F427336

General Info

Members Datasets Scaffolds Average Seq Length
376 205 752 200

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10968676|Ga0114129_109686762
Length 230
Sequence MPSKKKLKSDGRKKESRTALSFMTLEPYERRQGCLGSQEGNSMALSSTHEVTRLLIAWGEGNEAALDKLTPLVFQELRRLAKRYMRRENADHTLQATALVNEAYLRLVKQKNVRWQNRAHFFAISAQLMRRILVDMARARRYGKRGGEARQVPLDEALVIPKERGEDLVALDDALKSLTEIDPRKSRVVELRFFGGLSVEETAEVLKISPDTVMRDWKMAKVWLLHELSK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 96.28
Stem 0
Stem Tuber 0
Unclassified 29.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10968676 3300009147 Bacteria 1073
2 JGI24034J26672_10003912 3300002239 Bacteria 2095
3 JGI25406J46586_10031770 3300003203 Bacteria 1971
4 Ga0065704_10001989 3300005289 Bacteria 6297
5 Ga0065704_10077259 3300005289 Bacteria 4798
6 Ga0065704_10122946 3300005289 Bacteria 1742
7 Ga0065712_10002347 3300005290 Bacteria 5108
8 Ga0065715_10130436 3300005293 Bacteria 2024
9 Ga0065715_10156062 3300005293 Bacteria 1676
10 Ga0065715_10279066 3300005293 Unclassified 1078
11 Ga0065707_10000667 3300005295 Bacteria 14388
12 Ga0065707_10001488 3300005295 Bacteria 6671
13 Ga0065707_10134573 3300005295 Unclassified 1863
14 Ga0070683_100177861 3300005329 Bacteria 2020
15 Ga0070690_100413831 3300005330 Bacteria 993
16 Ga0070670_100065325 3300005331 Bacteria 3122
17 Ga0070677_10122473 3300005333 Bacteria 1176
18 Ga0068869_100014187 3300005334 Bacteria 5320
19 Ga0068869_100218756 3300005334 Unclassified 1509
20 Ga0070666_10456563 3300005335 Bacteria 923
21 Ga0068868_100110120 3300005338 Bacteria 2237
22 Ga0070689_100005072 3300005340 Bacteria 8957
23 Ga0070689_100026788 3300005340 Bacteria 4342
24 Ga0070689_100112691 3300005340 Bacteria 2165
25 Ga0070689_100124859 3300005340 Unclassified 2059
26 Ga0070691_10080907 3300005341 Unclassified 1590
27 Ga0070687_100144626 3300005343 Bacteria 1388
28 Ga0070687_100279675 3300005343 Unclassified 1050
29 Ga0070692_10118425 3300005345 Bacteria 1473
30 Ga0070692_10250283 3300005345 Bacteria 1060
31 Ga0070668_100300434 3300005347 Unclassified 1346
32 Ga0070668_100510262 3300005347 Unclassified 1042
33 Ga0070669_100025460 3300005353 Bacteria 4250
34 Ga0070669_100063971 3300005353 Unclassified 2708
35 Ga0070669_100083605 3300005353 Bacteria 2381
36 Ga0070669_100643767 3300005353 Unclassified 891
37 Ga0070675_100002736 3300005354 Bacteria 13256
38 Ga0070675_100002966 3300005354 Bacteria 12811
39 Ga0070675_100018220 3300005354 Bacteria 5589
40 Ga0070675_100083068 3300005354 Unclassified 2673
41 Ga0070675_100218854 3300005354 Bacteria 1658
42 Ga0070675_100488762 3300005354 Unclassified 1108
43 Ga0070671_100303070 3300005355 Bacteria 1361
44 Ga0070673_100211720 3300005364 Bacteria 1674
45 Ga0070688_100019177 3300005365 Bacteria 3961
46 Ga0070688_100024608 3300005365 Bacteria 3555
47 Ga0070688_100132698 3300005365 Bacteria 1682
48 Ga0070659_100659784 3300005366 Unclassified 902
49 Ga0070667_100071721 3300005367 Bacteria 2950
50 Ga0070713_100211673 3300005436 Bacteria 1755
51 Ga0070701_10012161 3300005438 Unclassified 3873
52 Ga0070701_10084213 3300005438 Bacteria 1729
53 Ga0070701_10113153 3300005438 Bacteria 1519
54 Ga0070705_100132186 3300005440 Bacteria 1630
55 Ga0070705_100544125 3300005440 Unclassified 889
56 Ga0070700_100013186 3300005441 Bacteria 4637
57 Ga0070700_100563876 3300005441 Bacteria 887
58 Ga0070694_100016330 3300005444 Unclassified 4674
59 Ga0070694_100790071 3300005444 Unclassified 778
60 Ga0070694_100977454 3300005444 Unclassified 702
61 Ga0070708_100083913 3300005445 Bacteria 2889
62 Ga0070708_100109073 3300005445 Unclassified 2543
63 Ga0070708_100495967 3300005445 Bacteria 1152
64 Ga0070708_100512677 3300005445 Bacteria 1131
65 Ga0070663_100383384 3300005455 Unclassified 1145
66 Ga0070678_100097266 3300005456 Bacteria 2273
67 Ga0070678_100225171 3300005456 Bacteria 1561
68 Ga0070662_100102891 3300005457 Unclassified 2165
69 Ga0068867_100080021 3300005459 Bacteria 2460
70 Ga0070706_100104342 3300005467 Bacteria 2636
71 Ga0070706_100384398 3300005467 Bacteria 1307
72 Ga0070707_100000073 3300005468 Bacteria 90649
73 Ga0070707_100000201 3300005468 Bacteria 59927
74 Ga0070707_100074233 3300005468 Unclassified 3279
75 Ga0070707_100610512 3300005468 Bacteria 1053
76 Ga0070707_100654534 3300005468 Bacteria 1013
77 Ga0070698_100043150 3300005471 Bacteria 4625
78 Ga0070699_100002735 3300005518 Bacteria 15724
79 Ga0070699_100012490 3300005518 Bacteria 7328
80 Ga0070699_100193371 3300005518 Bacteria 1808
81 Ga0070684_100476523 3300005535 Bacteria 1155
82 Ga0070697_100167750 3300005536 Bacteria 1857
83 Ga0070672_100028899 3300005543 Unclassified 4151
84 Ga0070672_100105080 3300005543 Unclassified 2296
85 Ga0070686_100244315 3300005544 Unclassified 1308
86 Ga0070686_100839905 3300005544 Unclassified 743
87 Ga0070695_100150863 3300005545 Bacteria 1622
88 Ga0070695_100159332 3300005545 Unclassified 1583
89 Ga0070696_101118947 3300005546 Unclassified 663
90 Ga0070693_100002265 3300005547 Bacteria 8817
91 Ga0068857_100083296 3300005577 Unclassified 2857
92 Ga0068854_100065455 3300005578 Unclassified 2642
93 Ga0068856_100382826 3300005614 Bacteria 1426
94 Ga0070702_100047782 3300005615 Bacteria 2432
95 Ga0070702_100084549 3300005615 Unclassified 1908
96 Ga0070702_100451996 3300005615 Unclassified 932
97 Ga0068852_100639061 3300005616 Unclassified 1071
98 Ga0068859_100006578 3300005617 Bacteria 11794
99 Ga0068859_100006710 3300005617 Bacteria 11690
100 Ga0068859_100161302 3300005617 Bacteria 2321
101 Ga0068864_100009487 3300005618 Bacteria 8031
102 Ga0068864_100026099 3300005618 Unclassified 4924
103 Ga0068866_10005755 3300005718 Bacteria 5137
104 Ga0068861_100545206 3300005719 Bacteria 1056
105 Ga0068861_100584563 3300005719 Unclassified 1023
106 Ga0068870_10011518 3300005840 Bacteria 4103
107 Ga0068870_10249804 3300005840 Bacteria 1099
108 Ga0068863_100124553 3300005841 Unclassified 2458
109 Ga0068863_100125829 3300005841 Bacteria 2445
110 Ga0068863_100181522 3300005841 Bacteria 2020
111 Ga0068863_100279427 3300005841 Bacteria 1617
112 Ga0068863_100480517 3300005841 Bacteria 1222
113 Ga0068858_100037129 3300005842 Bacteria 4516
114 Ga0068858_100225784 3300005842 Bacteria 1774
115 Ga0068858_100228315 3300005842 Bacteria 1764
116 Ga0068860_100015142 3300005843 Bacteria 7536
117 Ga0068860_100272082 3300005843 Bacteria 1653
118 Ga0068862_100039787 3300005844 Bacteria 3994
119 Ga0068862_100368222 3300005844 Unclassified 1337
120 Ga0081455_10619483 3300005937 Unclassified 702
121 Ga0081539_10001414 3300005985 Bacteria 41289
122 Ga0081539_10029323 3300005985 Bacteria 3439
123 Ga0070717_10476906 3300006028 Bacteria 1126
124 Ga0097621_100015492 3300006237 Bacteria 5738
125 Ga0097621_100023479 3300006237 Bacteria 4803
126 Ga0068871_100073341 3300006358 Bacteria 2821
127 Ga0075428_100094353 3300006844 Bacteria 3263
128 Ga0075428_100190381 3300006844 Unclassified 2219
129 Ga0075428_100558071 3300006844 Bacteria 1224
130 Ga0075430_100062657 3300006846 Bacteria 3123
131 Ga0075430_100487238 3300006846 Bacteria 1017
132 Ga0075430_100681286 3300006846 Bacteria 847
133 Ga0075431_100002835 3300006847 Bacteria 16771
134 Ga0075431_100080625 3300006847 Bacteria 3360
135 Ga0075431_100445358 3300006847 Bacteria 1291
136 Ga0075431_100840802 3300006847 Unclassified 890
137 Ga0075434_100995183 3300006871 Bacteria 852
138 Ga0075429_100001991 3300006880 Bacteria 16979
139 Ga0068865_100126495 3300006881 Bacteria 1908
140 Ga0068865_100368528 3300006881 Bacteria 1168
141 Ga0097620_100006578 3300006931 Bacteria 11794
142 Ga0097620_100006711 3300006931 Bacteria 11690
143 Ga0097620_100161298 3300006931 Bacteria 2321
144 Ga0075435_100197296 3300007076 Bacteria 1705
145 Ga0075435_100410126 3300007076 Bacteria 1166
146 Ga0099794_10192478 3300007265 Unclassified 1043
147 Ga0105240_10279010 3300009093 Bacteria 1920
148 Ga0111539_10018334 3300009094 Bacteria 8670
149 Ga0111539_10060779 3300009094 Bacteria 4477
150 Ga0111539_10073449 3300009094 Bacteria 4033
151 Ga0111539_10087295 3300009094 Bacteria 3665
152 Ga0111539_10199473 3300009094 Bacteria 2333
153 Ga0111539_10714967 3300009094 Unclassified 1166
154 Ga0105245_10066234 3300009098 Bacteria 3269
155 Ga0105245_11109005 3300009098 Unclassified 838
156 Ga0114129_10006040 3300009147 Bacteria 17170
157 Ga0114129_10018093 3300009147 Bacteria 10038
158 Ga0114129_10055636 3300009147 Bacteria 5544
159 Ga0114129_10207372 3300009147 Unclassified 2651
160 Ga0114129_10243739 3300009147 Bacteria 2415
161 Ga0114129_10266987 3300009147 Bacteria 2291
162 Ga0114129_10323223 3300009147 Bacteria 2051
163 Ga0114129_10445464 3300009147 Bacteria 1699
164 Ga0114129_10666457 3300009147 Unclassified 1341
165 Ga0114129_10841093 3300009147 Bacteria 1168
166 Ga0105241_10112278 3300009174 Unclassified 2183
167 Ga0105241_10614762 3300009174 Bacteria 983
168 Ga0105242_10075035 3300009176 Bacteria 2814
169 Ga0105248_10591931 3300009177 Bacteria 1251
170 Ga0105248_10782585 3300009177 Bacteria 1077
171 Ga0105237_10019385 3300009545 Bacteria 7026
172 Ga0105237_11045846 3300009545 Bacteria 823
173 Ga0105249_10020820 3300009553 Bacteria 5865
174 Ga0105249_10112163 3300009553 Bacteria 2579
175 Ga0105249_10422240 3300009553 Bacteria 1367
176 Ga0105249_10545697 3300009553 Unclassified 1209
177 Ga0105239_10273351 3300010375 Unclassified 1901
178 Ga0105239_10675589 3300010375 Bacteria 1180
179 Ga0105246_10497228 3300011119 Unclassified 1035
180 Ga0157345_1002364 3300012498 Unclassified 1330
181 Ga0157370_10013010 3300013104 Bacteria 8596
182 Ga0157374_10540340 3300013296 Unclassified 1173
183 Ga0157378_10109323 3300013297 Unclassified 2532
184 Ga0163162_10459371 3300013306 Unclassified 1405
185 Ga0157372_10041386 3300013307 Bacteria 5095
186 Ga0157375_10038863 3300013308 Bacteria 4573
187 Ga0157375_10172710 3300013308 Unclassified 2310
188 Ga0157375_10537537 3300013308 Bacteria 1331
189 Ga0163163_10023993 3300014325 Bacteria 5801
190 Ga0163163_10321961 3300014325 Unclassified 1600
191 Ga0163163_10448979 3300014325 Unclassified 1349
192 Ga0157380_10044307 3300014326 Bacteria 3486
193 Ga0157380_10044431 3300014326 Unclassified 3482
194 Ga0157380_10063025 3300014326 Bacteria 2972
195 Ga0182008_10269181 3300014497 Unclassified 883
196 Ga0157377_10040778 3300014745 Bacteria 2572
197 Ga0157377_10057517 3300014745 Unclassified 2212
198 Ga0157377_10274908 3300014745 Bacteria 1102
199 Ga0157379_10315662 3300014968 Bacteria 1426
200 Ga0157376_10018796 3300014969 Bacteria 5310
201 Ga0157376_10384739 3300014969 Bacteria 1352
202 Ga0163161_10043913 3300017792 Unclassified 3218
203 Ga0213876_10134147 3300021384 Unclassified 1317
204 Ga0213876_10173353 3300021384 Unclassified 1148
205 Ga0213875_10000024 3300021388 Bacteria 200333
206 Ga0207697_10151764 3300025315 Unclassified 1008
207 Ga0207682_10139619 3300025893 Unclassified 1087
208 Ga0207680_10292364 3300025903 Bacteria 1134
209 Ga0207643_10128623 3300025908 Bacteria 1505
210 Ga0207643_10172482 3300025908 Bacteria 1306
211 Ga0207684_10064845 3300025910 Bacteria 3101
212 Ga0207654_10066280 3300025911 Bacteria 2129
213 Ga0207654_10322916 3300025911 Unclassified 1056
214 Ga0207707_10523669 3300025912 Unclassified 1009
215 Ga0207695_10548012 3300025913 Bacteria 1038
216 Ga0207671_10005875 3300025914 Bacteria 11141
217 Ga0207662_10008223 3300025918 Bacteria 5707
218 Ga0207646_10000362 3300025922 Bacteria 61074
219 Ga0207646_10074315 3300025922 Bacteria 3036
220 Ga0207646_10536519 3300025922 Bacteria 1053
221 Ga0207646_10891067 3300025922 Bacteria 790
222 Ga0207681_10133667 3300025923 Bacteria 1837
223 Ga0207681_10192855 3300025923 Bacteria 1560
224 Ga0207659_10000681 3300025926 Bacteria 20176
225 Ga0207659_10007083 3300025926 Bacteria 6886
226 Ga0207659_10035799 3300025926 Bacteria 3434
227 Ga0207687_10408168 3300025927 Bacteria 1119
228 Ga0207700_10556065 3300025928 Unclassified 1019
229 Ga0207644_10402452 3300025931 Unclassified 1119
230 Ga0207706_10256479 3300025933 Bacteria 1527
231 Ga0207686_10070490 3300025934 Bacteria 2246
232 Ga0207670_10146809 3300025936 Bacteria 1745
233 Ga0207704_10110541 3300025938 Bacteria 1857
234 Ga0207704_10425106 3300025938 Unclassified 1054
235 Ga0207691_10001519 3300025940 Bacteria 23086
236 Ga0207691_10279670 3300025940 Bacteria 1436
237 Ga0207689_10007996 3300025942 Bacteria 9237
238 Ga0207651_10058825 3300025960 Bacteria 2658
239 Ga0207712_10177896 3300025961 Unclassified 1668
240 Ga0207712_10572625 3300025961 Bacteria 974
241 Ga0207640_10044296 3300025981 Unclassified 2850
242 Ga0207658_10086031 3300025986 Bacteria 2423
243 Ga0207677_10079485 3300026023 Bacteria 2345
244 Ga0207677_10090935 3300026023 Unclassified 2219
245 Ga0207677_10674221 3300026023 Unclassified 915
246 Ga0207703_10073609 3300026035 Unclassified 2827
247 Ga0207703_10193695 3300026035 Bacteria 1802
248 Ga0207639_10183009 3300026041 Bacteria 1784
249 Ga0207639_10478187 3300026041 Bacteria 1135
250 Ga0207708_10024352 3300026075 Bacteria 4579
251 Ga0207708_10390690 3300026075 Unclassified 1148
252 Ga0207641_10047520 3300026088 Bacteria 3619
253 Ga0207641_10055469 3300026088 Unclassified 3365
254 Ga0207641_10210661 3300026088 Bacteria 1797
255 Ga0207641_10366398 3300026088 Unclassified 1377
256 Ga0207641_10380557 3300026088 Bacteria 1351
257 Ga0207648_10027471 3300026089 Bacteria 5051
258 Ga0207648_11071962 3300026089 Unclassified 755
259 Ga0207676_10042547 3300026095 Bacteria 3494
260 Ga0207676_10123275 3300026095 Unclassified 2189
261 Ga0207675_100155871 3300026118 Bacteria 2176
262 Ga0207675_100157414 3300026118 Bacteria 2165
263 Ga0207675_100238879 3300026118 Bacteria 1755
264 Ga0207683_10480988 3300026121 Bacteria 1146
265 Ga0207428_10006978 3300027907 Bacteria 10350
266 Ga0207428_10058533 3300027907 Bacteria 3057
267 Ga0268266_10169244 3300028379 Bacteria 1982
268 Ga0268265_10282824 3300028380 Bacteria 1485
269 Ga0268265_10284881 3300028380 Bacteria 1480
270 Ga0268265_10302608 3300028380 Bacteria 1440
271 Ga0268265_10349860 3300028380 Bacteria 1349
272 Ga0268265_10674291 3300028380 Bacteria 996
273 Ga0268264_10006268 3300028381 Bacteria 10031
274 Ga0265338_10091406 3300028800 Bacteria 2515
275 Ga0265331_10042816 3300031250 Bacteria 2195
276 Ga0265316_10173740 3300031344 Unclassified 1606
277 Ga0265314_10135503 3300031711 Bacteria 1530
278 Ga0307409_100732871 3300031995 Bacteria 991
279 Ga0307416_100290133 3300032002 Bacteria 1619
280 Ga0373951_0037484 3300035091 Unclassified 1160
281 Ga0373932_0021888 3300035112 Bacteria 1692
282 Ga0373945_0439589 3300035116 Unclassified 576
283 Ga0373931_0158784 3300035691 Unclassified 1324
284 Ga0316582_0692284 3300036647 Unclassified 700
285 Ga0436364_0419719 3300037853 Unclassified 2358
286 Ga0436364_0902289 3300037853 Unclassified 860
287 Ga0436364_1053076 3300037853 Unclassified 1002
288 Ga0436364_1265330 3300037853 Bacteria 89074
289 Ga0436365_0014821 3300039437 Bacteria 893
290 Ga0436365_0371875 3300039437 Unclassified 1661
291 Ga0436365_1813885 3300039437 Bacteria 10796
292 Ga0436365_1932093 3300039437 Bacteria 1446
293 Ga0436363_1071224 3300039450 Unclassified 800
294 Ga0453683_0003465 3300044673 Bacteria 11618
295 Ga0453683_0019745 3300044673 Unclassified 4313
296 Ga0466970_0396420 3300044765 Unclassified 787
297 Ga0466959_0070495 3300045049 Unclassified 2532
298 Ga0451576_0133733 3300045051 Bacteria 2585
299 Ga0466958_0087007 3300045836 Unclassified 1929
300 Ga0466958_0312979 3300045836 Bacteria 1009
301 Ga0495629_0001587 3300046459 Bacteria 17875
302 Ga0495580_0107806 3300046472 Bacteria 1934
303 Ga0495663_0015885 3300046525 Unclassified 2125
304 Ga0495642_0027018 3300046528 Bacteria 2282
305 Ga0495598_0045507 3300046537 Bacteria 1301
306 Ga0495598_0167643 3300046537 Bacteria 776
307 Ga0495609_0172676 3300046538 Unclassified 912
308 Ga0495622_0033112 3300046557 Unclassified 2413
309 Ga0495635_0128060 3300046663 Unclassified 1731
310 Ga0495659_0058601 3300046664 Bacteria 1417
311 Ga0495659_0104175 3300046664 Bacteria 1102
312 Ga0495588_0315959 3300046674 Unclassified 822
313 Ga0495658_0014113 3300046683 Unclassified 4074
314 Ga0495604_0003191 3300047317 Bacteria 13102
315 Ga0495636_0270985 3300047318 Bacteria 789
316 Ga0495674_0020725 3300047319 Bacteria 6087
317 Ga0495676_0068396 3300047321 Bacteria 2744
318 Ga0495680_0181539 3300047322 Bacteria 1519
319 Ga0495685_053761 3300047447 Bacteria 1363
320 Ga0495684_0361563 3300047471 Unclassified 1028
321 Ga0495602_0010085 3300048088 Bacteria 9805
322 Ga0496104_0356275 3300048907 Bacteria 1376
323 Ga0496109_0008753 3300048912 Bacteria 8617
324 Ga0501038_0119734 3300049574 Bacteria 2173
325 Ga0501039_0046435 3300049575 Bacteria 3355
326 Ga0501041_0051349 3300049577 Bacteria 2513
327 Ga0501046_0379018 3300049580 Bacteria 1024
328 Ga0501048_0113233 3300049582 Bacteria 1916
329 Ga0501048_0368844 3300049582 Bacteria 1025
330 Ga0501071_0020890 3300049587 Bacteria 4555
331 Ga0501071_0143181 3300049587 Bacteria 1781
332 Ga0501072_0183630 3300049588 Bacteria 1668
333 Ga0501074_0630480 3300049590 Bacteria 758
334 Ga0501075_0027022 3300049591 Bacteria 4228
335 Ga0501076_0050197 3300049592 Bacteria 3300
336 Ga0501076_0254170 3300049592 Bacteria 1438
337 Ga0501077_0229277 3300049593 Bacteria 1181
338 Ga0501079_0030179 3300049741 Bacteria 4166
339 Ga0501080_0550861 3300049742 Bacteria 1027
340 Ga0501045_0026865 3300049824 Bacteria 4143
341 Ga0501045_0231751 3300049824 Bacteria 1375
342 nmdc:mga05p37_170372_c1 3300050507 Unclassified 2655
343 nmdc:mga05p37_178116_c1 3300050507 Unclassified 2589
344 nmdc:mga05p37_353070_c1 3300050507 Unclassified 1731
345 nmdc:mga05p37_501278_c2 3300050507 Bacteria 1073
346 nmdc:mga05p37_50263_c1 3300050507 Bacteria 5127
347 nmdc:mga05p37_562885_c1 3300050507 Bacteria 1295
348 nmdc:mga05p37_7953_c1 3300050507 Bacteria 12514
349 nmdc:mga09592_29058_c1 3300050508 Unclassified 4598
350 nmdc:mga09592_472776_c1 3300050508 Unclassified 1080
351 nmdc:mga09592_88131_c1 3300050508 Bacteria 2650
352 nmdc:mga0qj67_12290_c1 3300050509 Bacteria 6447
353 nmdc:mga0qj67_295591_c1 3300050509 Bacteria 1312
354 nmdc:mga0qj67_645836_c1 3300050509 Bacteria 844
355 nmdc:mga06r32_109828_c1 3300050510 Bacteria 2712
356 nmdc:mga06r32_1370490_c1 3300050510 Unclassified 650
357 nmdc:mga06r32_165725_c1 3300050510 Bacteria 2193
358 nmdc:mga06r32_178484_c1 3300050510 Unclassified 2109
359 nmdc:mga06r32_569959_c1 3300050510 Bacteria 1105
360 nmdc:mga06r32_751153_c1 3300050510 Unclassified 939
361 nmdc:mga06r32_99763_c1 3300050510 Bacteria 2848
362 nmdc:mga08y16_114526_c1 3300050511 Bacteria 2807
363 nmdc:mga08y16_20490_c1 3300050511 Bacteria 6981
364 nmdc:mga08y16_277980_c1 3300050511 Bacteria 1728
365 nmdc:mga08y16_345669_c1 3300050511 Bacteria 1529
366 nmdc:mga08y16_44093_c1 3300050511 Bacteria 4673
367 nmdc:mga0n895_204136_c1 3300050512 Unclassified 2007
368 nmdc:mga0rr50_222654_c1 3300050513 Bacteria 1558
369 nmdc:mga0a205_247231_c1 3300050515 Unclassified 1664
370 nmdc:mga0a205_3702_c1 3300050515 Bacteria 13679
371 nmdc:mga0a205_88287_c1 3300050515 Unclassified 2996
372 Ga0501084_0045429 3300054114 Bacteria 3677
373 Ga0501082_0040648 3300060353 Bacteria 4010
374 Ga0501082_0369130 3300060353 Bacteria 1252
375 Ga0501082_0883586 3300060353 Bacteria 782
376 Ga0530510_0134548 3300061734 Bacteria 1819
377 Ga0114129_10968676
378 JGI24034J26672_10003912
379 JGI25406J46586_10031770
380 Ga0065704_10001989
381 Ga0065704_10077259
382 Ga0065704_10122946
383 Ga0065712_10002347
384 Ga0065715_10130436
385 Ga0065715_10156062
386 Ga0065715_10279066
387 Ga0065707_10000667
388 Ga0065707_10001488
389 Ga0065707_10134573
390 Ga0070683_100177861
391 Ga0070690_100413831
392 Ga0070670_100065325
393 Ga0070677_10122473
394 Ga0068869_100014187
395 Ga0068869_100218756
396 Ga0070666_10456563
397 Ga0068868_100110120
398 Ga0070689_100005072
399 Ga0070689_100026788
400 Ga0070689_100112691
401 Ga0070689_100124859
402 Ga0070691_10080907
403 Ga0070687_100144626
404 Ga0070687_100279675
405 Ga0070692_10118425
406 Ga0070692_10250283
407 Ga0070668_100300434
408 Ga0070668_100510262
409 Ga0070669_100025460
410 Ga0070669_100063971
411 Ga0070669_100083605
412 Ga0070669_100643767
413 Ga0070675_100002736
414 Ga0070675_100002966
415 Ga0070675_100018220
416 Ga0070675_100083068
417 Ga0070675_100218854
418 Ga0070675_100488762
419 Ga0070671_100303070
420 Ga0070673_100211720
421 Ga0070688_100019177
422 Ga0070688_100024608
423 Ga0070688_100132698
424 Ga0070659_100659784
425 Ga0070667_100071721
426 Ga0070713_100211673
427 Ga0070701_10012161
428 Ga0070701_10084213
429 Ga0070701_10113153
430 Ga0070705_100132186
431 Ga0070705_100544125
432 Ga0070700_100013186
433 Ga0070700_100563876
434 Ga0070694_100016330
435 Ga0070694_100790071
436 Ga0070694_100977454
437 Ga0070708_100083913
438 Ga0070708_100109073
439 Ga0070708_100495967
440 Ga0070708_100512677
441 Ga0070663_100383384
442 Ga0070678_100097266
443 Ga0070678_100225171
444 Ga0070662_100102891
445 Ga0068867_100080021
446 Ga0070706_100104342
447 Ga0070706_100384398
448 Ga0070707_100000073
449 Ga0070707_100000201
450 Ga0070707_100074233
451 Ga0070707_100610512
452 Ga0070707_100654534
453 Ga0070698_100043150
454 Ga0070699_100002735
455 Ga0070699_100012490
456 Ga0070699_100193371
457 Ga0070684_100476523
458 Ga0070697_100167750
459 Ga0070672_100028899
460 Ga0070672_100105080
461 Ga0070686_100244315
462 Ga0070686_100839905
463 Ga0070695_100150863
464 Ga0070695_100159332
465 Ga0070696_101118947
466 Ga0070693_100002265
467 Ga0068857_100083296
468 Ga0068854_100065455
469 Ga0068856_100382826
470 Ga0070702_100047782
471 Ga0070702_100084549
472 Ga0070702_100451996
473 Ga0068852_100639061
474 Ga0068859_100006578
475 Ga0068859_100006710
476 Ga0068859_100161302
477 Ga0068864_100009487
478 Ga0068864_100026099
479 Ga0068866_10005755
480 Ga0068861_100545206
481 Ga0068861_100584563
482 Ga0068870_10011518
483 Ga0068870_10249804
484 Ga0068863_100124553
485 Ga0068863_100125829
486 Ga0068863_100181522
487 Ga0068863_100279427
488 Ga0068863_100480517
489 Ga0068858_100037129
490 Ga0068858_100225784
491 Ga0068858_100228315
492 Ga0068860_100015142
493 Ga0068860_100272082
494 Ga0068862_100039787
495 Ga0068862_100368222
496 Ga0081455_10619483
497 Ga0081539_10001414
498 Ga0081539_10029323
499 Ga0070717_10476906
500 Ga0097621_100015492
501 Ga0097621_100023479
502 Ga0068871_100073341
503 Ga0075428_100094353
504 Ga0075428_100190381
505 Ga0075428_100558071
506 Ga0075430_100062657
507 Ga0075430_100487238
508 Ga0075430_100681286
509 Ga0075431_100002835
510 Ga0075431_100080625
511 Ga0075431_100445358
512 Ga0075431_100840802
513 Ga0075434_100995183
514 Ga0075429_100001991
515 Ga0068865_100126495
516 Ga0068865_100368528
517 Ga0097620_100006578
518 Ga0097620_100006711
519 Ga0097620_100161298
520 Ga0075435_100197296
521 Ga0075435_100410126
522 Ga0099794_10192478
523 Ga0105240_10279010
524 Ga0111539_10018334
525 Ga0111539_10060779
526 Ga0111539_10073449
527 Ga0111539_10087295
528 Ga0111539_10199473
529 Ga0111539_10714967
530 Ga0105245_10066234
531 Ga0105245_11109005
532 Ga0114129_10006040
533 Ga0114129_10018093
534 Ga0114129_10055636
535 Ga0114129_10207372
536 Ga0114129_10243739
537 Ga0114129_10266987
538 Ga0114129_10323223
539 Ga0114129_10445464
540 Ga0114129_10666457
541 Ga0114129_10841093
542 Ga0105241_10112278
543 Ga0105241_10614762
544 Ga0105242_10075035
545 Ga0105248_10591931
546 Ga0105248_10782585
547 Ga0105237_10019385
548 Ga0105237_11045846
549 Ga0105249_10020820
550 Ga0105249_10112163
551 Ga0105249_10422240
552 Ga0105249_10545697
553 Ga0105239_10273351
554 Ga0105239_10675589
555 Ga0105246_10497228
556 Ga0157345_1002364
557 Ga0157370_10013010
558 Ga0157374_10540340
559 Ga0157378_10109323
560 Ga0163162_10459371
561 Ga0157372_10041386
562 Ga0157375_10038863
563 Ga0157375_10172710
564 Ga0157375_10537537
565 Ga0163163_10023993
566 Ga0163163_10321961
567 Ga0163163_10448979
568 Ga0157380_10044307
569 Ga0157380_10044431
570 Ga0157380_10063025
571 Ga0182008_10269181
572 Ga0157377_10040778
573 Ga0157377_10057517
574 Ga0157377_10274908
575 Ga0157379_10315662
576 Ga0157376_10018796
577 Ga0157376_10384739
578 Ga0163161_10043913
579 Ga0213876_10134147
580 Ga0213876_10173353
581 Ga0213875_10000024
582 Ga0207697_10151764
583 Ga0207682_10139619
584 Ga0207680_10292364
585 Ga0207643_10128623
586 Ga0207643_10172482
587 Ga0207684_10064845
588 Ga0207654_10066280
589 Ga0207654_10322916
590 Ga0207707_10523669
591 Ga0207695_10548012
592 Ga0207671_10005875
593 Ga0207662_10008223
594 Ga0207646_10000362
595 Ga0207646_10074315
596 Ga0207646_10536519
597 Ga0207646_10891067
598 Ga0207681_10133667
599 Ga0207681_10192855
600 Ga0207659_10000681
601 Ga0207659_10007083
602 Ga0207659_10035799
603 Ga0207687_10408168
604 Ga0207700_10556065
605 Ga0207644_10402452
606 Ga0207706_10256479
607 Ga0207686_10070490
608 Ga0207670_10146809
609 Ga0207704_10110541
610 Ga0207704_10425106
611 Ga0207691_10001519
612 Ga0207691_10279670
613 Ga0207689_10007996
614 Ga0207651_10058825
615 Ga0207712_10177896
616 Ga0207712_10572625
617 Ga0207640_10044296
618 Ga0207658_10086031
619 Ga0207677_10079485
620 Ga0207677_10090935
621 Ga0207677_10674221
622 Ga0207703_10073609
623 Ga0207703_10193695
624 Ga0207639_10183009
625 Ga0207639_10478187
626 Ga0207708_10024352
627 Ga0207708_10390690
628 Ga0207641_10047520
629 Ga0207641_10055469
630 Ga0207641_10210661
631 Ga0207641_10366398
632 Ga0207641_10380557
633 Ga0207648_10027471
634 Ga0207648_11071962
635 Ga0207676_10042547
636 Ga0207676_10123275
637 Ga0207675_100155871
638 Ga0207675_100157414
639 Ga0207675_100238879
640 Ga0207683_10480988
641 Ga0207428_10006978
642 Ga0207428_10058533
643 Ga0268266_10169244
644 Ga0268265_10282824
645 Ga0268265_10284881
646 Ga0268265_10302608
647 Ga0268265_10349860
648 Ga0268265_10674291
649 Ga0268264_10006268
650 Ga0265338_10091406
651 Ga0265331_10042816
652 Ga0265316_10173740
653 Ga0265314_10135503
654 Ga0307409_100732871
655 Ga0307416_100290133
656 Ga0373951_0037484
657 Ga0373932_0021888
658 Ga0373945_0439589
659 Ga0373931_0158784
660 Ga0316582_0692284
661 Ga0436364_0419719
662 Ga0436364_0902289
663 Ga0436364_1053076
664 Ga0436364_1265330
665 Ga0436365_0014821
666 Ga0436365_0371875
667 Ga0436365_1813885
668 Ga0436365_1932093
669 Ga0436363_1071224
670 Ga0453683_0003465
671 Ga0453683_0019745
672 Ga0466970_0396420
673 Ga0466959_0070495
674 Ga0451576_0133733
675 Ga0466958_0087007
676 Ga0466958_0312979
677 Ga0495629_0001587
678 Ga0495580_0107806
679 Ga0495663_0015885
680 Ga0495642_0027018
681 Ga0495598_0045507
682 Ga0495598_0167643
683 Ga0495609_0172676
684 Ga0495622_0033112
685 Ga0495635_0128060
686 Ga0495659_0058601
687 Ga0495659_0104175
688 Ga0495588_0315959
689 Ga0495658_0014113
690 Ga0495604_0003191
691 Ga0495636_0270985
692 Ga0495674_0020725
693 Ga0495676_0068396
694 Ga0495680_0181539
695 Ga0495685_053761
696 Ga0495684_0361563
697 Ga0495602_0010085
698 Ga0496104_0356275
699 Ga0496109_0008753
700 Ga0501038_0119734
701 Ga0501039_0046435
702 Ga0501041_0051349
703 Ga0501046_0379018
704 Ga0501048_0113233
705 Ga0501048_0368844
706 Ga0501071_0020890
707 Ga0501071_0143181
708 Ga0501072_0183630
709 Ga0501074_0630480
710 Ga0501075_0027022
711 Ga0501076_0050197
712 Ga0501076_0254170
713 Ga0501077_0229277
714 Ga0501079_0030179
715 Ga0501080_0550861
716 Ga0501045_0026865
717 Ga0501045_0231751
718 nmdc:mga05p37_170372_c1
719 nmdc:mga05p37_178116_c1
720 nmdc:mga05p37_353070_c1
721 nmdc:mga05p37_501278_c2
722 nmdc:mga05p37_50263_c1
723 nmdc:mga05p37_562885_c1
724 nmdc:mga05p37_7953_c1
725 nmdc:mga09592_29058_c1
726 nmdc:mga09592_472776_c1
727 nmdc:mga09592_88131_c1
728 nmdc:mga0qj67_12290_c1
729 nmdc:mga0qj67_295591_c1
730 nmdc:mga0qj67_645836_c1
731 nmdc:mga06r32_109828_c1
732 nmdc:mga06r32_1370490_c1
733 nmdc:mga06r32_165725_c1
734 nmdc:mga06r32_178484_c1
735 nmdc:mga06r32_569959_c1
736 nmdc:mga06r32_751153_c1
737 nmdc:mga06r32_99763_c1
738 nmdc:mga08y16_114526_c1
739 nmdc:mga08y16_20490_c1
740 nmdc:mga08y16_277980_c1
741 nmdc:mga08y16_345669_c1
742 nmdc:mga08y16_44093_c1
743 nmdc:mga0n895_204136_c1
744 nmdc:mga0rr50_222654_c1
745 nmdc:mga0a205_247231_c1
746 nmdc:mga0a205_3702_c1
747 nmdc:mga0a205_88287_c1
748 Ga0501084_0045429
749 Ga0501082_0040648
750 Ga0501082_0369130
751 Ga0501082_0883586
752 Ga0530510_0134548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07638

Sigma70_ECF

ECF sigma factor

48

230

0.98

PF04545

Sigma70_r4

Sigma-70, region 4

174

215

0.9

PF08281

Sigma70_r4_2

Sigma-70, region 4

169

224

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4go1-assembly1.cif.gz_B-2 crystal structure of full length transcription repressor lsrr from e. coli. 0.9659 150 188
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9356 135 196
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9209 137 197
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9181 135 196
3hug-assembly6.cif.gz_A crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9171 135 196
ID Description Score Start End Superfamily
4nqwA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9225 136 194 1.10.10.10
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9215 135 196 1.10.10.10
3vdoA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9214 136 194 1.10.10.10
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9196 135 196 1.10.10.10
3hugA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9171 135 196 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A521ARL5-F1-model_v4 RNA polymerase, sigma subunit, ECF family 0.8852 12 195 GO:0006352
GO:0016987
AF-Q4QKY2-F1-model_v4 RNA polymerase sigma factor 0.8829 128 198 GO:0003677
GO:0060567
AF-A0A1Q4FNM0-F1-model_v4 RNA polymerase sigma-70 ECF-like HTH domain-containing protein 0.8716 9 194 GO:0006352
GO:0016987
AF-A0A521ARL5-F1-model_v4 RNA polymerase, sigma subunit, ECF family 0.8716 12 195 GO:0006352
GO:0016987
AF-A0A1Q4FNM0-F1-model_v4 RNA polymerase sigma-70 ECF-like HTH domain-containing protein 0.8627 9 194 GO:0006352
GO:0016987

Map