F427210

General Info

Members Datasets Scaffolds Average Seq Length
375 292 750 242

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2784746763|2785346669
Length 297
Sequence QGPSLRELAVQALSSVEHGYDLLAPKFDHTPFRTPDSILDAVERALTAMGPFDHGLDLCCGTGAGMEVLRELCRESATGVDISAGMLAVGRDRLTAGSGDRDRDRDRRDGDRDGDCDRDRDRRDGDRDGDCDRDRDGDCDRDRDGAAAGAPRLSWVRGDALALPFGPVFDLAVSFGAFGHFLPEQLPGLFAQVHSVLRPGGRFAFPLPAPAPPRSPWYWAALGFDAAMRVRNTVWRPPFVMYYRPFRLGLVRHELERAGFDVELFALPEFGPRPDGSPRCRMVVATRPHTPGHRAAR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
118 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
154 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
155 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
156 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
157 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
158 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
159 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
261 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
262 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
263 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
264 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
265 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
268 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
269 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
272 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
273 2643221714 Streptomyces sp. Root264 Isolate Unclassified
274 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
275 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
276 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
277 2808606448 Streptomyces sp. 193411 Isolate Unclassified
278 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
279 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
280 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
281 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
282 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
283 2891562705 Microbispora tritici MT50 Isolate Unclassified
284 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
285 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
286 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
287 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
288 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
289 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
290 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
291 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
292 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.87
Metatranscriptomes 0.27
Isolates 5.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 0
Rhizoplane 3.2
Rhizosphere 81.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10041928 3300001989 Bacteria 1520
2 JGI24737J22298_10037978 3300001990 Bacteria 1483
3 JGI24735J21928_10031487 3300002067 Bacteria 1572
4 JGI25160J50197_1001875 3300003354 Bacteria 10086
5 JGI25160J50197_1010007 3300003354 Bacteria 3464
6 JGI25160J50197_1016370 3300003354 Bacteria 2392
7 Ga0070658_10143212 3300005327 Bacteria 1997
8 Ga0070658_10789412 3300005327 Bacteria 825
9 Ga0070683_100151672 3300005329 Bacteria 2197
10 Ga0070683_100155276 3300005329 Bacteria 2170
11 Ga0070690_100423838 3300005330 Bacteria 982
12 Ga0070670_100874199 3300005331 Bacteria 814
13 Ga0068869_100220849 3300005334 Bacteria 1502
14 Ga0068869_100264233 3300005334 Bacteria 1378
15 Ga0070680_100312981 3300005336 Bacteria 1332
16 Ga0070682_100443011 3300005337 Bacteria 993
17 Ga0068868_100392954 3300005338 Bacteria 1195
18 Ga0070660_100435505 3300005339 Bacteria 1086
19 Ga0070689_100047040 3300005340 Bacteria 3326
20 Ga0070691_10026087 3300005341 Bacteria 2722
21 Ga0070661_100004677 3300005344 Bacteria 9428
22 Ga0070661_100009471 3300005344 Bacteria 6744
23 Ga0070692_10359727 3300005345 Bacteria 907
24 Ga0070668_100000153 3300005347 Bacteria 43911
25 Ga0070668_100253363 3300005347 Bacteria 1462
26 Ga0070675_100018826 3300005354 Bacteria 5497
27 Ga0070671_100161418 3300005355 Bacteria 1894
28 Ga0070673_100178914 3300005364 Bacteria 1815
29 Ga0070688_100165580 3300005365 Bacteria 1522
30 Ga0070667_100062208 3300005367 Bacteria 3161
31 Ga0070714_100009236 3300005435 Bacteria 7746
32 Ga0070710_10001000 3300005437 Bacteria 13458
33 Ga0070701_10185871 3300005438 Bacteria 1219
34 Ga0070711_100000506 3300005439 Bacteria 20277
35 Ga0070700_100106372 3300005441 Bacteria 1857
36 Ga0070694_100540865 3300005444 Bacteria 932
37 Ga0070663_100183056 3300005455 Bacteria 1626
38 Ga0070662_100103340 3300005457 Bacteria 2161
39 Ga0070681_10169206 3300005458 Bacteria 2107
40 Ga0070685_10123268 3300005466 Bacteria 1612
41 Ga0070679_100078216 3300005530 Bacteria 3297
42 Ga0070679_100080463 3300005530 Bacteria 3247
43 Ga0070684_100101775 3300005535 Bacteria 2567
44 Ga0070684_100382106 3300005535 Bacteria 1297
45 Ga0068853_100096344 3300005539 Bacteria 2610
46 Ga0070695_100061762 3300005545 Bacteria 2431
47 Ga0070696_100080093 3300005546 Bacteria 2311
48 Ga0070693_100143058 3300005547 Bacteria 1507
49 Ga0070665_100605912 3300005548 Bacteria 1108
50 Ga0070704_100179625 3300005549 Bacteria 1691
51 Ga0068855_100498527 3300005563 Bacteria 1323
52 Ga0070664_100549591 3300005564 Bacteria 1068
53 Ga0068857_100402027 3300005577 Bacteria 1275
54 Ga0068854_100289463 3300005578 Bacteria 1321
55 Ga0068856_100091681 3300005614 Bacteria 3023
56 Ga0070702_100044398 3300005615 Bacteria 2509
57 Ga0068852_100029721 3300005616 Bacteria 4491
58 Ga0068859_100296375 3300005617 Bacteria 1710
59 Ga0068861_100135289 3300005719 Bacteria 2005
60 Ga0068863_100191501 3300005841 Bacteria 1965
61 Ga0068860_100037196 3300005843 Bacteria 4659
62 Ga0068860_100103665 3300005843 Bacteria 2715
63 Ga0068862_100035373 3300005844 Bacteria 4230
64 Ga0081455_10153867 3300005937 Bacteria 1770
65 Ga0081540_1001373 3300005983 Bacteria 21131
66 Ga0081540_1012976 3300005983 Bacteria 5443
67 Ga0070717_10007059 3300006028 Bacteria 8320
68 Ga0070715_10051160 3300006163 Bacteria 1776
69 Ga0070716_100000972 3300006173 Bacteria 12455
70 Ga0070712_100001624 3300006175 Bacteria 13758
71 Ga0097621_100482588 3300006237 Bacteria 1120
72 Ga0068871_100034407 3300006358 Bacteria 4020
73 Ga0075430_100202298 3300006846 Bacteria 1649
74 Ga0068865_100340672 3300006881 Bacteria 1212
75 Ga0097620_100296372 3300006931 Bacteria 1710
76 Ga0075435_100076394 3300007076 Bacteria 2744
77 Ga0105251_10026224 3300009011 Bacteria 2969
78 Ga0105251_10120044 3300009011 Bacteria 1194
79 Ga0105240_10185853 3300009093 Bacteria 2448
80 Ga0114129_10589068 3300009147 Bacteria 1442
81 Ga0105243_10053917 3300009148 Bacteria 3190
82 Ga0105242_10470254 3300009176 Bacteria 1189
83 Ga0105248_10713423 3300009177 Bacteria 1132
84 Ga0105237_10151571 3300009545 Bacteria 2315
85 Ga0105249_10515960 3300009553 Bacteria 1242
86 Ga0105246_10024861 3300011119 Bacteria 3898
87 Ga0157341_1004902 3300012494 Bacteria 984
88 Ga0157373_10380309 3300013100 Bacteria 1010
89 Ga0157371_10039961 3300013102 Bacteria 3353
90 Ga0157369_10154879 3300013105 Bacteria 2421
91 Ga0157369_10222635 3300013105 Bacteria 1974
92 Ga0157374_10181311 3300013296 Bacteria 2057
93 Ga0157378_10251215 3300013297 Bacteria 1693
94 Ga0157378_10358529 3300013297 Bacteria 1426
95 Ga0163162_10286075 3300013306 Bacteria 1780
96 Ga0163162_11079263 3300013306 Bacteria 909
97 Ga0157375_10348834 3300013308 Bacteria 1646
98 Ga0157375_10557241 3300013308 Bacteria 1307
99 Ga0163163_10399059 3300014325 Bacteria 1433
100 Ga0163163_10917474 3300014325 Bacteria 939
101 Ga0157379_10292965 3300014968 Bacteria 1482
102 Ga0163161_10082162 3300017792 Bacteria 2374
103 Ga0206353_12014128 3300020082 Bacteria 967
104 Ga0224572_1022546 3300024225 Bacteria 1210
105 Ga0207426_1000560 3300025302 Bacteria 50872
106 Ga0207426_1000630 3300025302 Bacteria 44678
107 Ga0207426_1003221 3300025302 Bacteria 9159
108 Ga0207692_10001057 3300025898 Bacteria 10062
109 Ga0207647_10112267 3300025904 Bacteria 1611
110 Ga0207699_10000592 3300025906 Bacteria 17798
111 Ga0207643_10019216 3300025908 Bacteria 3743
112 Ga0207705_10182912 3300025909 Bacteria 1582
113 Ga0207705_10261524 3300025909 Bacteria 1321
114 Ga0207693_10000897 3300025915 Bacteria 26699
115 Ga0207663_10000800 3300025916 Bacteria 14130
116 Ga0207662_10078199 3300025918 Bacteria 2013
117 Ga0207657_10002225 3300025919 Bacteria 21047
118 Ga0207649_10046580 3300025920 Bacteria 2664
119 Ga0207652_10085428 3300025921 Bacteria 2765
120 Ga0207687_10138084 3300025927 Bacteria 1846
121 Ga0207700_10002351 3300025928 Bacteria 10857
122 Ga0207664_10001972 3300025929 Bacteria 13513
123 Ga0207706_10053612 3300025933 Bacteria 3559
124 Ga0207665_10003429 3300025939 Bacteria 10606
125 Ga0207689_10020922 3300025942 Bacteria 5500
126 Ga0207667_10255765 3300025949 Bacteria 1791
127 Ga0207651_10447401 3300025960 Bacteria 1108
128 Ga0207668_10007221 3300025972 Bacteria 6596
129 Ga0207658_10014180 3300025986 Bacteria 5459
130 Ga0207703_10246505 3300026035 Bacteria 1608
131 Ga0207678_10099952 3300026067 Bacteria 2478
132 Ga0207641_10431590 3300026088 Bacteria 1270
133 Ga0207674_10003306 3300026116 Bacteria 19815
134 Ga0207675_100043707 3300026118 Bacteria 4185
135 Ga0268265_10008875 3300028380 Bacteria 6795
136 Ga0268264_10044748 3300028381 Bacteria 3673
137 Ga0265337_1000407 3300028556 Bacteria 23020
138 Ga0265319_1012539 3300028563 Bacteria 3423
139 Ga0265336_10005120 3300028666 Bacteria 4873
140 Ga0307517_10002021 3300028786 Bacteria 33010
141 Ga0307517_10235562 3300028786 Bacteria 1093
142 Ga0307515_10000294 3300028794 Bacteria 123065
143 Ga0307515_10024434 3300028794 Bacteria 10530
144 Ga0307515_10302470 3300028794 Bacteria 1283
145 Ga0265338_10002106 3300028800 Bacteria 30708
146 Ga0265324_10005043 3300029957 Bacteria 5792
147 Ga0307511_10000740 3300030521 Bacteria 34869
148 Ga0307511_10011311 3300030521 Bacteria 8794
149 Ga0307512_10122725 3300030522 Bacteria 1661
150 Ga0265320_10013402 3300031240 Bacteria 4717
151 Ga0265339_10068110 3300031249 Bacteria 1903
152 Ga0265316_10020256 3300031344 Bacteria 5667
153 Ga0307509_10040630 3300031507 Bacteria 5056
154 Ga0307509_10054882 3300031507 Bacteria 4239
155 Ga0307509_10065768 3300031507 Bacteria 3805
156 Ga0265313_10011284 3300031595 Bacteria 5566
157 Ga0307508_10046601 3300031616 Bacteria 3870
158 Ga0307508_10253832 3300031616 Bacteria 1354
159 Ga0265342_10022150 3300031712 Bacteria 4044
160 Ga0307516_10000167 3300031730 Bacteria 83099
161 Ga0307518_10016742 3300031838 Bacteria 5256
162 Ga0307507_10010118 3300033179 Bacteria 12314
163 Ga0307507_10022295 3300033179 Bacteria 7006
164 Ga0307510_10004857 3300033180 Bacteria 15892
165 Ga0373948_0044563 3300034817 Bacteria 938
166 Ga0373928_0058756 3300035084 Bacteria 925
167 Ga0373952_0019744 3300035092 Bacteria 1406
168 Ga0373932_0018572 3300035112 Bacteria 1800
169 Ga0373960_0065201 3300035121 Bacteria 1114
170 Ga0373942_0000924 3300035207 Bacteria 8061
171 Ga0373962_0015081 3300035242 Bacteria 1976
172 Ga0373962_0053769 3300035242 Bacteria 1166
173 Ga0373935_0030327 3300035692 Bacteria 3351
174 Ga0436364_1169169 3300037853 Bacteria 2828
175 Ga0439436_0004107 3300041404 Bacteria 4462
176 Ga0439439_0029288 3300041406 Bacteria 1397
177 Ga0451837_1734306 3300041494 Bacteria 1833
178 Ga0451853_0464663 3300041512 Bacteria 3297
179 Ga0451853_2674030 3300041512 Bacteria 2799
180 Ga0439433_0006859 3300041999 Bacteria 2454
181 Ga0439448_0067642 3300042005 Bacteria 1187
182 Ga0439449_0004498 3300042007 Bacteria 5385
183 Ga0439457_000205 3300042014 Bacteria 15639
184 Ga0439457_000610 3300042014 Bacteria 10554
185 Ga0439457_005978 3300042014 Bacteria 3008
186 Ga0439462_0006506 3300042015 Bacteria 2905
187 Ga0450894_000913 3300042131 Bacteria 4662
188 Ga0450896_011930 3300042133 Bacteria 1226
189 Ga0450899_001299 3300042135 Bacteria 2814
190 Ga0450903_007314 3300042138 Bacteria 1819
191 Ga0450908_003106 3300042184 Bacteria 3229
192 Ga0466969_0012363 3300044656 Bacteria 4503
193 Ga0466961_0014501 3300044693 Bacteria 5063
194 Ga0466963_0018341 3300044694 Bacteria 4373
195 Ga0466971_0084472 3300044719 Bacteria 1449
196 Ga0466957_0547234 3300044842 Bacteria 806
197 Ga0466959_0119200 3300045049 Bacteria 1877
198 Ga0466958_0348406 3300045836 Bacteria 953
199 Ga0466967_0207825 3300045976 Bacteria 1856
200 Ga0495592_0028472 3300046454 Bacteria 4231
201 Ga0495592_0061848 3300046454 Bacteria 2750
202 Ga0495629_0017748 3300046459 Bacteria 5100
203 Ga0495629_0021703 3300046459 Bacteria 4581
204 Ga0495651_0009301 3300046462 Bacteria 7540
205 Ga0495605_0024466 3300046474 Bacteria 3159
206 Ga0495605_0091937 3300046474 Bacteria 1405
207 Ga0495662_0000106 3300046476 Bacteria 30793
208 Ga0495662_0008477 3300046476 Bacteria 5055
209 Ga0495662_0122989 3300046476 Bacteria 1274
210 Ga0495664_0001406 3300046477 Bacteria 12744
211 Ga0495585_0028635 3300046492 Bacteria 3176
212 Ga0495594_0041094 3300046499 Bacteria 2532
213 Ga0495607_0045365 3300046501 Bacteria 2586
214 Ga0495583_0041998 3300046506 Bacteria 2138
215 Ga0495606_0045931 3300046507 Bacteria 2890
216 Ga0495616_0013590 3300046513 Bacteria 4587
217 Ga0495618_0017973 3300046514 Bacteria 4339
218 Ga0495618_0204121 3300046514 Bacteria 1251
219 Ga0495620_0013503 3300046515 Bacteria 4178
220 Ga0495620_0024092 3300046515 Bacteria 2899
221 Ga0495628_0008416 3300046516 Bacteria 8851
222 Ga0495628_0019900 3300046516 Bacteria 5545
223 Ga0495628_0148481 3300046516 Bacteria 1786
224 Ga0495630_0027704 3300046517 Bacteria 4207
225 Ga0495631_0082359 3300046518 Bacteria 1387
226 Ga0495648_0061009 3300046524 Bacteria 2241
227 Ga0495666_0109237 3300046526 Bacteria 1299
228 Ga0495652_0078117 3300046529 Bacteria 2741
229 Ga0495640_0083744 3300046533 Bacteria 2116
230 Ga0495586_0075017 3300046535 Bacteria 1851
231 Ga0495587_0000273 3300046536 Bacteria 36925
232 Ga0495645_0024403 3300046543 Bacteria 4387
233 Ga0495633_0009931 3300046558 Bacteria 5226
234 Ga0495668_0015173 3300046616 Bacteria 4503
235 Ga0495668_0206195 3300046616 Bacteria 1076
236 Ga0495634_0005338 3300046642 Bacteria 9905
237 Ga0495634_0066854 3300046642 Bacteria 2379
238 Ga0495634_0113826 3300046642 Bacteria 1737
239 Ga0495625_0011470 3300046660 Bacteria 7225
240 Ga0495625_0111496 3300046660 Bacteria 1869
241 Ga0495635_0002568 3300046663 Bacteria 12424
242 Ga0495635_0043107 3300046663 Bacteria 3114
243 Ga0495635_0055796 3300046663 Bacteria 2721
244 Ga0495661_0149075 3300046665 Bacteria 1265
245 Ga0495588_0159827 3300046674 Bacteria 1191
246 Ga0495657_0000049 3300046675 Bacteria 103042
247 Ga0495657_0012138 3300046675 Bacteria 6408
248 Ga0495657_0118559 3300046675 Bacteria 1669
249 Ga0495646_0005596 3300046680 Bacteria 7947
250 Ga0495646_0208704 3300046680 Bacteria 1061
251 Ga0495658_0005074 3300046683 Bacteria 6469
252 Ga0495613_0001811 3300046689 Bacteria 16235
253 Ga0495613_0007168 3300046689 Bacteria 8304
254 Ga0495613_0017952 3300046689 Bacteria 5272
255 Ga0495613_0062314 3300046689 Bacteria 2729
256 Ga0495613_0111114 3300046689 Bacteria 1974
257 Ga0495613_0148193 3300046689 Bacteria 1674
258 Ga0495624_0233348 3300046690 Bacteria 1114
259 Ga0495671_0048743 3300046692 Bacteria 2113
260 Ga0495649_0048359 3300046694 Bacteria 2311
261 Ga0495589_0096374 3300046794 Bacteria 1434
262 Ga0495600_0007563 3300046809 Bacteria 6653
263 Ga0495600_0013187 3300046809 Bacteria 5186
264 Ga0495660_0152126 3300046810 Bacteria 1141
265 Ga0495581_0006512 3300047315 Bacteria 6773
266 Ga0495581_0015128 3300047315 Bacteria 4480
267 Ga0495604_0000670 3300047317 Bacteria 28983
268 Ga0495604_0016636 3300047317 Bacteria 5881
269 Ga0495636_0001320 3300047318 Bacteria 9413
270 Ga0495636_0086334 3300047318 Bacteria 1357
271 Ga0495674_0066738 3300047319 Bacteria 3120
272 Ga0495676_0001452 3300047321 Bacteria 20463
273 Ga0495676_0026188 3300047321 Bacteria 5023
274 Ga0495676_0238315 3300047321 Bacteria 1246
275 Ga0495680_0011352 3300047322 Bacteria 7889
276 Ga0495683_0080412 3300047323 Bacteria 1590
277 Ga0495687_000825 3300047443 Bacteria 33158
278 Ga0495687_015901 3300047443 Bacteria 3805
279 Ga0495677_0046787 3300047445 Bacteria 1588
280 Ga0495685_002064 3300047447 Bacteria 6246
281 Ga0495685_050579 3300047447 Bacteria 1410
282 Ga0495684_0097237 3300047471 Bacteria 2228
283 Ga0495684_0133616 3300047471 Bacteria 1862
284 Ga0495593_0000472 3300047673 Bacteria 22660
285 Ga0495593_0049654 3300047673 Bacteria 2225
286 Ga0495602_0096938 3300048088 Bacteria 2431
287 Ga0495614_0002073 3300048089 Bacteria 8842
288 Ga0495614_0004190 3300048089 Bacteria 6497
289 Ga0495614_0021323 3300048089 Bacteria 2797
290 Ga0496101_0041386 3300048904 Bacteria 3285
291 Ga0496103_0271747 3300048906 Bacteria 1090
292 Ga0496104_0115404 3300048907 Bacteria 2576
293 Ga0496106_0027634 3300048909 Bacteria 4226
294 Ga0496108_0000017 3300048911 Bacteria 235428
295 Ga0496108_0013632 3300048911 Bacteria 6636
296 Ga0496109_0027152 3300048912 Bacteria 5109
297 Ga0496110_0127351 3300048913 Bacteria 2298
298 Ga0496110_0330508 3300048913 Bacteria 1388
299 Ga0496112_0478082 3300048915 Bacteria 1182
300 Ga0496114_0465790 3300048917 Bacteria 1118
301 Ga0496115_0100083 3300048918 Bacteria 2376
302 Ga0496126_0223641 3300048929 Bacteria 1580
303 Ga0495682_0038198 3300049460 Bacteria 1765
304 Ga0501031_0026481 3300049568 Bacteria 3780
305 Ga0501032_0006367 3300049569 Bacteria 8702
306 Ga0501032_0076863 3300049569 Bacteria 2223
307 Ga0501033_0004108 3300049570 Bacteria 11733
308 Ga0501033_0039119 3300049570 Bacteria 3543
309 Ga0501034_0029671 3300049571 Bacteria 5560
310 Ga0501034_0145896 3300049571 Bacteria 2344
311 Ga0501034_0156274 3300049571 Bacteria 2254
312 Ga0501034_0183885 3300049571 Bacteria 2054
313 Ga0501036_0084224 3300049572 Bacteria 2688
314 Ga0501036_0635520 3300049572 Bacteria 884
315 Ga0501037_0002658 3300049573 Bacteria 12879
316 Ga0501038_0004671 3300049574 Bacteria 12756
317 Ga0501039_0045412 3300049575 Bacteria 3394
318 Ga0501042_0008065 3300049578 Bacteria 6932
319 Ga0501046_0078992 3300049580 Bacteria 2544
320 Ga0501047_0008327 3300049581 Bacteria 9787
321 Ga0501047_0009033 3300049581 Bacteria 9411
322 Ga0501047_0078281 3300049581 Bacteria 3180
323 Ga0501048_0055344 3300049582 Bacteria 2816
324 Ga0501071_0383056 3300049587 Bacteria 1073
325 Ga0501073_0372951 3300049589 Bacteria 986
326 Ga0501080_0212598 3300049742 Bacteria 1772
327 Ga0501035_0005092 3300049822 Bacteria 12446
328 Ga0501035_0039646 3300049822 Bacteria 4261
329 Ga0501035_0166945 3300049822 Bacteria 1903
330 Ga0501044_0008789 3300049823 Bacteria 11049
331 Ga0501044_0011616 3300049823 Bacteria 9543
332 nmdc:mga05p37_550019_c1 3300050507 Bacteria 1314
333 nmdc:mga0qj67_122003_c1 3300050509 Bacteria 2108
334 nmdc:mga06r32_403592_c1 3300050510 Bacteria 1349
335 nmdc:mga0n895_500160_c1 3300050512 Bacteria 1225
336 Ga0495601_0007837 3300053077 Bacteria 6284
337 Ga0495601_0019746 3300053077 Bacteria 4112
338 Ga0495612_0017777 3300053078 Bacteria 2846
339 Ga0495612_0028185 3300053078 Bacteria 2261
340 Ga0495595_0137974 3300053084 Bacteria 1195
341 Ga0500644_0008247 3300053088 Bacteria 2745
342 Ga0500647_0168348 3300053091 Bacteria 1013
343 Ga0500640_021780 3300053095 Bacteria 2766
344 Ga0500650_0212822 3300053098 Bacteria 877
345 Ga0500553_024638 3300053101 Bacteria 3034
346 Ga0500569_046638 3300053109 Bacteria 1292
347 Ga0500621_113194 3300053126 Bacteria 1058
348 Ga0500652_002095 3300053131 Bacteria 5995
349 Ga0500624_001685 3300053157 Bacteria 3291
350 Ga0500633_0110659 3300053160 Bacteria 1017
351 Ga0500611_058566 3300053727 Bacteria 905
352 Ga0466962_0054734 3300061719 Bacteria 1906
353 Ga0466962_0074402 3300061719 Bacteria 1623
354 2785346669 2784746763 Bacteria 9783172
355 2616693525 2616644814 Bacteria 11555299
356 2644630650 2643221714 Bacteria 9015452
357 2753262809 2751185782 Bacteria 11227053
358 2784586226 2784132148 Bacteria 8627943
359 2808917697 2808606375 Bacteria 9466072
360 2809229622 2808606448 Bacteria 8656184
361 2812477321 2811994917 Bacteria 7761064
362 2856741602 2856741275 Bacteria 8096094
363 2862293566 2862290372 Bacteria 7471434
364 2862513754 2862507626 Bacteria 9425308
365 2862710312 2862705112 Bacteria 6563286
366 2891562970 2891562705 Bacteria 8039471
367 2929222485 2929219909 Bacteria 6984360
368 2946073102 2946072368 Bacteria 8999607
369 2990050239 2990044586 Bacteria 6603797
370 2990065697 2990059506 Bacteria 9321252
371 2997455798 2997451912 Bacteria 8492419
372 8008490704 8008485437 Bacteria 7198341
373 8023629940 8023623736 Bacteria 8593882
374 8025525792 8025524527 Bacteria 7197316
375 8048413574 8048406513 Bacteria 8936924
376 JGI24739J22299_10041928
377 JGI24737J22298_10037978
378 JGI24735J21928_10031487
379 JGI25160J50197_1001875
380 JGI25160J50197_1010007
381 JGI25160J50197_1016370
382 Ga0070658_10143212
383 Ga0070658_10789412
384 Ga0070683_100151672
385 Ga0070683_100155276
386 Ga0070690_100423838
387 Ga0070670_100874199
388 Ga0068869_100220849
389 Ga0068869_100264233
390 Ga0070680_100312981
391 Ga0070682_100443011
392 Ga0068868_100392954
393 Ga0070660_100435505
394 Ga0070689_100047040
395 Ga0070691_10026087
396 Ga0070661_100004677
397 Ga0070661_100009471
398 Ga0070692_10359727
399 Ga0070668_100000153
400 Ga0070668_100253363
401 Ga0070675_100018826
402 Ga0070671_100161418
403 Ga0070673_100178914
404 Ga0070688_100165580
405 Ga0070667_100062208
406 Ga0070714_100009236
407 Ga0070710_10001000
408 Ga0070701_10185871
409 Ga0070711_100000506
410 Ga0070700_100106372
411 Ga0070694_100540865
412 Ga0070663_100183056
413 Ga0070662_100103340
414 Ga0070681_10169206
415 Ga0070685_10123268
416 Ga0070679_100078216
417 Ga0070679_100080463
418 Ga0070684_100101775
419 Ga0070684_100382106
420 Ga0068853_100096344
421 Ga0070695_100061762
422 Ga0070696_100080093
423 Ga0070693_100143058
424 Ga0070665_100605912
425 Ga0070704_100179625
426 Ga0068855_100498527
427 Ga0070664_100549591
428 Ga0068857_100402027
429 Ga0068854_100289463
430 Ga0068856_100091681
431 Ga0070702_100044398
432 Ga0068852_100029721
433 Ga0068859_100296375
434 Ga0068861_100135289
435 Ga0068863_100191501
436 Ga0068860_100037196
437 Ga0068860_100103665
438 Ga0068862_100035373
439 Ga0081455_10153867
440 Ga0081540_1001373
441 Ga0081540_1012976
442 Ga0070717_10007059
443 Ga0070715_10051160
444 Ga0070716_100000972
445 Ga0070712_100001624
446 Ga0097621_100482588
447 Ga0068871_100034407
448 Ga0075430_100202298
449 Ga0068865_100340672
450 Ga0097620_100296372
451 Ga0075435_100076394
452 Ga0105251_10026224
453 Ga0105251_10120044
454 Ga0105240_10185853
455 Ga0114129_10589068
456 Ga0105243_10053917
457 Ga0105242_10470254
458 Ga0105248_10713423
459 Ga0105237_10151571
460 Ga0105249_10515960
461 Ga0105246_10024861
462 Ga0157341_1004902
463 Ga0157373_10380309
464 Ga0157371_10039961
465 Ga0157369_10154879
466 Ga0157369_10222635
467 Ga0157374_10181311
468 Ga0157378_10251215
469 Ga0157378_10358529
470 Ga0163162_10286075
471 Ga0163162_11079263
472 Ga0157375_10348834
473 Ga0157375_10557241
474 Ga0163163_10399059
475 Ga0163163_10917474
476 Ga0157379_10292965
477 Ga0163161_10082162
478 Ga0206353_12014128
479 Ga0224572_1022546
480 Ga0207426_1000560
481 Ga0207426_1000630
482 Ga0207426_1003221
483 Ga0207692_10001057
484 Ga0207647_10112267
485 Ga0207699_10000592
486 Ga0207643_10019216
487 Ga0207705_10182912
488 Ga0207705_10261524
489 Ga0207693_10000897
490 Ga0207663_10000800
491 Ga0207662_10078199
492 Ga0207657_10002225
493 Ga0207649_10046580
494 Ga0207652_10085428
495 Ga0207687_10138084
496 Ga0207700_10002351
497 Ga0207664_10001972
498 Ga0207706_10053612
499 Ga0207665_10003429
500 Ga0207689_10020922
501 Ga0207667_10255765
502 Ga0207651_10447401
503 Ga0207668_10007221
504 Ga0207658_10014180
505 Ga0207703_10246505
506 Ga0207678_10099952
507 Ga0207641_10431590
508 Ga0207674_10003306
509 Ga0207675_100043707
510 Ga0268265_10008875
511 Ga0268264_10044748
512 Ga0265337_1000407
513 Ga0265319_1012539
514 Ga0265336_10005120
515 Ga0307517_10002021
516 Ga0307517_10235562
517 Ga0307515_10000294
518 Ga0307515_10024434
519 Ga0307515_10302470
520 Ga0265338_10002106
521 Ga0265324_10005043
522 Ga0307511_10000740
523 Ga0307511_10011311
524 Ga0307512_10122725
525 Ga0265320_10013402
526 Ga0265339_10068110
527 Ga0265316_10020256
528 Ga0307509_10040630
529 Ga0307509_10054882
530 Ga0307509_10065768
531 Ga0265313_10011284
532 Ga0307508_10046601
533 Ga0307508_10253832
534 Ga0265342_10022150
535 Ga0307516_10000167
536 Ga0307518_10016742
537 Ga0307507_10010118
538 Ga0307507_10022295
539 Ga0307510_10004857
540 Ga0373948_0044563
541 Ga0373928_0058756
542 Ga0373952_0019744
543 Ga0373932_0018572
544 Ga0373960_0065201
545 Ga0373942_0000924
546 Ga0373962_0015081
547 Ga0373962_0053769
548 Ga0373935_0030327
549 Ga0436364_1169169
550 Ga0439436_0004107
551 Ga0439439_0029288
552 Ga0451837_1734306
553 Ga0451853_0464663
554 Ga0451853_2674030
555 Ga0439433_0006859
556 Ga0439448_0067642
557 Ga0439449_0004498
558 Ga0439457_000205
559 Ga0439457_000610
560 Ga0439457_005978
561 Ga0439462_0006506
562 Ga0450894_000913
563 Ga0450896_011930
564 Ga0450899_001299
565 Ga0450903_007314
566 Ga0450908_003106
567 Ga0466969_0012363
568 Ga0466961_0014501
569 Ga0466963_0018341
570 Ga0466971_0084472
571 Ga0466957_0547234
572 Ga0466959_0119200
573 Ga0466958_0348406
574 Ga0466967_0207825
575 Ga0495592_0028472
576 Ga0495592_0061848
577 Ga0495629_0017748
578 Ga0495629_0021703
579 Ga0495651_0009301
580 Ga0495605_0024466
581 Ga0495605_0091937
582 Ga0495662_0000106
583 Ga0495662_0008477
584 Ga0495662_0122989
585 Ga0495664_0001406
586 Ga0495585_0028635
587 Ga0495594_0041094
588 Ga0495607_0045365
589 Ga0495583_0041998
590 Ga0495606_0045931
591 Ga0495616_0013590
592 Ga0495618_0017973
593 Ga0495618_0204121
594 Ga0495620_0013503
595 Ga0495620_0024092
596 Ga0495628_0008416
597 Ga0495628_0019900
598 Ga0495628_0148481
599 Ga0495630_0027704
600 Ga0495631_0082359
601 Ga0495648_0061009
602 Ga0495666_0109237
603 Ga0495652_0078117
604 Ga0495640_0083744
605 Ga0495586_0075017
606 Ga0495587_0000273
607 Ga0495645_0024403
608 Ga0495633_0009931
609 Ga0495668_0015173
610 Ga0495668_0206195
611 Ga0495634_0005338
612 Ga0495634_0066854
613 Ga0495634_0113826
614 Ga0495625_0011470
615 Ga0495625_0111496
616 Ga0495635_0002568
617 Ga0495635_0043107
618 Ga0495635_0055796
619 Ga0495661_0149075
620 Ga0495588_0159827
621 Ga0495657_0000049
622 Ga0495657_0012138
623 Ga0495657_0118559
624 Ga0495646_0005596
625 Ga0495646_0208704
626 Ga0495658_0005074
627 Ga0495613_0001811
628 Ga0495613_0007168
629 Ga0495613_0017952
630 Ga0495613_0062314
631 Ga0495613_0111114
632 Ga0495613_0148193
633 Ga0495624_0233348
634 Ga0495671_0048743
635 Ga0495649_0048359
636 Ga0495589_0096374
637 Ga0495600_0007563
638 Ga0495600_0013187
639 Ga0495660_0152126
640 Ga0495581_0006512
641 Ga0495581_0015128
642 Ga0495604_0000670
643 Ga0495604_0016636
644 Ga0495636_0001320
645 Ga0495636_0086334
646 Ga0495674_0066738
647 Ga0495676_0001452
648 Ga0495676_0026188
649 Ga0495676_0238315
650 Ga0495680_0011352
651 Ga0495683_0080412
652 Ga0495687_000825
653 Ga0495687_015901
654 Ga0495677_0046787
655 Ga0495685_002064
656 Ga0495685_050579
657 Ga0495684_0097237
658 Ga0495684_0133616
659 Ga0495593_0000472
660 Ga0495593_0049654
661 Ga0495602_0096938
662 Ga0495614_0002073
663 Ga0495614_0004190
664 Ga0495614_0021323
665 Ga0496101_0041386
666 Ga0496103_0271747
667 Ga0496104_0115404
668 Ga0496106_0027634
669 Ga0496108_0000017
670 Ga0496108_0013632
671 Ga0496109_0027152
672 Ga0496110_0127351
673 Ga0496110_0330508
674 Ga0496112_0478082
675 Ga0496114_0465790
676 Ga0496115_0100083
677 Ga0496126_0223641
678 Ga0495682_0038198
679 Ga0501031_0026481
680 Ga0501032_0006367
681 Ga0501032_0076863
682 Ga0501033_0004108
683 Ga0501033_0039119
684 Ga0501034_0029671
685 Ga0501034_0145896
686 Ga0501034_0156274
687 Ga0501034_0183885
688 Ga0501036_0084224
689 Ga0501036_0635520
690 Ga0501037_0002658
691 Ga0501038_0004671
692 Ga0501039_0045412
693 Ga0501042_0008065
694 Ga0501046_0078992
695 Ga0501047_0008327
696 Ga0501047_0009033
697 Ga0501047_0078281
698 Ga0501048_0055344
699 Ga0501071_0383056
700 Ga0501073_0372951
701 Ga0501080_0212598
702 Ga0501035_0005092
703 Ga0501035_0039646
704 Ga0501035_0166945
705 Ga0501044_0008789
706 Ga0501044_0011616
707 nmdc:mga05p37_550019_c1
708 nmdc:mga0qj67_122003_c1
709 nmdc:mga06r32_403592_c1
710 nmdc:mga0n895_500160_c1
711 Ga0495601_0007837
712 Ga0495601_0019746
713 Ga0495612_0017777
714 Ga0495612_0028185
715 Ga0495595_0137974
716 Ga0500644_0008247
717 Ga0500647_0168348
718 Ga0500640_021780
719 Ga0500650_0212822
720 Ga0500553_024638
721 Ga0500569_046638
722 Ga0500621_113194
723 Ga0500652_002095
724 Ga0500624_001685
725 Ga0500633_0110659
726 Ga0500611_058566
727 Ga0466962_0054734
728 Ga0466962_0074402
729 2785346669
730 2616693525
731 2644630650
732 2753262809
733 2784586226
734 2808917697
735 2809229622
736 2812477321
737 2856741602
738 2862293566
739 2862513754
740 2862710312
741 2891562970
742 2929222485
743 2946073102
744 2990050239
745 2990065697
746 2997455798
747 8008490704
748 8023629940
749 8025525792
750 8048413574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

56

99

0.93

PF08241

Methyltransf_11

Methyltransferase domain

139

205

0.89

PF13649

Methyltransf_25

Methyltransferase domain

139

201

0.89

PF13489

Methyltransf_23

Methyltransferase domain

27

264

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.7459 54 234
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.7397 48 233
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.7394 57 255
3lcc-assembly1.cif.gz_A structure of a sam-dependent halide methyltransferase from arabidopsis thaliana 0.7274 59 254
3i9f-assembly1.cif.gz_B crystal structure of a putative type 11 methyltransferase from sulfolobus solfataricus 0.7239 50 255
ID Description Score Start End Superfamily
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8166 60 182 3.40.50.150
af_A0A2R8RIC7_223_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8129 51 172 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7851 69 181 3.40.50.150
af_O61833_6_236_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7822 56 179 3.40.50.150
af_Q58055_1_219_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7635 54 217 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2G7D2X4-F1-model_v4 deleted 0.9211 15 255
AF-A0A554L9X0-F1-model_v4 Methyltransferase domain-containing protein 0.8681 15 255
AF-A0A1G9VNS0-F1-model_v4 Methyltransferase domain-containing protein 0.8674 1 255 GO:0008168
GO:0009058
GO:0032259
AF-A0A554L9X0-F1-model_v4 Methyltransferase domain-containing protein 0.8647 15 255
AF-A0A2G7D2X4-F1-model_v4 deleted 0.8526 15 255

Map