metagRoot

F427151

General Info

Members	Datasets	Scaffolds	Average Seq Length
375	265	357	123

Family's Representative Sequence

Representative Sequence	3300046557\|Ga0495622_0340173\|Ga0495622_0340173_129_569
Length	146
Sequence	MAQCAIRTQVPTHHHDRTFMTRAILDDSQIHPAARPLIGSKHKDIVREVQAAIAAHQVVVVGMALNPFPRKARKILDVLGTPYKYLQYGSYLNQWHRRNALKMWSGWPTFPMIFVNGVLIGGASELQALVENGEFSAMLARKVREC

Samples

	Sample ID	Description	Type	Environment
1	2585428057	Methylibium sp. YR605	Isolate	Rhizosphere
2	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
3	2600255292	Janthinobacterium lividum NFR18	Isolate	Rhizoplane
4	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
5	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
6	2643221645	Massilia sp. Root351	Isolate	Unclassified
7	2643221664	Massilia sp. Root418	Isolate	Unclassified
8	2738541280	Massilia sp. GV090	Isolate	Unclassified
9	2738541300	Massilia sp. GV016	Isolate	Unclassified
10	2738543018	Massilia sp. GV045	Isolate	Unclassified
11	2738543030	Massilia sp. GV097	Isolate	Unclassified
12	2857547612	Janthinobacterium sp. R-74502	Isolate	Unclassified
13	2857553236	Duganella sp. R-74557	Isolate	Unclassified
14	2885080285	Janthinobacterium sp. AD80	Isolate	Rhizosphere
15	2919476304	Duganella sp. 3397	Isolate	Unclassified
16	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
17	2932410948	Janthinobacterium lividum 2829	Isolate	Rhizosphere
18	2932416698	Janthinobacterium lividum 2830	Isolate	Rhizosphere
19	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
20	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
21	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
22	3300003308	Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
23	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
24	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
25	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
26	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
27	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
28	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
29	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
30	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
31	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
32	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
33	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
34	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
35	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
36	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
37	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
38	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
39	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
40	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
41	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
42	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
43	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
44	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
45	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
46	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
47	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
48	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
49	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
50	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
51	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
52	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
53	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
54	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
55	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
56	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
57	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
58	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
59	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
60	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
61	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
62	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
63	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
64	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
65	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
66	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
67	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
68	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
69	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
70	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
71	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
72	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
73	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
74	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
75	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
76	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
77	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
79	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
80	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
82	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
83	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
85	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
86	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
87	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
88	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
89	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
90	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
91	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
92	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
93	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
94	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
95	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
96	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
97	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
98	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
99	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
102	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
103	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
104	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
105	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
106	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
107	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
108	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
109	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
110	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
111	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
112	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
113	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
116	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
162	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
166	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
167	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
168	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
169	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
170	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
171	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
172	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
173	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
174	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
175	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
176	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
177	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
178	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
179	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
180	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
181	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
182	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
183	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
184	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
185	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
186	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
187	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
188	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
189	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
190	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
191	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
192	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
193	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
194	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
195	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
196	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
197	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
198	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
199	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
200	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
201	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
202	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
203	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
204	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
205	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
206	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
207	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
208	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
209	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
210	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
211	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
212	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
213	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
214	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
215	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
216	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
217	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
218	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
219	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
220	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
221	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
222	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
223	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
224	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
225	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
226	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
227	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
228	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
229	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
230	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
231	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
232	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
233	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
234	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
235	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
236	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
237	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
238	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
239	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
240	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
241	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
242	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
243	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
244	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
245	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
246	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
247	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
248	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
249	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
250	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
251	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
252	3300053127	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere	Metagenome	Endosphere
253	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
254	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
255	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
256	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
257	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
258	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
259	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
260	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
261	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
262	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
263	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
264	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
265	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.67
Metatranscriptomes	0.53
Isolates	4.8

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	20.27
Nodule	0
Rhizoplane	4.27
Rhizosphere	68
Stem	0
Stem Tuber	0
Unclassified	7.47

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25152J39213_1000357	3300002773	Bacteria	28520
2	JGI25150J39212_1005094	3300002774	Bacteria	2840
3	JGI25153J46596_10012766	3300003215	Bacteria	3599
4	Ga0006777J48905_1034290	3300003308	Bacteria	1294
5	Ga0007417J51691_1126448	3300003544	Unclassified	519
6	Ga0055524_1000282	3300003775	Bacteria	49809
7	Ga0055530_10032389	3300003791	Bacteria	1360
8	Ga0055543_1037818	3300004625	Bacteria	823
9	Ga0065165_1002188	3300005262	Bacteria	17582
10	Ga0065165_1146164	3300005262	Bacteria	555
11	Ga0070676_10010066	3300005328	Bacteria	5121
12	Ga0070676_10915870	3300005328	Bacteria	654
13	Ga0070690_100026886	3300005330	Bacteria	3553
14	Ga0070670_100177905	3300005331	Bacteria	1846
15	Ga0070677_10011721	3300005333	Bacteria	3029
16	Ga0068869_100056308	3300005334	Bacteria	2867
17	Ga0070666_10040369	3300005335	Bacteria	3115
18	Ga0068868_100149204	3300005338	Bacteria	1925
19	Ga0070660_100138475	3300005339	Bacteria	1951
20	Ga0070660_100554707	3300005339	Bacteria	959
21	Ga0070689_100307589	3300005340	Bacteria	1321
22	Ga0070687_100033500	3300005343	Bacteria	2537
23	Ga0070661_100019013	3300005344	Bacteria	4891
24	Ga0070668_100018791	3300005347	Bacteria	5190
25	Ga0070669_100002788	3300005353	Bacteria	12611
26	Ga0070669_100950138	3300005353	Bacteria	736
27	Ga0070675_100019387	3300005354	Bacteria	5419
28	Ga0070675_101560459	3300005354	Bacteria	609
29	Ga0070671_100006379	3300005355	Bacteria	9420
30	Ga0070674_100004423	3300005356	Bacteria	8012
31	Ga0070674_100829078	3300005356	Bacteria	801
32	Ga0070673_100349096	3300005364	Bacteria	1313
33	Ga0070673_100416464	3300005364	Bacteria	1204
34	Ga0070659_100001958	3300005366	Bacteria	14717
35	Ga0070659_100833798	3300005366	Bacteria	803
36	Ga0070659_101454234	3300005366	Bacteria	610
37	Ga0070667_100003227	3300005367	Bacteria	13952
38	Ga0070667_100187338	3300005367	Bacteria	1832
39	Ga0070701_10257604	3300005438	Bacteria	1056
40	Ga0070700_101081412	3300005441	Bacteria	664
41	Ga0070663_100439874	3300005455	Bacteria	1073
42	Ga0070678_100115379	3300005456	Bacteria	2108
43	Ga0070678_100865372	3300005456	Unclassified	824
44	Ga0070678_100880177	3300005456	Bacteria	818
45	Ga0070662_100026921	3300005457	Bacteria	3987
46	Ga0070662_100070820	3300005457	Bacteria	2569
47	Ga0070662_100207422	3300005457	Bacteria	1558
48	Ga0068867_100012509	3300005459	Bacteria	6005
49	Ga0068867_100117383	3300005459	Bacteria	2052
50	Ga0070672_100002386	3300005543	Bacteria	11888
51	Ga0070672_100255765	3300005543	Bacteria	1476
52	Ga0070672_100638203	3300005543	Bacteria	930
53	Ga0070665_100575644	3300005548	Bacteria	1139
54	Ga0070665_101122275	3300005548	Bacteria	798
55	Ga0068855_102330673	3300005563	Bacteria	535
56	Ga0070664_100004866	3300005564	Bacteria	10758
57	Ga0070664_100139925	3300005564	Bacteria	2130
58	Ga0068857_100067691	3300005577	Bacteria	3178
59	Ga0068854_100047196	3300005578	Bacteria	3069
60	Ga0068856_100042265	3300005614	Bacteria	4483
61	Ga0068852_100033431	3300005616	Bacteria	4269
62	Ga0068852_100154599	3300005616	Bacteria	2136
63	Ga0068859_100004293	3300005617	Bacteria	14552
64	Ga0068859_100625907	3300005617	Bacteria	1169
65	Ga0068864_100069110	3300005618	Bacteria	3070
66	Ga0068861_100005367	3300005719	Bacteria	8668
67	Ga0068851_10227294	3300005834	Bacteria	1051
68	Ga0068863_100008294	3300005841	Bacteria	10155
69	Ga0068863_100116244	3300005841	Bacteria	2549
70	Ga0068863_100153170	3300005841	Bacteria	2206
71	Ga0068858_100006561	3300005842	Bacteria	11319
72	Ga0068858_101748878	3300005842	Bacteria	614
73	Ga0068860_100001194	3300005843	Bacteria	28367
74	Ga0075365_10492943	3300006038	Bacteria	866
75	Ga0075368_10092024	3300006042	Bacteria	1241
76	Ga0075368_10237324	3300006042	Bacteria	777
77	Ga0075363_100021838	3300006048	Bacteria	3230
78	Ga0075363_100290908	3300006048	Bacteria	947
79	Ga0075364_10341779	3300006051	Bacteria	1020
80	Ga0075364_10938541	3300006051	Bacteria	589
81	Ga0070715_10379631	3300006163	Bacteria	780
82	Ga0075362_10004451	3300006177	Bacteria	5038
83	Ga0075362_10084924	3300006177	Bacteria	1463
84	Ga0075367_10179168	3300006178	Bacteria	1321
85	Ga0075367_10316804	3300006178	Bacteria	983
86	Ga0075369_10004699	3300006186	Bacteria	5065
87	Ga0075369_10069615	3300006186	Bacteria	1547
88	Ga0075366_10003499	3300006195	Bacteria	8295
89	Ga0075366_10060287	3300006195	Bacteria	2254
90	Ga0075366_10256631	3300006195	Bacteria	1067
91	Ga0097621_100048150	3300006237	Bacteria	3457
92	Ga0068871_101743647	3300006358	Bacteria	591
93	Ga0068865_100010254	3300006881	Bacteria	5827
94	Ga0097620_100004293	3300006931	Bacteria	14552
95	Ga0097620_100625939	3300006931	Bacteria	1169
96	Ga0105244_10040842	3300009036	Bacteria	2406
97	Ga0105240_10039041	3300009093	Bacteria	6083
98	Ga0111539_11135736	3300009094	Bacteria	908
99	Ga0111539_11607619	3300009094	Bacteria	754
100	Ga0105245_10257710	3300009098	Bacteria	1696
101	Ga0105243_10005693	3300009148	Bacteria	9692
102	Ga0105241_11021408	3300009174	Bacteria	775
103	Ga0105242_10062412	3300009176	Bacteria	3066
104	Ga0105242_10289258	3300009176	Bacteria	1491
105	Ga0105242_11093769	3300009176	Bacteria	811
106	Ga0105248_10246085	3300009177	Bacteria	2013
107	Ga0105248_10450698	3300009177	Bacteria	1450
108	Ga0105237_10008330	3300009545	Bacteria	11250
109	Ga0105238_10341671	3300009551	Bacteria	1485
110	Ga0105238_11209762	3300009551	Bacteria	780
111	Ga0105249_10042411	3300009553	Bacteria	4138
112	Ga0105249_12830608	3300009553	Bacteria	556
113	Ga0105239_10136895	3300010375	Bacteria	2727
114	Ga0157373_10298194	3300013100	Bacteria	1144
115	Ga0157374_10057712	3300013296	Bacteria	3626
116	Ga0157378_13221748	3300013297	Bacteria	507
117	Ga0163162_10003822	3300013306	Bacteria	14433
118	Ga0157372_10800868	3300013307	Bacteria	1095
119	Ga0157375_10019822	3300013308	Bacteria	6129
120	Ga0163163_12186344	3300014325	Bacteria	612
121	Ga0157380_10027869	3300014326	Bacteria	4302
122	Ga0157380_10275688	3300014326	Bacteria	1536
123	Ga0182008_10000244	3300014497	Bacteria	42053
124	Ga0157379_10052919	3300014968	Bacteria	3627
125	Ga0157379_10070210	3300014968	Bacteria	3133
126	Ga0157379_10794745	3300014968	Bacteria	893
127	Ga0157376_10644621	3300014969	Bacteria	1059
128	Ga0157376_10666748	3300014969	Bacteria	1042
129	Ga0182006_1000002	3300015261	Bacteria	887990
130	Ga0182007_10000073	3300015262	Bacteria	80601
131	Ga0182005_1000002	3300015265	Bacteria	908499
132	Ga0163161_10002952	3300017792	Bacteria	12051
133	Ga0163161_10026451	3300017792	Bacteria	4109
134	Ga0163161_10058854	3300017792	Bacteria	2793
135	Ga0163161_10171807	3300017792	Bacteria	1658
136	Ga0213872_10026996	3300021361	Bacteria	2637
137	Ga0207425_1000001	3300025245	Bacteria	2525432
138	Ga0209129_1000001	3300025258	Bacteria	1452436
139	Ga0209565_1010457	3300025263	Bacteria	2300
140	Ga0209565_1013188	3300025263	Bacteria	1942
141	Ga0209673_1010931	3300025273	Bacteria	3786
142	Ga0209758_1000073	3300025297	Bacteria	276262
143	Ga0209050_1050481	3300025298	Bacteria	1057
144	Ga0209256_1000116	3300025299	Bacteria	169876
145	Ga0209051_1017018	3300025303	Bacteria	3264
146	Ga0209257_1007380	3300025304	Bacteria	6654
147	Ga0207655_1031022	3300025728	Bacteria	2472
148	Ga0207682_10035164	3300025893	Bacteria	2023
149	Ga0207680_10047343	3300025903	Bacteria	2547
150	Ga0207647_10452928	3300025904	Bacteria	719
151	Ga0207685_10246684	3300025905	Bacteria	862
152	Ga0207645_10002656	3300025907	Bacteria	13911
153	Ga0207645_11145466	3300025907	Bacteria	523
154	Ga0207705_10316608	3300025909	Bacteria	1198
155	Ga0207695_10210327	3300025913	Bacteria	1856
156	Ga0207671_10007511	3300025914	Bacteria	9453
157	Ga0207662_10109739	3300025918	Bacteria	1719
158	Ga0207657_10158185	3300025919	Bacteria	1841
159	Ga0207657_10374753	3300025919	Bacteria	1121
160	Ga0207649_10016734	3300025920	Bacteria	4143
161	Ga0207649_10463304	3300025920	Bacteria	959
162	Ga0207649_11173586	3300025920	Bacteria	607
163	Ga0207681_10000326	3300025923	Bacteria	34311
164	Ga0207681_10621808	3300025923	Bacteria	894
165	Ga0207694_11431020	3300025924	Bacteria	584
166	Ga0207650_10073226	3300025925	Bacteria	2580
167	Ga0207650_10380120	3300025925	Bacteria	1166
168	Ga0207659_10015668	3300025926	Bacteria	4919
169	Ga0207659_10206433	3300025926	Bacteria	1572
170	Ga0207687_10036793	3300025927	Bacteria	3335
171	Ga0207644_10000223	3300025931	Bacteria	39200
172	Ga0207644_10089601	3300025931	Bacteria	2290
173	Ga0207644_10953721	3300025931	Unclassified	719
174	Ga0207690_10000831	3300025932	Bacteria	19793
175	Ga0207690_10734046	3300025932	Bacteria	813
176	Ga0207706_10007785	3300025933	Bacteria	9885
177	Ga0207706_10070108	3300025933	Bacteria	3083
178	Ga0207706_10196829	3300025933	Bacteria	1768
179	Ga0207706_10804270	3300025933	Bacteria	798
180	Ga0207686_10057096	3300025934	Bacteria	2456
181	Ga0207686_10173195	3300025934	Bacteria	1524
182	Ga0207686_11555338	3300025934	Bacteria	546
183	Ga0207709_10030812	3300025935	Bacteria	3124
184	Ga0207709_10095250	3300025935	Bacteria	1956
185	Ga0207670_11503700	3300025936	Bacteria	572
186	Ga0207669_10001267	3300025937	Bacteria	10717
187	Ga0207704_10007026	3300025938	Bacteria	5290
188	Ga0207704_10932481	3300025938	Bacteria	731
189	Ga0207691_10006061	3300025940	Bacteria	11679
190	Ga0207691_10042218	3300025940	Bacteria	4205
191	Ga0207691_10247911	3300025940	Bacteria	1538
192	Ga0207691_10837044	3300025940	Bacteria	772
193	Ga0207711_10110132	3300025941	Bacteria	2448
194	Ga0207711_10307182	3300025941	Bacteria	1464
195	Ga0207711_11025060	3300025941	Bacteria	765
196	Ga0207689_10004382	3300025942	Bacteria	12844
197	Ga0207689_10029351	3300025942	Bacteria	4594
198	Ga0207689_10878439	3300025942	Bacteria	757
199	Ga0207689_11639414	3300025942	Bacteria	534
200	Ga0207679_10000629	3300025945	Bacteria	23458
201	Ga0207679_10581677	3300025945	Bacteria	1007
202	Ga0207712_10034579	3300025961	Bacteria	3425
203	Ga0207640_10112631	3300025981	Bacteria	1932
204	Ga0207658_10022628	3300025986	Bacteria	4378
205	Ga0207658_10673505	3300025986	Bacteria	934
206	Ga0207677_10223746	3300026023	Bacteria	1511
207	Ga0207677_10341021	3300026023	Bacteria	1252
208	Ga0207703_10000504	3300026035	Bacteria	40430
209	Ga0207703_11491164	3300026035	Bacteria	651
210	Ga0207678_10120895	3300026067	Bacteria	2235
211	Ga0207678_10499786	3300026067	Bacteria	1060
212	Ga0207708_11030766	3300026075	Bacteria	716
213	Ga0207702_10038119	3300026078	Bacteria	4026
214	Ga0207641_10002204	3300026088	Bacteria	18325
215	Ga0207641_10076838	3300026088	Bacteria	2888
216	Ga0207641_10079920	3300026088	Bacteria	2836
217	Ga0207641_11676561	3300026088	Bacteria	638
218	Ga0207648_10037167	3300026089	Bacteria	4288
219	Ga0207648_10067053	3300026089	Bacteria	3129
220	Ga0207676_10158278	3300026095	Bacteria	1959
221	Ga0207676_11400604	3300026095	Bacteria	695
222	Ga0207675_100012424	3300026118	Bacteria	7956
223	Ga0207675_100501818	3300026118	Bacteria	1208
224	Ga0207683_10087645	3300026121	Bacteria	2768
225	Ga0207683_10131312	3300026121	Bacteria	2253
226	Ga0207683_11314761	3300026121	Bacteria	669
227	Ga0207698_10014993	3300026142	Bacteria	5174
228	Ga0207698_10030043	3300026142	Bacteria	3902
229	Ga0209813_10030412	3300027866	Bacteria	1587
230	Ga0268266_10645224	3300028379	Bacteria	1019
231	Ga0268265_10482892	3300028380	Bacteria	1164
232	Ga0268264_10024442	3300028381	Bacteria	4932
233	Ga0268264_10209367	3300028381	Bacteria	1789
234	Ga0307515_10320698	3300028794	Bacteria	1216
235	Ga0307408_100008652	3300031548	Bacteria	6721
236	Ga0307508_10130631	3300031616	Bacteria	2115
237	Ga0307413_10075223	3300031824	Bacteria	2143
238	Ga0316583_10132225	3300032133	Bacteria	869
239	Ga0316574_0476281	3300035398	Bacteria	780
240	Ga0395900_0578641	3300037418	Bacteria	1065
241	Ga0395905_0001177	3300037471	Bacteria	32676
242	Ga0395905_0485457	3300037471	Bacteria	1135
243	Ga0436361_0096607	3300039447	Bacteria	4888
244	Ga0451793_0454755	3300041452	Bacteria	1996
245	Ga0451802_0170379	3300041460	Bacteria	820
246	Ga0451802_1255762	3300041460	Bacteria	655
247	Ga0451804_1089298	3300041463	Bacteria	583
248	Ga0451853_1384115	3300041512	Bacteria	665
249	Ga0451853_3020787	3300041512	Bacteria	610
250	Ga0450919_000255	3300042121	Bacteria	6111
251	Ga0450898_005665	3300042134	Bacteria	1896
252	Ga0450918_001154	3300042531	Bacteria	5416
253	Ga0451577_0008705	3300042876	Bacteria	9843
254	Ga0451577_0425066	3300042876	Bacteria	1206
255	Ga0466965_0059961	3300044683	Bacteria	1900
256	Ga0453684_1885672	3300044712	Bacteria	605
257	Ga0466968_0574668	3300044735	Bacteria	567
258	Ga0466960_0017602	3300044901	Bacteria	3119
259	Ga0451576_1508932	3300045051	Unclassified	698
260	Ga0495629_0023920	3300046459	Bacteria	4351
261	Ga0495606_0029316	3300046507	Bacteria	3867
262	Ga0495631_0000073	3300046518	Bacteria	64358
263	Ga0495632_0004607	3300046519	Bacteria	9337
264	Ga0495654_0010839	3300046530	Bacteria	4950
265	Ga0495654_0187426	3300046530	Bacteria	892
266	Ga0495609_0145216	3300046538	Bacteria	1011
267	Ga0495597_0034554	3300046542	Bacteria	2284
268	Ga0495645_0702251	3300046543	Bacteria	614
269	Ga0495622_0036614	3300046557	Bacteria	2287
270	Ga0495622_0048725	3300046557	Bacteria	1968
271	Ga0495622_0340173	3300046557	Bacteria	650
272	Ga0495633_0000329	3300046558	Bacteria	53611
273	Ga0495633_0245741	3300046558	Bacteria	817
274	Ga0495656_0451705	3300046615	Bacteria	677
275	Ga0495668_0268523	3300046616	Bacteria	934
276	Ga0495611_0136577	3300046648	Bacteria	1145
277	Ga0495625_0001295	3300046660	Bacteria	31401
278	Ga0495659_0000021	3300046664	Bacteria	73067
279	Ga0495588_0082582	3300046674	Bacteria	1678
280	Ga0495671_0000102	3300046692	Bacteria	77849
281	Ga0495671_0115445	3300046692	Bacteria	1311
282	Ga0495589_0124162	3300046794	Bacteria	1242
283	Ga0495600_0427124	3300046809	Bacteria	822
284	Ga0495660_0003721	3300046810	Bacteria	9363
285	Ga0495660_0031545	3300046810	Bacteria	2979
286	Ga0495660_0086662	3300046810	Bacteria	1634
287	Ga0495672_0000259	3300047320	Bacteria	73356
288	Ga0495677_0118241	3300047445	Bacteria	1010
289	Ga0495686_0095221	3300047472	Bacteria	1803
290	Ga0495593_0014907	3300047673	Bacteria	4415
291	Ga0496104_0772732	3300048907	Bacteria	867
292	Ga0496105_0066453	3300048908	Bacteria	2977
293	Ga0496108_0565700	3300048911	Unclassified	991
294	Ga0496109_0189753	3300048912	Bacteria	1931
295	Ga0496110_1365138	3300048913	Bacteria	618
296	Ga0496111_0059619	3300048914	Bacteria	2766
297	Ga0496111_0235812	3300048914	Bacteria	1359
298	Ga0496112_0073838	3300048915	Bacteria	3371
299	Ga0496113_0032641	3300048916	Bacteria	3784
300	Ga0496114_1306037	3300048917	Bacteria	612
301	Ga0496115_0489463	3300048918	Bacteria	990
302	Ga0496116_0071421	3300048919	Bacteria	2198
303	Ga0496117_0000001	3300048920	Bacteria	2526244
304	Ga0496118_0000002	3300048921	Bacteria	1690764
305	Ga0496121_0003928	3300048924	Bacteria	20597
306	Ga0496121_0008764	3300048924	Bacteria	11803
307	Ga0496121_0258198	3300048924	Bacteria	1204
308	Ga0496122_0003134	3300048925	Bacteria	22145
309	Ga0496123_0002013	3300048926	Bacteria	26237
310	Ga0496124_0235764	3300048927	Bacteria	1364
311	Ga0496125_0250561	3300048928	Bacteria	1117
312	Ga0496126_0981744	3300048929	Bacteria	635
313	Ga0496126_1130049	3300048929	Bacteria	580
314	Ga0495678_000128	3300049459	Bacteria	89099
315	Ga0495682_0002601	3300049460	Bacteria	8472
316	nmdc:mga03683_16424_c1	3300050489	Bacteria	2781
317	nmdc:mga03683_54836_c1	3300050489	Bacteria	1672
318	nmdc:mga03683_67059_c1	3300050489	Bacteria	1527
319	nmdc:mga03n38_3672_c1	3300050490	Bacteria	4965
320	nmdc:mga00v17_10121_c1	3300050491	Bacteria	5138
321	nmdc:mga0yw44_389730_c1	3300050492	Bacteria	941
322	nmdc:mga0k408_22049_c1	3300050493	Bacteria	3583
323	nmdc:mga0k408_252674_c1	3300050493	Bacteria	1053
324	nmdc:mga0k408_4946_c1	3300050493	Bacteria	7060
325	nmdc:mga0k408_56722_c1	3300050493	Bacteria	2274
326	nmdc:mga06z11_125397_c1	3300050494	Bacteria	1436
327	nmdc:mga06z11_176476_c1	3300050494	Bacteria	1230
328	nmdc:mga04h51_8220_c1	3300050495	Bacteria	2786
329	nmdc:mga07m45_8793_c1	3300050496	Bacteria	5206
330	nmdc:mga08y16_789619_c1	3300050511	Bacteria	943
331	nmdc:mga0sz30_121443_c1	3300050516	Bacteria	1148
332	nmdc:mga0sz30_25403_c1	3300050516	Bacteria	2422
333	Ga0500578_0001085	3300053086	Bacteria	29483
334	Ga0500643_013845	3300053087	Bacteria	2826
335	Ga0500644_0314332	3300053088	Bacteria	672
336	Ga0500646_0011730	3300053090	Bacteria	2256
337	Ga0500583_0438410	3300053092	Bacteria	622
338	Ga0500650_0340192	3300053098	Bacteria	658
339	Ga0500571_000031	3300053110	Bacteria	45855
340	Ga0500572_039223	3300053111	Bacteria	1366
341	Ga0500594_0007412	3300053118	Bacteria	2481
342	Ga0500597_025303	3300053120	Bacteria	2391
343	Ga0500623_266641	3300053127	Bacteria	555
344	Ga0500626_055931	3300053128	Bacteria	1770
345	Ga0500628_060791	3300053129	Bacteria	922
346	Ga0500652_006366	3300053131	Bacteria	3798
347	Ga0500559_0010999	3300053136	Bacteria	3874
348	Ga0500564_041928	3300053138	Bacteria	2105
349	Ga0500568_0007198	3300053139	Bacteria	5482
350	Ga0500568_0196932	3300053139	Bacteria	738
351	Ga0500577_0036795	3300053142	Bacteria	1755
352	Ga0500604_0106805	3300053151	Bacteria	927
353	Ga0500616_0007329	3300053153	Bacteria	7032
354	Ga0500622_0000091	3300053156	Bacteria	93307
355	Ga0500634_0006006	3300053161	Bacteria	5834
356	Ga0500638_011409	3300053162	Bacteria	3939
357	Ga0500636_0028693	3300053177	Bacteria	3286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005841	Ga0068863_100116244	Ga0068863_1001162442	117
2	3300026088	Ga0207641_10079920	Ga0207641_100799204	117
3	iso_pu_bacteria	2857553236	2857554336	117
4	iso_pu_bacteria	2919476304	2919478547	117
5	iso_pu_bacteria	2585428057	2587729862	118
6	iso_pu_bacteria	2585428058	2587733522	118
7	iso_pu_bacteria	2643221603	2644029342	118
8	iso_pu_bacteria	2643221644	2644244969	118
9	3300013100	Ga0157373_10298194	Ga0157373_102981943	119
10	3300042876	Ga0451577_0425066	Ga0451577_0425066_263_622	119
11	iso_pu_bacteria	2928084124	2928090664	119
12	3300005456	Ga0070678_100865372	Ga0070678_1008653722	120
13	3300005563	Ga0068855_102330673	Ga0068855_1023306731	121
14	3300021361	Ga0213872_10026996	Ga0213872_100269962	121
15	3300025920	Ga0207649_10463304	Ga0207649_104633042	121
16	3300025931	Ga0207644_10953721	Ga0207644_109537211	121
17	3300025941	Ga0207711_10110132	Ga0207711_101101323	121
18	3300026067	Ga0207678_10499786	Ga0207678_104997862	121
19	3300026095	Ga0207676_11400604	Ga0207676_114006041	121
20	3300028380	Ga0268265_10482892	Ga0268265_104828922	121
21	3300028794	Ga0307515_10320698	Ga0307515_103206982	121
22	3300037471	Ga0395905_0001177	Ga0395905_0001177_21673_22038	121
23	3300039447	Ga0436361_0096607	Ga0436361_0096607_3392_3757	121
24	3300041452	Ga0451793_0454755	Ga0451793_0454755_1363_1728	121
25	3300041460	Ga0451802_1255762	Ga0451802_1255762_17_382	121
26	3300042134	Ga0450898_005665	Ga0450898_005665_249_614	121
27	3300045051	Ga0451576_1508932	Ga0451576_1508932_183_548	121
28	3300046558	Ga0495633_0245741	Ga0495633_0245741_293_658	121
29	3300046615	Ga0495656_0451705	Ga0495656_0451705_15_380	121
30	3300046809	Ga0495600_0427124	Ga0495600_0427124_115_624	121
31	3300046810	Ga0495660_0003721	Ga0495660_0003721_3760_4125	121
32	3300048907	Ga0496104_0772732	Ga0496104_0772732_476_844	121
33	3300048908	Ga0496105_0066453	Ga0496105_0066453_1427_1795	121
34	3300048911	Ga0496108_0565700	Ga0496108_0565700_161_529	121
35	3300048912	Ga0496109_0189753	Ga0496109_0189753_288_656	121
36	3300048913	Ga0496110_1365138	Ga0496110_1365138_112_480	121
37	3300048914	Ga0496111_0235812	Ga0496111_0235812_947_1315	121
38	3300048915	Ga0496112_0073838	Ga0496112_0073838_2363_2731	121
39	3300048916	Ga0496113_0032641	Ga0496113_0032641_1574_1942	121
40	3300003308	Ga0006777J48905_1034290	Ga0006777J48905_10342902	122
41	3300003544	Ga0007417J51691_1126448	Ga0007417J51691_11264481	122
42	3300004625	Ga0055543_1037818	Ga0055543_10378182	122
43	3300005262	Ga0065165_1002188	Ga0065165_10021888	122
44	3300005328	Ga0070676_10010066	Ga0070676_100100664	122
45	3300005328	Ga0070676_10915870	Ga0070676_109158701	122
46	3300005330	Ga0070690_100026886	Ga0070690_1000268865	122
47	3300005331	Ga0070670_100177905	Ga0070670_1001779052	122
48	3300005333	Ga0070677_10011721	Ga0070677_100117212	122
49	3300005334	Ga0068869_100056308	Ga0068869_1000563082	122
50	3300005335	Ga0070666_10040369	Ga0070666_100403693	122
51	3300005338	Ga0068868_100149204	Ga0068868_1001492042	122
52	3300005339	Ga0070660_100138475	Ga0070660_1001384752	122
53	3300005339	Ga0070660_100554707	Ga0070660_1005547072	122
54	3300005340	Ga0070689_100307589	Ga0070689_1003075892	122
55	3300005343	Ga0070687_100033500	Ga0070687_1000335002	122
56	3300005344	Ga0070661_100019013	Ga0070661_1000190132	122
57	3300005347	Ga0070668_100018791	Ga0070668_1000187914	122
58	3300005353	Ga0070669_100002788	Ga0070669_1000027883	122
59	3300005353	Ga0070669_100950138	Ga0070669_1009501382	122
60	3300005354	Ga0070675_100019387	Ga0070675_1000193871	122
61	3300005354	Ga0070675_101560459	Ga0070675_1015604591	122
62	3300005355	Ga0070671_100006379	Ga0070671_1000063794	122
63	3300005356	Ga0070674_100004423	Ga0070674_1000044232	122
64	3300005356	Ga0070674_100829078	Ga0070674_1008290782	122
65	3300005364	Ga0070673_100349096	Ga0070673_1003490962	122
66	3300005364	Ga0070673_100416464	Ga0070673_1004164642	122
67	3300005366	Ga0070659_100001958	Ga0070659_1000019582	122
68	3300005366	Ga0070659_100833798	Ga0070659_1008337982	122
69	3300005366	Ga0070659_101454234	Ga0070659_1014542341	122
70	3300005367	Ga0070667_100003227	Ga0070667_1000032273	122
71	3300005367	Ga0070667_100187338	Ga0070667_1001873382	122
72	3300005438	Ga0070701_10257604	Ga0070701_102576041	122
73	3300005441	Ga0070700_101081412	Ga0070700_1010814121	122
74	3300005455	Ga0070663_100439874	Ga0070663_1004398742	122
75	3300005456	Ga0070678_100115379	Ga0070678_1001153792	122
76	3300005456	Ga0070678_100880177	Ga0070678_1008801771	122
77	3300005457	Ga0070662_100026921	Ga0070662_1000269212	122
78	3300005457	Ga0070662_100070820	Ga0070662_1000708203	122
79	3300005457	Ga0070662_100207422	Ga0070662_1002074222	122
80	3300005459	Ga0068867_100012509	Ga0068867_1000125095	122
81	3300005459	Ga0068867_100117383	Ga0068867_1001173832	122
82	3300005543	Ga0070672_100002386	Ga0070672_10000238612	122
83	3300005543	Ga0070672_100255765	Ga0070672_1002557652	122
84	3300005543	Ga0070672_100638203	Ga0070672_1006382032	122
85	3300005548	Ga0070665_100575644	Ga0070665_1005756442	122
86	3300005548	Ga0070665_101122275	Ga0070665_1011222752	122
87	3300005564	Ga0070664_100004866	Ga0070664_1000048663	122
88	3300005564	Ga0070664_100139925	Ga0070664_1001399252	122
89	3300005577	Ga0068857_100067691	Ga0068857_1000676912	122
90	3300005578	Ga0068854_100047196	Ga0068854_1000471962	122
91	3300005614	Ga0068856_100042265	Ga0068856_1000422656	122
92	3300005616	Ga0068852_100033431	Ga0068852_1000334312	122
93	3300005616	Ga0068852_100154599	Ga0068852_1001545992	122
94	3300005617	Ga0068859_100004293	Ga0068859_1000042936	122
95	3300005617	Ga0068859_100625907	Ga0068859_1006259072	122
96	3300005618	Ga0068864_100069110	Ga0068864_1000691102	122
97	3300005719	Ga0068861_100005367	Ga0068861_1000053673	122
98	3300005834	Ga0068851_10227294	Ga0068851_102272942	122
99	3300005841	Ga0068863_100008294	Ga0068863_1000082949	122
100	3300005841	Ga0068863_100153170	Ga0068863_1001531703	122
101	3300005842	Ga0068858_100006561	Ga0068858_1000065612	122
102	3300005842	Ga0068858_101748878	Ga0068858_1017488781	122
103	3300005843	Ga0068860_100001194	Ga0068860_10000119416	122
104	3300006038	Ga0075365_10492943	Ga0075365_104929432	122
105	3300006042	Ga0075368_10092024	Ga0075368_100920242	122
106	3300006042	Ga0075368_10237324	Ga0075368_102373242	122
107	3300006048	Ga0075363_100021838	Ga0075363_1000218383	122
108	3300006048	Ga0075363_100290908	Ga0075363_1002909082	122
109	3300006051	Ga0075364_10341779	Ga0075364_103417792	122
110	3300006051	Ga0075364_10938541	Ga0075364_109385411	122
111	3300006163	Ga0070715_10379631	Ga0070715_103796312	122
112	3300006177	Ga0075362_10004451	Ga0075362_100044516	122
113	3300006177	Ga0075362_10084924	Ga0075362_100849241	122
114	3300006178	Ga0075367_10179168	Ga0075367_101791682	122
115	3300006178	Ga0075367_10316804	Ga0075367_103168042	122
116	3300006186	Ga0075369_10004699	Ga0075369_100046993	122
117	3300006186	Ga0075369_10069615	Ga0075369_100696152	122
118	3300006195	Ga0075366_10003499	Ga0075366_100034995	122
119	3300006195	Ga0075366_10060287	Ga0075366_100602872	122
120	3300006195	Ga0075366_10256631	Ga0075366_102566312	122
121	3300006237	Ga0097621_100048150	Ga0097621_1000481502	122
122	3300006358	Ga0068871_101743647	Ga0068871_1017436471	122
123	3300006881	Ga0068865_100010254	Ga0068865_1000102545	122
124	3300006931	Ga0097620_100004293	Ga0097620_1000042936	122
125	3300006931	Ga0097620_100625939	Ga0097620_1006259392	122
126	3300009093	Ga0105240_10039041	Ga0105240_100390414	122
127	3300009094	Ga0111539_11135736	Ga0111539_111357362	122
128	3300009094	Ga0111539_11607619	Ga0111539_116076191	122
129	3300009098	Ga0105245_10257710	Ga0105245_102577102	122
130	3300009148	Ga0105243_10005693	Ga0105243_100056935	122
131	3300009174	Ga0105241_11021408	Ga0105241_110214081	122
132	3300009176	Ga0105242_10062412	Ga0105242_100624123	122
133	3300009176	Ga0105242_11093769	Ga0105242_110937692	122
134	3300009177	Ga0105248_10246085	Ga0105248_102460852	122
135	3300009177	Ga0105248_10450698	Ga0105248_104506982	122
136	3300009545	Ga0105237_10008330	Ga0105237_1000833010	122
137	3300009551	Ga0105238_10341671	Ga0105238_103416712	122
138	3300009553	Ga0105249_10042411	Ga0105249_100424112	122
139	3300010375	Ga0105239_10136895	Ga0105239_101368952	122
140	3300013296	Ga0157374_10057712	Ga0157374_100577122	122
141	3300013297	Ga0157378_13221748	Ga0157378_132217482	122
142	3300013306	Ga0163162_10003822	Ga0163162_100038227	122
143	3300013307	Ga0157372_10800868	Ga0157372_108008682	122
144	3300013308	Ga0157375_10019822	Ga0157375_100198224	122
145	3300014325	Ga0163163_12186344	Ga0163163_121863441	122
146	3300014326	Ga0157380_10027869	Ga0157380_100278693	122
147	3300014326	Ga0157380_10275688	Ga0157380_102756882	122
148	3300014968	Ga0157379_10070210	Ga0157379_100702102	122
149	3300014968	Ga0157379_10794745	Ga0157379_107947452	122
150	3300014969	Ga0157376_10644621	Ga0157376_106446212	122
151	3300014969	Ga0157376_10666748	Ga0157376_106667482	122
152	3300017792	Ga0163161_10002952	Ga0163161_1000295211	122
153	3300017792	Ga0163161_10171807	Ga0163161_101718072	122
154	3300025273	Ga0209673_1010931	Ga0209673_10109314	122
155	3300025304	Ga0209257_1007380	Ga0209257_10073802	122
156	3300025893	Ga0207682_10035164	Ga0207682_100351642	122
157	3300025903	Ga0207680_10047343	Ga0207680_100473433	122
158	3300025904	Ga0207647_10452928	Ga0207647_104529282	122
159	3300025905	Ga0207685_10246684	Ga0207685_102466841	122
160	3300025907	Ga0207645_10002656	Ga0207645_1000265612	122
161	3300025907	Ga0207645_11145466	Ga0207645_111454662	122
162	3300025909	Ga0207705_10316608	Ga0207705_103166082	122
163	3300025913	Ga0207695_10210327	Ga0207695_102103271	122
164	3300025914	Ga0207671_10007511	Ga0207671_100075112	122
165	3300025918	Ga0207662_10109739	Ga0207662_101097392	122
166	3300025919	Ga0207657_10158185	Ga0207657_101581852	122
167	3300025919	Ga0207657_10374753	Ga0207657_103747532	122
168	3300025920	Ga0207649_10016734	Ga0207649_100167342	122
169	3300025920	Ga0207649_11173586	Ga0207649_111735861	122
170	3300025923	Ga0207681_10000326	Ga0207681_1000032631	122
171	3300025923	Ga0207681_10621808	Ga0207681_106218082	122
172	3300025925	Ga0207650_10073226	Ga0207650_100732262	122
173	3300025925	Ga0207650_10380120	Ga0207650_103801202	122
174	3300025926	Ga0207659_10015668	Ga0207659_100156685	122
175	3300025926	Ga0207659_10206433	Ga0207659_102064333	122
176	3300025927	Ga0207687_10036793	Ga0207687_100367932	122
177	3300025931	Ga0207644_10000223	Ga0207644_1000022338	122
178	3300025931	Ga0207644_10089601	Ga0207644_100896012	122
179	3300025932	Ga0207690_10000831	Ga0207690_100008317	122
180	3300025932	Ga0207690_10734046	Ga0207690_107340462	122
181	3300025933	Ga0207706_10007785	Ga0207706_100077858	122
182	3300025933	Ga0207706_10070108	Ga0207706_100701083	122
183	3300025933	Ga0207706_10196829	Ga0207706_101968292	122
184	3300025933	Ga0207706_10804270	Ga0207706_108042702	122
185	3300025934	Ga0207686_10057096	Ga0207686_100570962	122
186	3300025934	Ga0207686_10173195	Ga0207686_101731952	122
187	3300025934	Ga0207686_11555338	Ga0207686_115553381	122
188	3300025935	Ga0207709_10030812	Ga0207709_100308125	122
189	3300025935	Ga0207709_10095250	Ga0207709_100952502	122
190	3300025936	Ga0207670_11503700	Ga0207670_115037001	122
191	3300025937	Ga0207669_10001267	Ga0207669_100012678	122
192	3300025938	Ga0207704_10007026	Ga0207704_100070265	122
193	3300025938	Ga0207704_10932481	Ga0207704_109324811	122
194	3300025940	Ga0207691_10006061	Ga0207691_1000606111	122
195	3300025940	Ga0207691_10042218	Ga0207691_100422184	122
196	3300025940	Ga0207691_10247911	Ga0207691_102479112	122
197	3300025940	Ga0207691_10837044	Ga0207691_108370442	122
198	3300025941	Ga0207711_10307182	Ga0207711_103071821	122
199	3300025941	Ga0207711_11025060	Ga0207711_110250602	122
200	3300025942	Ga0207689_10004382	Ga0207689_100043822	122
201	3300025942	Ga0207689_10029351	Ga0207689_100293514	122
202	3300025942	Ga0207689_10878439	Ga0207689_108784392	122
203	3300025942	Ga0207689_11639414	Ga0207689_116394142	122
204	3300025945	Ga0207679_10000629	Ga0207679_1000062919	122
205	3300025945	Ga0207679_10581677	Ga0207679_105816772	122
206	3300025961	Ga0207712_10034579	Ga0207712_100345794	122
207	3300025981	Ga0207640_10112631	Ga0207640_101126313	122
208	3300025986	Ga0207658_10022628	Ga0207658_100226283	122
209	3300025986	Ga0207658_10673505	Ga0207658_106735052	122
210	3300026023	Ga0207677_10223746	Ga0207677_102237462	122
211	3300026023	Ga0207677_10341021	Ga0207677_103410212	122
212	3300026035	Ga0207703_10000504	Ga0207703_1000050413	122
213	3300026035	Ga0207703_11491164	Ga0207703_114911642	122
214	3300026067	Ga0207678_10120895	Ga0207678_101208952	122
215	3300026075	Ga0207708_11030766	Ga0207708_110307662	122
216	3300026078	Ga0207702_10038119	Ga0207702_100381192	122
217	3300026088	Ga0207641_10002204	Ga0207641_1000220412	122
218	3300026088	Ga0207641_10076838	Ga0207641_100768381	122
219	3300026088	Ga0207641_11676561	Ga0207641_116765611	122
220	3300026089	Ga0207648_10037167	Ga0207648_100371674	122
221	3300026089	Ga0207648_10067053	Ga0207648_100670533	122
222	3300026095	Ga0207676_10158278	Ga0207676_101582782	122
223	3300026118	Ga0207675_100012424	Ga0207675_1000124243	122
224	3300026118	Ga0207675_100501818	Ga0207675_1005018182	122
225	3300026121	Ga0207683_10087645	Ga0207683_100876453	122
226	3300026121	Ga0207683_10131312	Ga0207683_101313123	122
227	3300026121	Ga0207683_11314761	Ga0207683_113147612	122
228	3300026142	Ga0207698_10014993	Ga0207698_100149933	122
229	3300026142	Ga0207698_10030043	Ga0207698_100300435	122
230	3300027866	Ga0209813_10030412	Ga0209813_100304122	122
231	3300028379	Ga0268266_10645224	Ga0268266_106452242	122
232	3300028381	Ga0268264_10024442	Ga0268264_100244426	122
233	3300031616	Ga0307508_10130631	Ga0307508_101306312	122
234	3300031824	Ga0307413_10075223	Ga0307413_100752232	122
235	3300032133	Ga0316583_10132225	Ga0316583_101322252	122
236	3300041460	Ga0451802_0170379	Ga0451802_0170379_13_381	122
237	3300041512	Ga0451853_1384115	Ga0451853_1384115_249_617	122
238	3300041512	Ga0451853_3020787	Ga0451853_3020787_72_440	122
239	3300042121	Ga0450919_000255	Ga0450919_000255_603_971	122
240	3300042531	Ga0450918_001154	Ga0450918_001154_2658_3026	122
241	3300046519	Ga0495632_0004607	Ga0495632_0004607_92_460	122
242	3300046543	Ga0495645_0702251	Ga0495645_0702251_35_403	122
243	3300046648	Ga0495611_0136577	Ga0495611_0136577_536_904	122
244	3300046692	Ga0495671_0115445	Ga0495671_0115445_637_1005	122
245	3300050489	nmdc:mga03683_16424_c1	nmdc:mga03683_16424_c1_461_829	122
246	3300050489	nmdc:mga03683_67059_c1	nmdc:mga03683_67059_c1_987_1355	122
247	3300050490	nmdc:mga03n38_3672_c1	nmdc:mga03n38_3672_c1_4027_4395	122
248	3300050491	nmdc:mga00v17_10121_c1	nmdc:mga00v17_10121_c1_196_564	122
249	3300050492	nmdc:mga0yw44_389730_c1	nmdc:mga0yw44_389730_c1_113_481	122
250	3300050493	nmdc:mga0k408_252674_c1	nmdc:mga0k408_252674_c1_380_748	122
251	3300050493	nmdc:mga0k408_4946_c1	nmdc:mga0k408_4946_c1_5204_5572	122
252	3300050493	nmdc:mga0k408_56722_c1	nmdc:mga0k408_56722_c1_1102_1470	122
253	3300050494	nmdc:mga06z11_125397_c1	nmdc:mga06z11_125397_c1_173_541	122
254	3300050494	nmdc:mga06z11_176476_c1	nmdc:mga06z11_176476_c1_402_770	122
255	3300050495	nmdc:mga04h51_8220_c1	nmdc:mga04h51_8220_c1_593_961	122
256	3300050496	nmdc:mga07m45_8793_c1	nmdc:mga07m45_8793_c1_2240_2608	122
257	3300050511	nmdc:mga08y16_789619_c1	nmdc:mga08y16_789619_c1_148_516	122
258	3300050516	nmdc:mga0sz30_121443_c1	nmdc:mga0sz30_121443_c1_669_1037	122
259	3300050516	nmdc:mga0sz30_25403_c1	nmdc:mga0sz30_25403_c1_103_471	122
260	3300053086	Ga0500578_0001085	Ga0500578_0001085_18045_18413	122
261	3300053088	Ga0500644_0314332	Ga0500644_0314332_144_512	122
262	3300053090	Ga0500646_0011730	Ga0500646_0011730_219_587	122
263	3300053092	Ga0500583_0438410	Ga0500583_0438410_30_398	122
264	3300053098	Ga0500650_0340192	Ga0500650_0340192_91_459	122
265	3300053127	Ga0500623_266641	Ga0500623_266641_170_538	122
266	3300053129	Ga0500628_060791	Ga0500628_060791_535_903	122
267	3300053131	Ga0500652_006366	Ga0500652_006366_206_574	122
268	3300053139	Ga0500568_0196932	Ga0500568_0196932_131_499	122
269	3300053142	Ga0500577_0036795	Ga0500577_0036795_1239_1607	122
270	3300053151	Ga0500604_0106805	Ga0500604_0106805_215_583	122
271	3300053156	Ga0500622_0000091	Ga0500622_0000091_79880_80248	122
272	iso_pu_bacteria	2600255292	2601667559	122
273	iso_pu_bacteria	2643221645	2644254261	122
274	iso_pu_bacteria	2643221664	2644358072	122
275	iso_pu_bacteria	2738541280	2738741081	122
276	iso_pu_bacteria	2738541300	2738845540	122
277	iso_pu_bacteria	2738543018	2739276595	122
278	iso_pu_bacteria	2738543030	2739345639	122
279	iso_pu_bacteria	2857547612	2857551720	122
280	iso_pu_bacteria	2885080285	2885082827	122
281	iso_pu_bacteria	2932410948	2932411168	122
282	iso_pu_bacteria	2932416698	2932419265	122
283	3300009036	Ga0105244_10040842	Ga0105244_100408423	123
284	3300009176	Ga0105242_10289258	Ga0105242_102892584	123
285	3300009551	Ga0105238_11209762	Ga0105238_112097622	123
286	3300009553	Ga0105249_12830608	Ga0105249_128306081	123
287	3300014968	Ga0157379_10052919	Ga0157379_100529195	123
288	3300025728	Ga0207655_1031022	Ga0207655_10310223	123
289	3300025924	Ga0207694_11431020	Ga0207694_114310202	123
290	3300028381	Ga0268264_10209367	Ga0268264_102093672	123
291	3300035398	Ga0316574_0476281	Ga0316574_0476281_169_540	123
292	3300041463	Ga0451804_1089298	Ga0451804_1089298_112_483	123
293	3300046459	Ga0495629_0023920	Ga0495629_0023920_327_698	123
294	3300046518	Ga0495631_0000073	Ga0495631_0000073_19492_19863	123
295	3300046530	Ga0495654_0010839	Ga0495654_0010839_2372_2743	123
296	3300046538	Ga0495609_0145216	Ga0495609_0145216_521_892	123
297	3300046557	Ga0495622_0048725	Ga0495622_0048725_444_815	123
298	3300046674	Ga0495588_0082582	Ga0495588_0082582_870_1241	123
299	3300047673	Ga0495593_0014907	Ga0495593_0014907_3905_4276	123
300	3300048924	Ga0496121_0258198	Ga0496121_0258198_581_952	123
301	3300048929	Ga0496126_1130049	Ga0496126_1130049_53_424	123
302	3300050493	nmdc:mga0k408_22049_c1	nmdc:mga0k408_22049_c1_1816_2187	123
303	3300053087	Ga0500643_013845	Ga0500643_013845_1235_1606	123
304	3300053110	Ga0500571_000031	Ga0500571_000031_42759_43130	123
305	3300053111	Ga0500572_039223	Ga0500572_039223_896_1267	123
306	3300053118	Ga0500594_0007412	Ga0500594_0007412_635_1006	123
307	3300053120	Ga0500597_025303	Ga0500597_025303_986_1357	123
308	3300053128	Ga0500626_055931	Ga0500626_055931_578_949	123
309	3300053136	Ga0500559_0010999	Ga0500559_0010999_1281_1652	123
310	3300053138	Ga0500564_041928	Ga0500564_041928_1606_1977	123
311	3300053139	Ga0500568_0007198	Ga0500568_0007198_3523_3894	123
312	3300053153	Ga0500616_0007329	Ga0500616_0007329_2779_3150	123
313	3300053161	Ga0500634_0006006	Ga0500634_0006006_684_1055	123
314	3300053162	Ga0500638_011409	Ga0500638_011409_1488_1859	123
315	3300053177	Ga0500636_0028693	Ga0500636_0028693_2304_2675	123
316	3300037418	Ga0395900_0578641	Ga0395900_0578641_33_407	124
317	3300046810	Ga0495660_0031545	Ga0495660_0031545_1875_2252	125
318	3300047472	Ga0495686_0095221	Ga0495686_0095221_257_634	125
319	3300048918	Ga0496115_0489463	Ga0496115_0489463_369_746	125
320	3300002773	JGI25152J39213_1000357	JGI25152J39213_100035725	126
321	3300002774	JGI25150J39212_1005094	JGI25150J39212_10050942	126
322	3300003215	JGI25153J46596_10012766	JGI25153J46596_100127661	126
323	3300003775	Ga0055524_1000282	Ga0055524_100028237	126
324	3300003791	Ga0055530_10032389	Ga0055530_100323892	126
325	3300005262	Ga0065165_1146164	Ga0065165_11461641	126
326	3300014497	Ga0182008_10000244	Ga0182008_1000024424	126
327	3300015261	Ga0182006_1000002	Ga0182006_1000002469	126
328	3300015262	Ga0182007_10000073	Ga0182007_1000007360	126
329	3300015265	Ga0182005_1000002	Ga0182005_1000002624	126
330	3300017792	Ga0163161_10026451	Ga0163161_100264515	126
331	3300017792	Ga0163161_10058854	Ga0163161_100588543	126
332	3300025245	Ga0207425_1000001	Ga0207425_10000011496	126
333	3300025258	Ga0209129_1000001	Ga0209129_1000001673	126
334	3300025263	Ga0209565_1010457	Ga0209565_10104571	126
335	3300025263	Ga0209565_1013188	Ga0209565_10131882	126
336	3300025297	Ga0209758_1000073	Ga0209758_1000073222	126
337	3300025298	Ga0209050_1050481	Ga0209050_10504812	126
338	3300025299	Ga0209256_1000116	Ga0209256_1000116149	126
339	3300025303	Ga0209051_1017018	Ga0209051_10170183	126
340	3300031548	Ga0307408_100008652	Ga0307408_1000086527	126
341	3300037471	Ga0395905_0485457	Ga0395905_0485457_237_617	126
342	3300042876	Ga0451577_0008705	Ga0451577_0008705_5219_5599	126
343	3300044683	Ga0466965_0059961	Ga0466965_0059961_272_652	126
344	3300044712	Ga0453684_1885672	Ga0453684_1885672_214_594	126
345	3300044735	Ga0466968_0574668	Ga0466968_0574668_84_464	126
346	3300044901	Ga0466960_0017602	Ga0466960_0017602_537_917	126
347	3300046507	Ga0495606_0029316	Ga0495606_0029316_2710_3090	126
348	3300046530	Ga0495654_0187426	Ga0495654_0187426_34_417	126
349	3300046542	Ga0495597_0034554	Ga0495597_0034554_923_1303	126
350	3300046557	Ga0495622_0036614	Ga0495622_0036614_1690_2073	126
351	3300046557	Ga0495622_0340173	Ga0495622_0340173_129_569	126
352	3300046558	Ga0495633_0000329	Ga0495633_0000329_24314_24697	126
353	3300046616	Ga0495668_0268523	Ga0495668_0268523_389_769	126
354	3300046660	Ga0495625_0001295	Ga0495625_0001295_20484_20864	126
355	3300046664	Ga0495659_0000021	Ga0495659_0000021_55088_55468	126
356	3300046692	Ga0495671_0000102	Ga0495671_0000102_17846_18226	126
357	3300046794	Ga0495589_0124162	Ga0495589_0124162_525_905	126
358	3300046810	Ga0495660_0086662	Ga0495660_0086662_1151_1531	126
359	3300047320	Ga0495672_0000259	Ga0495672_0000259_38143_38523	126
360	3300047445	Ga0495677_0118241	Ga0495677_0118241_183_563	126
361	3300048914	Ga0496111_0059619	Ga0496111_0059619_2190_2624	126
362	3300048917	Ga0496114_1306037	Ga0496114_1306037_72_452	126
363	3300048919	Ga0496116_0071421	Ga0496116_0071421_266_649	126
364	3300048920	Ga0496117_0000001	Ga0496117_0000001_1575991_1576374	126
365	3300048921	Ga0496118_0000002	Ga0496118_0000002_1575991_1576374	126
366	3300048924	Ga0496121_0003928	Ga0496121_0003928_15115_15498	126
367	3300048924	Ga0496121_0008764	Ga0496121_0008764_7922_8305	126
368	3300048925	Ga0496122_0003134	Ga0496122_0003134_1452_1835	126
369	3300048926	Ga0496123_0002013	Ga0496123_0002013_24923_25306	126
370	3300048927	Ga0496124_0235764	Ga0496124_0235764_189_623	126
371	3300048928	Ga0496125_0250561	Ga0496125_0250561_409_792	126
372	3300048929	Ga0496126_0981744	Ga0496126_0981744_141_575	126
373	3300049459	Ga0495678_000128	Ga0495678_000128_48_428	126
374	3300049460	Ga0495682_0002601	Ga0495682_0002601_5127_5510	126
375	3300050489	nmdc:mga03683_54836_c1	nmdc:mga03683_54836_c1_299_679	126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

58

120

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2ht9-assembly1.cif.gz_B	the structure of dimeric human glutaredoxin 2	0.8821	26	120
3h8q-assembly2.cif.gz_B	crystal structure of glutaredoxin domain of human thioredoxin reductase 3	0.8796	23	124
2m46-assembly1.cif.gz_A	solution nmr structure of sacol0876 from staphylococcus aureus col, nesg target zr353 and csgid target idp00841	0.8719	39	68
2fls-assembly1.cif.gz_A	crystal structure of human glutaredoxin 2 complexed with glutathione	0.8713	26	120
2e7p-assembly5.cif.gz_D	crystal structure of the holo form of glutaredoxin c1 from populus tremula x tremuloides	0.8698	26	120

ID	Description	Score	Start	End	Superfamily
af_Q54EX7_20_123_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9308	21	123	3.40.30.10
af_Q54EX7_20_123_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9136	21	123	3.40.30.10
af_B4FIR4_56_163_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.8755	24	121	3.40.30.10
2m46A00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.8719	39	68	3.40.30.10
2e7pD00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.8698	26	120	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A085WEH0-F1-model_v4	Glutaredoxin-related protein	0.9755	21	115	GO:0015035
AF-A0A3D0UWH2-F1-model_v4	deleted	0.9725	37	115
AF-A0A7Y5NTT3-F1-model_v4	Glutaredoxin	0.9687	20	125	GO:0005737 GO:0015038 GO:0034599
AF-A0A7S4MYB7-F1-model_v4	Glutaredoxin domain-containing protein	0.9544	20	122	GO:0005739 GO:0015035
AF-A0A7Y5NTT3-F1-model_v4	Glutaredoxin	0.9511	20	125	GO:0005737 GO:0015038 GO:0034599

Feature Viewer

pLDDT	pTM	Quality
81.02	0.75	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F427151

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00462

Glutaredoxin

Glutaredoxin

58

120

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map