F427139

General Info

Members Datasets Scaffolds Average Seq Length
375 153 368 171

Family's Representative Sequence

Representative Sequence 3300046458|Ga0495591_005117|Ga0495591_005117_3495_4037
Length 180
Sequence MNSKLTRMITTSQTVGPFSHEAWQWAADACLPGALKTSGPTLLLSGVIYDGDGNPINDAQIEAWIPAGAADEAEQLIPGFRRAPSGADGEFSMRIPASGLEAGAAGEPAAYITVFARGLVKHQFTAVFLEDAAGLAQSAILNQVPEARRATLLARKTGDGQYHWDIRMQGEQETAFFDYV

Samples

Sample ID Description Type Environment
1 2643221645 Massilia sp. Root351 Isolate Unclassified
2 2643221664 Massilia sp. Root418 Isolate Unclassified
3 2738541280 Massilia sp. GV090 Isolate Unclassified
4 2842711865 Duganella sp. R-73148 Isolate Unclassified
5 2857553236 Duganella sp. R-74557 Isolate Unclassified
6 2904424332 Duganella sp. 1411 Isolate Rhizosphere
7 2919476304 Duganella sp. 3397 Isolate Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
26 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
27 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
28 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
37 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
38 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
45 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
60 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
63 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
66 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
67 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
68 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
69 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
70 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
71 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
72 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
73 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
79 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
83 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
84 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
85 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
86 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
87 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
117 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
143 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
144 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
150 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
151 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
152 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 1.33
Isolates 1.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.07
Nodule 0.27
Rhizoplane 2.13
Rhizosphere 82.67
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000021 3300002737 Bacteria 248155
2 JGI25154J39366_1001376 3300002738 Bacteria 8823
3 JGI25151J46595_10019261 3300003187 Bacteria 2903
4 JGI25165J46597_1000049 3300003214 Bacteria 248154
5 JGI25153J46596_10061335 3300003215 Bacteria 1019
6 rootL2_10031747 3300003322 Bacteria 2326
7 rootL2_10038603 3300003322 Bacteria 2520
8 rootL2_10135738 3300003322 Bacteria 1307
9 rootH1_10281653 3300003323 Bacteria 1413
10 Ga0055538_1000023 3300003751 Bacteria 248154
11 Ga0055539_1000030 3300003752 Bacteria 248154
12 Ga0055533_1000039 3300003756 Bacteria 248154
13 Ga0055525_1000048 3300003759 Bacteria 248154
14 Ga0055529_1000293 3300003763 Bacteria 58070
15 Ga0055541_1000021 3300003841 Bacteria 248154
16 Ga0065165_1001702 3300005262 Bacteria 22116
17 Ga0075370_10583309 3300006353 Bacteria 677
18 Ga0079104_1006317 3300006946 Bacteria 4515
19 Ga0105244_10000722 3300009036 Bacteria 28538
20 Ga0182006_1000017 3300015261 Bacteria 299454
21 Ga0182007_10222318 3300015262 Bacteria 667
22 Ga0182005_1000051 3300015265 Bacteria 114808
23 Ga0209760_103094 3300025207 Bacteria 1496
24 Ga0209784_100004 3300025224 Bacteria 1378156
25 Ga0209566_100004 3300025225 Bacteria 1531866
26 Ga0209674_100006 3300025226 Bacteria 1531866
27 Ga0209672_112222 3300025228 Bacteria 1073
28 Ga0209563_100009 3300025230 Bacteria 1378156
29 Ga0207427_100821 3300025231 Bacteria 13997
30 Ga0209437_100004 3300025233 Bacteria 1378156
31 Ga0207425_1000081 3300025245 Bacteria 97913
32 Ga0209646_1000023 3300025246 Bacteria 441100
33 Ga0209677_100005 3300025253 Bacteria 1378156
34 Ga0209233_1000005 3300025261 Bacteria 1531866
35 Ga0209233_1061482 3300025261 Bacteria 723
36 Ga0209455_1000044 3300025272 Bacteria 410787
37 Ga0209025_1002838 3300025294 Bacteria 17389
38 Ga0209564_1000011 3300025295 Bacteria 822327
39 Ga0209758_1007003 3300025297 Bacteria 7843
40 Ga0307515_10092366 3300028794 Bacteria 3768
41 Ga0316181_1199621 3300030744 Bacteria 2234
42 Ga0307408_100000546 3300031548 Bacteria 32433
43 Ga0395899_0034898 3300037312 Bacteria 3777
44 Ga0395898_0675290 3300037466 Bacteria 975
45 Ga0395905_0407517 3300037471 Bacteria 1255
46 Ga0395901_0812043 3300038443 Bacteria 923
47 Ga0450904_000380 3300042139 Bacteria 9235
48 Ga0466969_0148213 3300044656 Bacteria 1082
49 Ga0466966_0070719 3300044684 Bacteria 2187
50 Ga0466961_0439937 3300044693 Bacteria 789
51 Ga0466968_0041049 3300044735 Bacteria 1952
52 Ga0466970_0016236 3300044765 Bacteria 3837
53 Ga0466957_0844764 3300044842 Bacteria 652
54 Ga0466959_0046471 3300045049 Bacteria 3194
55 Ga0495617_000569 3300046452 Bacteria 18955
56 Ga0495627_000008 3300046453 Bacteria 572150
57 Ga0495627_035105 3300046453 Bacteria 1564
58 Ga0495603_0461314 3300046455 Bacteria 728
59 Ga0495590_0000005 3300046457 Bacteria 384276
60 Ga0495590_0000013 3300046457 Bacteria 271977
61 Ga0495590_0000182 3300046457 Bacteria 36534
62 Ga0495591_000109 3300046458 Bacteria 94877
63 Ga0495591_005117 3300046458 Bacteria 6155
64 Ga0495638_0000027 3300046460 Bacteria 337569
65 Ga0495638_0012294 3300046460 Bacteria 5872
66 Ga0495651_0001952 3300046462 Bacteria 15936
67 Ga0495651_0009143 3300046462 Bacteria 7604
68 Ga0495653_0000009 3300046463 Bacteria 304207
69 Ga0495650_0000322 3300046471 Bacteria 85802
70 Ga0495650_0006100 3300046471 Bacteria 7596
71 Ga0495650_0011252 3300046471 Bacteria 4916
72 Ga0495650_0055310 3300046471 Bacteria 1615
73 Ga0495650_0112373 3300046471 Bacteria 1010
74 Ga0495582_0010535 3300046473 Bacteria 5085
75 Ga0495605_0000023 3300046474 Bacteria 236732
76 Ga0495605_0001269 3300046474 Bacteria 16723
77 Ga0495605_0002220 3300046474 Bacteria 12125
78 Ga0495605_0005274 3300046474 Bacteria 7543
79 Ga0495605_0010792 3300046474 Bacteria 5105
80 Ga0495605_0011655 3300046474 Bacteria 4892
81 Ga0495605_0055249 3300046474 Bacteria 1919
82 Ga0495639_0003323 3300046475 Bacteria 6970
83 Ga0495584_0000029 3300046491 Bacteria 105850
84 Ga0495584_0007007 3300046491 Bacteria 5887
85 Ga0495584_0013776 3300046491 Bacteria 4123
86 Ga0495584_0016604 3300046491 Bacteria 3754
87 Ga0495584_0016950 3300046491 Bacteria 3712
88 Ga0495584_0192524 3300046491 Bacteria 1036
89 Ga0495584_0408471 3300046491 Bacteria 690
90 Ga0495585_0004702 3300046492 Bacteria 8798
91 Ga0495585_0010232 3300046492 Bacteria 5597
92 Ga0495585_0021498 3300046492 Bacteria 3703
93 Ga0495585_0031072 3300046492 Bacteria 3035
94 Ga0495585_0120870 3300046492 Bacteria 1385
95 Ga0495596_0000991 3300046500 Bacteria 16870
96 Ga0495596_0006725 3300046500 Bacteria 5258
97 Ga0495596_0026391 3300046500 Bacteria 2342
98 Ga0495596_0049094 3300046500 Bacteria 1654
99 Ga0495596_0050518 3300046500 Bacteria 1629
100 Ga0495596_0078862 3300046500 Bacteria 1278
101 Ga0495607_0000656 3300046501 Bacteria 33590
102 Ga0495607_0002596 3300046501 Bacteria 14539
103 Ga0495607_0008026 3300046501 Bacteria 7249
104 Ga0495607_0019553 3300046501 Bacteria 4299
105 Ga0495607_0049445 3300046501 Bacteria 2452
106 Ga0495607_0063678 3300046501 Bacteria 2085
107 Ga0495607_0189553 3300046501 Bacteria 1025
108 Ga0495607_0558561 3300046501 Bacteria 501
109 Ga0495583_0000378 3300046506 Bacteria 69104
110 Ga0495583_0001067 3300046506 Bacteria 30637
111 Ga0495583_0001070 3300046506 Bacteria 30573
112 Ga0495583_0001391 3300046506 Bacteria 24725
113 Ga0495583_0003300 3300046506 Bacteria 12506
114 Ga0495583_0006930 3300046506 Bacteria 7276
115 Ga0495583_0007961 3300046506 Bacteria 6557
116 Ga0495583_0019947 3300046506 Bacteria 3486
117 Ga0495583_0167470 3300046506 Bacteria 904
118 Ga0495606_0000062 3300046507 Bacteria 184841
119 Ga0495606_0000509 3300046507 Bacteria 63142
120 Ga0495606_0014830 3300046507 Bacteria 6054
121 Ga0495606_0092127 3300046507 Bacteria 1862
122 Ga0495606_0099300 3300046507 Bacteria 1775
123 Ga0495606_0134856 3300046507 Bacteria 1463
124 Ga0495606_0141957 3300046507 Bacteria 1417
125 Ga0495606_0168017 3300046507 Bacteria 1275
126 Ga0495606_0210072 3300046507 Bacteria 1103
127 Ga0495606_0224793 3300046507 Bacteria 1055
128 Ga0495606_0316898 3300046507 Bacteria 839
129 Ga0495608_0018514 3300046511 Bacteria 4803
130 Ga0495610_0005163 3300046512 Bacteria 9362
131 Ga0495610_0005344 3300046512 Bacteria 9163
132 Ga0495610_0008759 3300046512 Bacteria 6498
133 Ga0495610_0009084 3300046512 Bacteria 6333
134 Ga0495610_0043605 3300046512 Bacteria 2233
135 Ga0495610_0306305 3300046512 Bacteria 611
136 Ga0495616_0000012 3300046513 Bacteria 211342
137 Ga0495616_0000282 3300046513 Bacteria 41088
138 Ga0495616_0000974 3300046513 Bacteria 20508
139 Ga0495616_0009502 3300046513 Bacteria 5678
140 Ga0495616_0015131 3300046513 Bacteria 4293
141 Ga0495616_0021305 3300046513 Bacteria 3511
142 Ga0495628_0000366 3300046516 Bacteria 41368
143 Ga0495628_0408250 3300046516 Bacteria 991
144 Ga0495631_0000737 3300046518 Bacteria 21033
145 Ga0495631_0007422 3300046518 Bacteria 5572
146 Ga0495631_0008115 3300046518 Bacteria 5303
147 Ga0495631_0017581 3300046518 Bacteria 3379
148 Ga0495631_0150363 3300046518 Bacteria 999
149 Ga0495631_0182218 3300046518 Bacteria 900
150 Ga0495632_0000012 3300046519 Bacteria 264389
151 Ga0495632_0000367 3300046519 Bacteria 42974
152 Ga0495632_0000530 3300046519 Bacteria 36061
153 Ga0495632_0000909 3300046519 Bacteria 25947
154 Ga0495632_0038904 3300046519 Bacteria 2404
155 Ga0495632_0115414 3300046519 Bacteria 1258
156 Ga0495637_0000008 3300046520 Bacteria 404658
157 Ga0495637_0056152 3300046520 Bacteria 1630
158 Ga0495637_0063355 3300046520 Bacteria 1511
159 Ga0495643_0000028 3300046522 Bacteria 262886
160 Ga0495643_0000141 3300046522 Bacteria 115660
161 Ga0495643_0000167 3300046522 Bacteria 104447
162 Ga0495643_0000172 3300046522 Bacteria 102566
163 Ga0495643_0006190 3300046522 Bacteria 7942
164 Ga0495643_0070571 3300046522 Bacteria 1834
165 Ga0495644_0000590 3300046523 Bacteria 15203
166 Ga0495644_0006849 3300046523 Bacteria 4412
167 Ga0495644_0009787 3300046523 Bacteria 3691
168 Ga0495644_0010013 3300046523 Bacteria 3652
169 Ga0495644_0013218 3300046523 Bacteria 3171
170 Ga0495644_0019330 3300046523 Bacteria 2601
171 Ga0495644_0156438 3300046523 Bacteria 873
172 Ga0495648_0000002 3300046524 Bacteria 593972
173 Ga0495648_0000648 3300046524 Bacteria 37132
174 Ga0495648_0017288 3300046524 Bacteria 5164
175 Ga0495648_0135868 3300046524 Bacteria 1300
176 Ga0495648_0177387 3300046524 Bacteria 1086
177 Ga0495648_0324124 3300046524 Bacteria 713
178 Ga0495648_0409612 3300046524 Bacteria 603
179 Ga0495642_0000091 3300046528 Bacteria 53133
180 Ga0495642_0000938 3300046528 Bacteria 13644
181 Ga0495642_0022137 3300046528 Bacteria 2503
182 Ga0495642_0036822 3300046528 Bacteria 1978
183 Ga0495652_0007817 3300046529 Bacteria 9822
184 Ga0495652_0046165 3300046529 Bacteria 3741
185 Ga0495652_0120178 3300046529 Bacteria 2097
186 Ga0495654_0012346 3300046530 Bacteria 4590
187 Ga0495587_0020146 3300046536 Bacteria 4120
188 Ga0495609_0000340 3300046538 Bacteria 41415
189 Ga0495609_0001305 3300046538 Bacteria 17002
190 Ga0495609_0001492 3300046538 Bacteria 15496
191 Ga0495609_0028345 3300046538 Bacteria 2555
192 Ga0495609_0069271 3300046538 Bacteria 1551
193 Ga0495609_0106450 3300046538 Bacteria 1212
194 Ga0495609_0115375 3300046538 Bacteria 1157
195 Ga0495609_0148107 3300046538 Bacteria 999
196 Ga0495597_0000074 3300046542 Bacteria 86697
197 Ga0495597_0003305 3300046542 Bacteria 9522
198 Ga0495597_0010522 3300046542 Bacteria 4515
199 Ga0495597_0177850 3300046542 Bacteria 861
200 Ga0495645_0017870 3300046543 Bacteria 5089
201 Ga0495645_0122370 3300046543 Bacteria 1831
202 Ga0495622_0000002 3300046557 Bacteria 321742
203 Ga0495622_0000200 3300046557 Bacteria 47745
204 Ga0495633_0000033 3300046558 Bacteria 186714
205 Ga0495633_0000807 3300046558 Bacteria 27781
206 Ga0495633_0000874 3300046558 Bacteria 26052
207 Ga0495633_0001371 3300046558 Bacteria 19037
208 Ga0495633_0021700 3300046558 Bacteria 3208
209 Ga0495633_0111692 3300046558 Bacteria 1267
210 Ga0495656_0024198 3300046615 Bacteria 2396
211 Ga0495656_0050034 3300046615 Bacteria 1782
212 Ga0495656_0064373 3300046615 Bacteria 1610
213 Ga0495668_0000065 3300046616 Bacteria 178985
214 Ga0495668_0000091 3300046616 Bacteria 144428
215 Ga0495668_0005360 3300046616 Bacteria 8741
216 Ga0495668_0025160 3300046616 Bacteria 3384
217 Ga0495668_0054601 3300046616 Bacteria 2207
218 Ga0495668_0190663 3300046616 Bacteria 1123
219 Ga0495634_0564963 3300046642 Bacteria 662
220 Ga0495611_0001733 3300046648 Bacteria 10560
221 Ga0495611_0002070 3300046648 Bacteria 9440
222 Ga0495611_0037055 3300046648 Bacteria 2166
223 Ga0495611_0037708 3300046648 Bacteria 2148
224 Ga0495611_0231285 3300046648 Bacteria 859
225 Ga0495611_0251448 3300046648 Bacteria 819
226 Ga0495625_0000121 3300046660 Bacteria 121186
227 Ga0495625_0005012 3300046660 Bacteria 12284
228 Ga0495625_0005529 3300046660 Bacteria 11488
229 Ga0495625_0022491 3300046660 Bacteria 4834
230 Ga0495625_0057884 3300046660 Bacteria 2755
231 Ga0495625_0099240 3300046660 Bacteria 2002
232 Ga0495625_0318012 3300046660 Bacteria 992
233 Ga0495661_0000049 3300046665 Bacteria 144060
234 Ga0495661_0002043 3300046665 Bacteria 15869
235 Ga0495661_0015069 3300046665 Bacteria 5166
236 Ga0495661_0029014 3300046665 Bacteria 3535
237 Ga0495661_0034209 3300046665 Bacteria 3198
238 Ga0495661_0036641 3300046665 Bacteria 3069
239 Ga0495661_0096106 3300046665 Bacteria 1676
240 Ga0495661_0377022 3300046665 Bacteria 693
241 Ga0495588_0124313 3300046674 Bacteria 1360
242 Ga0495623_0390791 3300046679 Bacteria 750
243 Ga0495669_0001448 3300046684 Bacteria 9794
244 Ga0495669_0002071 3300046684 Bacteria 8216
245 Ga0495669_0004623 3300046684 Bacteria 5703
246 Ga0495669_0113793 3300046684 Bacteria 1265
247 Ga0495670_0009505 3300046691 Bacteria 4779
248 Ga0495670_0021829 3300046691 Bacteria 3160
249 Ga0495670_0028126 3300046691 Bacteria 2787
250 Ga0495670_0055357 3300046691 Bacteria 1989
251 Ga0495670_0144329 3300046691 Bacteria 1246
252 Ga0495671_0000159 3300046692 Bacteria 59318
253 Ga0495671_0031198 3300046692 Bacteria 2725
254 Ga0495671_0038901 3300046692 Bacteria 2403
255 Ga0495671_0089904 3300046692 Bacteria 1503
256 Ga0495671_0229023 3300046692 Bacteria 899
257 Ga0495649_0000071 3300046694 Bacteria 89386
258 Ga0495649_0002364 3300046694 Bacteria 13344
259 Ga0495649_0002621 3300046694 Bacteria 12553
260 Ga0495649_0008728 3300046694 Bacteria 6079
261 Ga0495649_0199644 3300046694 Bacteria 1039
262 Ga0495649_0281093 3300046694 Bacteria 850
263 Ga0495649_0355231 3300046694 Bacteria 740
264 Ga0495589_0012406 3300046794 Bacteria 4413
265 Ga0495589_0019238 3300046794 Bacteria 3502
266 Ga0495589_0046276 3300046794 Bacteria 2160
267 Ga0495589_0060610 3300046794 Bacteria 1858
268 Ga0495660_0000118 3300046810 Bacteria 85202
269 Ga0495660_0001415 3300046810 Bacteria 16450
270 Ga0495660_0005787 3300046810 Bacteria 7384
271 Ga0495660_0014199 3300046810 Bacteria 4612
272 Ga0495660_0024566 3300046810 Bacteria 3431
273 Ga0495660_0047170 3300046810 Bacteria 2360
274 Ga0495660_0081938 3300046810 Bacteria 1690
275 Ga0495636_0421517 3300047318 Archaea 638
276 Ga0495672_0000033 3300047320 Bacteria 291992
277 Ga0495672_0000116 3300047320 Bacteria 127119
278 Ga0495672_0000165 3300047320 Bacteria 96215
279 Ga0495672_0000212 3300047320 Bacteria 83026
280 Ga0495672_0001165 3300047320 Bacteria 26623
281 Ga0495672_0002035 3300047320 Bacteria 19028
282 Ga0495672_0002289 3300047320 Bacteria 17757
283 Ga0495676_0450098 3300047321 Bacteria 849
284 Ga0495676_0480130 3300047321 Bacteria 818
285 Ga0495683_0000168 3300047323 Bacteria 63828
286 Ga0495683_0003747 3300047323 Bacteria 8789
287 Ga0495683_0021358 3300047323 Bacteria 3336
288 Ga0495683_0219375 3300047323 Bacteria 848
289 Ga0495687_000012 3300047443 Bacteria 391586
290 Ga0495687_000369 3300047443 Bacteria 56056
291 Ga0495687_000924 3300047443 Bacteria 30497
292 Ga0495687_001452 3300047443 Bacteria 21757
293 Ga0495677_0000242 3300047445 Bacteria 24158
294 Ga0495677_0000762 3300047445 Bacteria 12968
295 Ga0495677_0001146 3300047445 Bacteria 10597
296 Ga0495677_0002206 3300047445 Bacteria 7721
297 Ga0495677_0004095 3300047445 Bacteria 5630
298 Ga0495677_0092238 3300047445 Bacteria 1142
299 Ga0495679_014549 3300047446 Bacteria 2909
300 Ga0495679_074004 3300047446 Bacteria 976
301 Ga0495679_085813 3300047446 Bacteria 888
302 Ga0495685_000553 3300047447 Bacteria 11583
303 Ga0495673_0000113 3300047469 Bacteria 163495
304 Ga0495681_0000016 3300047470 Bacteria 181322
305 Ga0495681_0005074 3300047470 Bacteria 8878
306 Ga0495681_0015280 3300047470 Bacteria 4350
307 Ga0495681_0020400 3300047470 Bacteria 3597
308 Ga0495686_0009427 3300047472 Bacteria 7032
309 Ga0495686_0025304 3300047472 Bacteria 3892
310 Ga0495602_0012386 3300048088 Bacteria 8770
311 Ga0495602_0673608 3300048088 Bacteria 704
312 Ga0495626_0001196 3300048091 Bacteria 21538
313 Ga0495626_0001564 3300048091 Bacteria 17953
314 Ga0495626_0009725 3300048091 Bacteria 5181
315 Ga0495626_0018495 3300048091 Bacteria 3498
316 Ga0495626_0019945 3300048091 Bacteria 3344
317 Ga0495626_0032358 3300048091 Bacteria 2512
318 Ga0495626_0039790 3300048091 Bacteria 2223
319 Ga0495626_0042092 3300048091 Bacteria 2147
320 Ga0495626_0042838 3300048091 Bacteria 2126
321 Ga0495626_0043099 3300048091 Bacteria 2118
322 Ga0495626_0083174 3300048091 Bacteria 1418
323 Ga0495626_0096802 3300048091 Bacteria 1291
324 Ga0495626_0123582 3300048091 Bacteria 1110
325 Ga0495626_0136015 3300048091 Bacteria 1045
326 Ga0496100_0056032 3300048903 Bacteria 2577
327 Ga0496101_0311275 3300048904 Bacteria 1234
328 Ga0496102_0155262 3300048905 Bacteria 2151
329 Ga0496103_0000854 3300048906 Bacteria 22289
330 Ga0496109_0025727 3300048912 Bacteria 5245
331 Ga0496112_0241392 3300048915 Bacteria 1759
332 Ga0496114_0066648 3300048917 Bacteria 3019
333 Ga0496115_0126330 3300048918 Bacteria 2107
334 Ga0496116_0031593 3300048919 Bacteria 3788
335 Ga0496116_0126523 3300048919 Bacteria 1467
336 Ga0496122_0001753 3300048925 Bacteria 33345
337 Ga0496123_0003705 3300048926 Bacteria 16808
338 Ga0496123_0242576 3300048926 Bacteria 894
339 Ga0496124_0004257 3300048927 Bacteria 16843
340 Ga0496124_0033658 3300048927 Bacteria 4507
341 Ga0496124_0500075 3300048927 Bacteria 815
342 Ga0496125_0004347 3300048928 Bacteria 16436
343 Ga0501307_014910 3300049162 Bacteria 955
344 Ga0495678_000024 3300049459 Bacteria 229034
345 Ga0495678_000029 3300049459 Bacteria 219803
346 Ga0495678_000032 3300049459 Bacteria 212537
347 Ga0495678_000061 3300049459 Bacteria 142649
348 Ga0495678_000193 3300049459 Bacteria 71591
349 Ga0495678_054345 3300049459 Bacteria 1533
350 Ga0495678_066608 3300049459 Bacteria 1333
351 Ga0495682_0000094 3300049460 Bacteria 78278
352 Ga0495682_0000130 3300049460 Bacteria 65523
353 Ga0495682_0006516 3300049460 Bacteria 4717
354 Ga0501313_000280 3300049529 Bacteria 3166
355 Ga0501315_020932 3300049531 Bacteria 882
356 Ga0501316_036992 3300049532 Bacteria 670
357 Ga0501230_016246 3300049667 Bacteria 1245
358 Ga0501249_009620 3300049679 Bacteria 2011
359 Ga0501269_000034 3300049766 Bacteria 42532
360 nmdc:mga03683_223730_c1 3300050489 Bacteria 869
361 nmdc:mga00v17_676697_c1 3300050491 Bacteria 662
362 nmdc:mga07m45_536079_c1 3300050496 Bacteria 677
363 Ga0495601_0116525 3300053077 Bacteria 1733
364 Ga0500562_065692 3300053108 Bacteria 977
365 Ga0500559_0239472 3300053136 Bacteria 855
366 Ga0500586_000014 3300053145 Bacteria 37183
367 Ga0587083_0017906 3300059505 Bacteria 1273
368 Ga0466962_0134762 3300061719 Bacteria 1195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0812043 Ga0395901_0812043_445_891 133
2 3300046473 Ga0495582_0010535 Ga0495582_0010535_24_467 145
3 3300046642 Ga0495634_0564963 Ga0495634_0564963_10_453 145
4 3300046453 Ga0495627_035105 Ga0495627_035105_32_478 146
5 3300046491 Ga0495584_0016950 Ga0495584_0016950_972_1418 146
6 3300046501 Ga0495607_0558561 Ga0495607_0558561_36_482 146
7 3300046512 Ga0495610_0306305 Ga0495610_0306305_18_464 146
8 3300046524 Ga0495648_0324124 Ga0495648_0324124_253_699 146
9 3300046520 Ga0495637_0000008 Ga0495637_0000008_85147_85668 149
10 3300046694 Ga0495649_0000071 Ga0495649_0000071_56617_57138 150
11 3300046522 Ga0495643_0006190 Ga0495643_0006190_2796_3317 151
12 3300049459 Ga0495678_000024 Ga0495678_000024_124416_124937 151
13 3300046457 Ga0495590_0000013 Ga0495590_0000013_185925_186446 156
14 3300046458 Ga0495591_000109 Ga0495591_000109_15373_15894 156
15 3300046471 Ga0495650_0112373 Ga0495650_0112373_11_532 156
16 3300046474 Ga0495605_0011655 Ga0495605_0011655_2768_3289 156
17 3300046491 Ga0495584_0000029 Ga0495584_0000029_17409_17930 156
18 3300046500 Ga0495596_0006725 Ga0495596_0006725_4452_4973 156
19 3300046501 Ga0495607_0002596 Ga0495607_0002596_1562_2083 156
20 3300046507 Ga0495606_0092127 Ga0495606_0092127_468_989 156
21 3300046512 Ga0495610_0005163 Ga0495610_0005163_8684_9205 156
22 3300046519 Ga0495632_0038904 Ga0495632_0038904_103_624 156
23 3300046523 Ga0495644_0010013 Ga0495644_0010013_3105_3626 156
24 3300046538 Ga0495609_0148107 Ga0495609_0148107_138_659 156
25 3300046558 Ga0495633_0000874 Ga0495633_0000874_11829_12350 156
26 3300046616 Ga0495668_0025160 Ga0495668_0025160_2502_3023 156
27 3300046648 Ga0495611_0001733 Ga0495611_0001733_9402_9923 156
28 3300046684 Ga0495669_0004623 Ga0495669_0004623_770_1291 156
29 3300046794 Ga0495589_0012406 Ga0495589_0012406_2841_3362 156
30 3300046810 Ga0495660_0081938 Ga0495660_0081938_1067_1588 156
31 3300047320 Ga0495672_0000033 Ga0495672_0000033_182416_182937 156
32 3300047323 Ga0495683_0000168 Ga0495683_0000168_32432_32953 156
33 3300047445 Ga0495677_0001146 Ga0495677_0001146_5395_5916 156
34 3300047446 Ga0495679_014549 Ga0495679_014549_1202_1723 156
35 3300047470 Ga0495681_0020400 Ga0495681_0020400_2928_3449 156
36 3300049460 Ga0495682_0006516 Ga0495682_0006516_1623_2144 156
37 3300049679 Ga0501249_009620 Ga0501249_009620_409_930 156
38 3300049766 Ga0501269_000034 Ga0501269_000034_14309_14830 156
39 3300046506 Ga0495583_0003300 Ga0495583_0003300_4035_4556 157
40 3300046518 Ga0495631_0000737 Ga0495631_0000737_4993_5514 157
41 3300037466 Ga0395898_0675290 Ga0395898_0675290_130_651 158
42 3300048091 Ga0495626_0042838 Ga0495626_0042838_692_1213 160
43 3300050491 nmdc:mga00v17_676697_c1 nmdc:mga00v17_676697_c1_122_643 162
44 3300046519 Ga0495632_0115414 Ga0495632_0115414_189_698 163
45 3300003187 JGI25151J46595_10019261 JGI25151J46595_100192612 165
46 3300003215 JGI25153J46596_10061335 JGI25153J46596_100613352 165
47 3300025245 Ga0207425_1000081 Ga0207425_100008146 165
48 3300025294 Ga0209025_1002838 Ga0209025_10028385 165
49 3300025297 Ga0209758_1007003 Ga0209758_10070033 165
50 iso_pu_bacteria 2904424332 2904425810 165
51 3300025295 Ga0209564_1000011 Ga0209564_1000011500 166
52 3300028794 Ga0307515_10092366 Ga0307515_100923662 166
53 3300046507 Ga0495606_0014830 Ga0495606_0014830_5100_5600 166
54 3300046512 Ga0495610_0008759 Ga0495610_0008759_5849_6349 166
55 3300046512 Ga0495610_0009084 Ga0495610_0009084_36_536 166
56 3300046558 Ga0495633_0001371 Ga0495633_0001371_2371_2871 166
57 3300046692 Ga0495671_0089904 Ga0495671_0089904_403_921 166
58 3300046694 Ga0495649_0281093 Ga0495649_0281093_151_669 166
59 3300048919 Ga0496116_0126523 Ga0496116_0126523_94_594 166
60 3300050489 nmdc:mga03683_223730_c1 nmdc:mga03683_223730_c1_75_575 166
61 3300053136 Ga0500559_0239472 Ga0500559_0239472_151_651 166
62 3300053145 Ga0500586_000014 Ga0500586_000014_33187_33687 166
63 3300003322 rootL2_10031747 rootL2_100317472 167
64 3300003322 rootL2_10135738 rootL2_101357382 167
65 3300003323 rootH1_10281653 rootH1_102816532 167
66 3300046463 Ga0495653_0000009 Ga0495653_0000009_287306_287809 167
67 3300046474 Ga0495605_0000023 Ga0495605_0000023_156011_156514 167
68 iso_pu_bacteria 2643221645 2644252730 167
69 iso_pu_bacteria 2643221664 2644355208 167
70 iso_pu_bacteria 2857553236 2857556009 167
71 iso_pu_bacteria 2919476304 2919478312 167
72 3300044765 Ga0466970_0016236 Ga0466970_0016236_308_832 168
73 3300046501 Ga0495607_0049445 Ga0495607_0049445_409_921 168
74 3300046507 Ga0495606_0000062 Ga0495606_0000062_45959_46471 168
75 3300046512 Ga0495610_0005344 Ga0495610_0005344_3057_3569 168
76 3300046558 Ga0495633_0021700 Ga0495633_0021700_871_1383 168
77 3300046616 Ga0495668_0000091 Ga0495668_0000091_69227_69739 168
78 3300047321 Ga0495676_0450098 Ga0495676_0450098_276_782 168
79 3300047472 Ga0495686_0025304 Ga0495686_0025304_1428_1940 168
80 iso_pu_bacteria 2842711865 2842715419 168
81 3300003763 Ga0055529_1000293 Ga0055529_100029326 169
82 3300009036 Ga0105244_10000722 Ga0105244_1000072225 169
83 3300025261 Ga0209233_1061482 Ga0209233_10614821 169
84 3300025272 Ga0209455_1000044 Ga0209455_1000044350 169
85 3300030744 Ga0316181_1199621 Ga0316181_11996213 169
86 3300046471 Ga0495650_0000322 Ga0495650_0000322_16993_17508 169
87 3300046474 Ga0495605_0005274 Ga0495605_0005274_1963_2484 169
88 3300046474 Ga0495605_0010792 Ga0495605_0010792_748_1263 169
89 3300046492 Ga0495585_0031072 Ga0495585_0031072_182_703 169
90 3300046500 Ga0495596_0000991 Ga0495596_0000991_5651_6166 169
91 3300046512 Ga0495610_0043605 Ga0495610_0043605_697_1218 169
92 3300046513 Ga0495616_0000012 Ga0495616_0000012_42021_42542 169
93 3300046518 Ga0495631_0008115 Ga0495631_0008115_4646_5167 169
94 3300046519 Ga0495632_0000367 Ga0495632_0000367_28482_29003 169
95 3300046524 Ga0495648_0017288 Ga0495648_0017288_3103_3615 169
96 3300046528 Ga0495642_0000091 Ga0495642_0000091_39564_40085 169
97 3300046530 Ga0495654_0012346 Ga0495654_0012346_4034_4555 169
98 3300046538 Ga0495609_0069271 Ga0495609_0069271_122_643 169
99 3300046542 Ga0495597_0003305 Ga0495597_0003305_4006_4545 169
100 3300046616 Ga0495668_0190663 Ga0495668_0190663_488_1003 169
101 3300046660 Ga0495625_0005012 Ga0495625_0005012_5606_6127 169
102 3300046684 Ga0495669_0002071 Ga0495669_0002071_4737_5258 169
103 3300046691 Ga0495670_0009505 Ga0495670_0009505_1395_1916 169
104 3300046692 Ga0495671_0000159 Ga0495671_0000159_43922_44461 169
105 3300046694 Ga0495649_0199644 Ga0495649_0199644_428_943 169
106 3300046794 Ga0495589_0019238 Ga0495589_0019238_2290_2805 169
107 3300047320 Ga0495672_0002035 Ga0495672_0002035_3898_4437 169
108 3300047321 Ga0495676_0480130 Ga0495676_0480130_226_741 169
109 3300047323 Ga0495683_0003747 Ga0495683_0003747_3990_4505 169
110 3300047445 Ga0495677_0092238 Ga0495677_0092238_240_761 169
111 3300048091 Ga0495626_0123582 Ga0495626_0123582_219_734 169
112 3300048906 Ga0496103_0000854 Ga0496103_0000854_8320_8841 169
113 3300048917 Ga0496114_0066648 Ga0496114_0066648_148_669 169
114 iso_pu_bacteria 2738541280 2738741348 169
115 3300037471 Ga0395905_0407517 Ga0395905_0407517_589_1107 170
116 3300046452 Ga0495617_000569 Ga0495617_000569_7427_7945 170
117 3300046455 Ga0495603_0461314 Ga0495603_0461314_177_695 170
118 3300046457 Ga0495590_0000182 Ga0495590_0000182_6072_6590 170
119 3300046462 Ga0495651_0009143 Ga0495651_0009143_5256_5774 170
120 3300046471 Ga0495650_0011252 Ga0495650_0011252_3265_3783 170
121 3300046491 Ga0495584_0016604 Ga0495584_0016604_582_1100 170
122 3300046492 Ga0495585_0021498 Ga0495585_0021498_2619_3137 170
123 3300046501 Ga0495607_0019553 Ga0495607_0019553_3555_4073 170
124 3300046506 Ga0495583_0167470 Ga0495583_0167470_371_889 170
125 3300046507 Ga0495606_0099300 Ga0495606_0099300_1009_1527 170
126 3300046507 Ga0495606_0141957 Ga0495606_0141957_331_849 170
127 3300046507 Ga0495606_0210072 Ga0495606_0210072_85_603 170
128 3300046507 Ga0495606_0316898 Ga0495606_0316898_212_730 170
129 3300046511 Ga0495608_0018514 Ga0495608_0018514_3143_3661 170
130 3300046513 Ga0495616_0021305 Ga0495616_0021305_218_736 170
131 3300046516 Ga0495628_0000366 Ga0495628_0000366_10175_10693 170
132 3300046519 Ga0495632_0000012 Ga0495632_0000012_49888_50406 170
133 3300046523 Ga0495644_0000590 Ga0495644_0000590_2383_2901 170
134 3300046529 Ga0495652_0007817 Ga0495652_0007817_2114_2632 170
135 3300046536 Ga0495587_0020146 Ga0495587_0020146_2558_3076 170
136 3300046538 Ga0495609_0001305 Ga0495609_0001305_12959_13477 170
137 3300046542 Ga0495597_0010522 Ga0495597_0010522_2846_3364 170
138 3300046543 Ga0495645_0122370 Ga0495645_0122370_85_603 170
139 3300046557 Ga0495622_0000002 Ga0495622_0000002_125650_126168 170
140 3300046558 Ga0495633_0000807 Ga0495633_0000807_11432_11950 170
141 3300046615 Ga0495656_0050034 Ga0495656_0050034_858_1376 170
142 3300046648 Ga0495611_0002070 Ga0495611_0002070_6539_7057 170
143 3300046660 Ga0495625_0057884 Ga0495625_0057884_646_1164 170
144 3300046665 Ga0495661_0029014 Ga0495661_0029014_888_1406 170
145 3300046665 Ga0495661_0096106 Ga0495661_0096106_410_928 170
146 3300046679 Ga0495623_0390791 Ga0495623_0390791_49_567 170
147 3300046692 Ga0495671_0031198 Ga0495671_0031198_494_1012 170
148 3300046810 Ga0495660_0000118 Ga0495660_0000118_12433_12948 170
149 3300047318 Ga0495636_0421517 Ga0495636_0421517_103_621 170
150 3300047320 Ga0495672_0000116 Ga0495672_0000116_56238_56756 170
151 3300047320 Ga0495672_0002289 Ga0495672_0002289_14031_14549 170
152 3300047443 Ga0495687_000012 Ga0495687_000012_179873_180391 170
153 3300047445 Ga0495677_0000762 Ga0495677_0000762_2383_2901 170
154 3300047446 Ga0495679_085813 Ga0495679_085813_160_675 170
155 3300047469 Ga0495673_0000113 Ga0495673_0000113_3119_3637 170
156 3300047470 Ga0495681_0000016 Ga0495681_0000016_76268_76786 170
157 3300047470 Ga0495681_0005074 Ga0495681_0005074_3099_3614 170
158 3300048905 Ga0496102_0155262 Ga0496102_0155262_25_543 170
159 3300048918 Ga0496115_0126330 Ga0496115_0126330_1555_2073 170
160 3300048927 Ga0496124_0500075 Ga0496124_0500075_169_687 170
161 3300049459 Ga0495678_000032 Ga0495678_000032_147482_147997 170
162 3300049460 Ga0495682_0000094 Ga0495682_0000094_45788_46306 170
163 3300053077 Ga0495601_0116525 Ga0495601_0116525_678_1196 170
164 3300002738 JGI25154J39366_1001376 JGI25154J39366_100137610 171
165 3300005262 Ga0065165_1001702 Ga0065165_100170211 171
166 3300006353 Ga0075370_10583309 Ga0075370_105833092 171
167 3300006946 Ga0079104_1006317 Ga0079104_10063174 171
168 3300015261 Ga0182006_1000017 Ga0182006_100001756 171
169 3300015262 Ga0182007_10222318 Ga0182007_102223181 171
170 3300015265 Ga0182005_1000051 Ga0182005_100005190 171
171 3300025246 Ga0209646_1000023 Ga0209646_100002394 171
172 3300042139 Ga0450904_000380 Ga0450904_000380_5749_6270 171
173 3300046457 Ga0495590_0000005 Ga0495590_0000005_215703_216224 171
174 3300046460 Ga0495638_0000027 Ga0495638_0000027_88225_88746 171
175 3300046471 Ga0495650_0006100 Ga0495650_0006100_1850_2371 171
176 3300046471 Ga0495650_0055310 Ga0495650_0055310_802_1323 171
177 3300046474 Ga0495605_0001269 Ga0495605_0001269_16183_16704 171
178 3300046474 Ga0495605_0002220 Ga0495605_0002220_150_671 171
179 3300046475 Ga0495639_0003323 Ga0495639_0003323_4832_5353 171
180 3300046491 Ga0495584_0007007 Ga0495584_0007007_4242_4763 171
181 3300046491 Ga0495584_0192524 Ga0495584_0192524_483_1004 171
182 3300046492 Ga0495585_0004702 Ga0495585_0004702_6804_7325 171
183 3300046492 Ga0495585_0010232 Ga0495585_0010232_3025_3546 171
184 3300046500 Ga0495596_0026391 Ga0495596_0026391_1061_1582 171
185 3300046500 Ga0495596_0049094 Ga0495596_0049094_1083_1604 171
186 3300046500 Ga0495596_0078862 Ga0495596_0078862_685_1206 171
187 3300046501 Ga0495607_0000656 Ga0495607_0000656_10384_10905 171
188 3300046501 Ga0495607_0008026 Ga0495607_0008026_4010_4531 171
189 3300046506 Ga0495583_0000378 Ga0495583_0000378_4495_5016 171
190 3300046506 Ga0495583_0001070 Ga0495583_0001070_11977_12498 171
191 3300046506 Ga0495583_0001391 Ga0495583_0001391_18996_19517 171
192 3300046506 Ga0495583_0006930 Ga0495583_0006930_2211_2732 171
193 3300046506 Ga0495583_0007961 Ga0495583_0007961_4591_5112 171
194 3300046507 Ga0495606_0000509 Ga0495606_0000509_5310_5831 171
195 3300046507 Ga0495606_0168017 Ga0495606_0168017_180_701 171
196 3300046507 Ga0495606_0224793 Ga0495606_0224793_344_865 171
197 3300046513 Ga0495616_0000282 Ga0495616_0000282_36748_37269 171
198 3300046513 Ga0495616_0000974 Ga0495616_0000974_4287_4808 171
199 3300046513 Ga0495616_0015131 Ga0495616_0015131_2705_3226 171
200 3300046518 Ga0495631_0007422 Ga0495631_0007422_2915_3436 171
201 3300046518 Ga0495631_0017581 Ga0495631_0017581_2244_2765 171
202 3300046518 Ga0495631_0150363 Ga0495631_0150363_409_930 171
203 3300046518 Ga0495631_0182218 Ga0495631_0182218_275_796 171
204 3300046519 Ga0495632_0000530 Ga0495632_0000530_25993_26514 171
205 3300046519 Ga0495632_0000909 Ga0495632_0000909_4106_4627 171
206 3300046522 Ga0495643_0000141 Ga0495643_0000141_5291_5812 171
207 3300046522 Ga0495643_0000167 Ga0495643_0000167_43512_44033 171
208 3300046522 Ga0495643_0000172 Ga0495643_0000172_97560_98081 171
209 3300046523 Ga0495644_0009787 Ga0495644_0009787_663_1184 171
210 3300046523 Ga0495644_0013218 Ga0495644_0013218_265_786 171
211 3300046523 Ga0495644_0156438 Ga0495644_0156438_342_863 171
212 3300046524 Ga0495648_0000002 Ga0495648_0000002_196569_197090 171
213 3300046524 Ga0495648_0177387 Ga0495648_0177387_53_574 171
214 3300046528 Ga0495642_0000938 Ga0495642_0000938_5257_5778 171
215 3300046528 Ga0495642_0022137 Ga0495642_0022137_1772_2293 171
216 3300046538 Ga0495609_0106450 Ga0495609_0106450_191_712 171
217 3300046538 Ga0495609_0115375 Ga0495609_0115375_158_679 171
218 3300046542 Ga0495597_0000074 Ga0495597_0000074_5258_5779 171
219 3300046542 Ga0495597_0177850 Ga0495597_0177850_188_709 171
220 3300046557 Ga0495622_0000200 Ga0495622_0000200_25215_25736 171
221 3300046558 Ga0495633_0000033 Ga0495633_0000033_23546_24067 171
222 3300046615 Ga0495656_0024198 Ga0495656_0024198_1086_1607 171
223 3300046615 Ga0495656_0064373 Ga0495656_0064373_989_1510 171
224 3300046616 Ga0495668_0000065 Ga0495668_0000065_120618_121139 171
225 3300046616 Ga0495668_0054601 Ga0495668_0054601_1230_1751 171
226 3300046648 Ga0495611_0037708 Ga0495611_0037708_1147_1668 171
227 3300046648 Ga0495611_0231285 Ga0495611_0231285_156_677 171
228 3300046648 Ga0495611_0251448 Ga0495611_0251448_71_592 171
229 3300046660 Ga0495625_0000121 Ga0495625_0000121_104640_105161 171
230 3300046660 Ga0495625_0022491 Ga0495625_0022491_3330_3851 171
231 3300046660 Ga0495625_0318012 Ga0495625_0318012_301_822 171
232 3300046665 Ga0495661_0000049 Ga0495661_0000049_37992_38513 171
233 3300046665 Ga0495661_0002043 Ga0495661_0002043_12528_13049 171
234 3300046665 Ga0495661_0015069 Ga0495661_0015069_1103_1624 171
235 3300046665 Ga0495661_0036641 Ga0495661_0036641_2056_2577 171
236 3300046665 Ga0495661_0377022 Ga0495661_0377022_64_585 171
237 3300046674 Ga0495588_0124313 Ga0495588_0124313_306_827 171
238 3300046684 Ga0495669_0113793 Ga0495669_0113793_498_1019 171
239 3300046691 Ga0495670_0021829 Ga0495670_0021829_2628_3149 171
240 3300046691 Ga0495670_0028126 Ga0495670_0028126_2202_2723 171
241 3300046691 Ga0495670_0144329 Ga0495670_0144329_492_1013 171
242 3300046692 Ga0495671_0038901 Ga0495671_0038901_1697_2218 171
243 3300046692 Ga0495671_0229023 Ga0495671_0229023_146_667 171
244 3300046694 Ga0495649_0008728 Ga0495649_0008728_2070_2591 171
245 3300046694 Ga0495649_0355231 Ga0495649_0355231_33_554 171
246 3300046794 Ga0495589_0046276 Ga0495589_0046276_224_745 171
247 3300046794 Ga0495589_0060610 Ga0495589_0060610_1146_1667 171
248 3300046810 Ga0495660_0005787 Ga0495660_0005787_4253_4774 171
249 3300046810 Ga0495660_0014199 Ga0495660_0014199_3279_3800 171
250 3300046810 Ga0495660_0047170 Ga0495660_0047170_1082_1603 171
251 3300047320 Ga0495672_0000165 Ga0495672_0000165_33261_33782 171
252 3300047323 Ga0495683_0021358 Ga0495683_0021358_1511_2032 171
253 3300047443 Ga0495687_000369 Ga0495687_000369_18867_19388 171
254 3300047443 Ga0495687_000924 Ga0495687_000924_10317_10838 171
255 3300047443 Ga0495687_001452 Ga0495687_001452_3747_4268 171
256 3300047445 Ga0495677_0002206 Ga0495677_0002206_4380_4901 171
257 3300047445 Ga0495677_0004095 Ga0495677_0004095_2447_2968 171
258 3300047470 Ga0495681_0015280 Ga0495681_0015280_2623_3144 171
259 3300047472 Ga0495686_0009427 Ga0495686_0009427_5117_5638 171
260 3300048091 Ga0495626_0001196 Ga0495626_0001196_6251_6772 171
261 3300048091 Ga0495626_0001564 Ga0495626_0001564_1732_2253 171
262 3300048091 Ga0495626_0018495 Ga0495626_0018495_2139_2660 171
263 3300048091 Ga0495626_0032358 Ga0495626_0032358_1696_2217 171
264 3300048091 Ga0495626_0039790 Ga0495626_0039790_268_789 171
265 3300048091 Ga0495626_0042092 Ga0495626_0042092_720_1241 171
266 3300048091 Ga0495626_0043099 Ga0495626_0043099_45_566 171
267 3300048091 Ga0495626_0136015 Ga0495626_0136015_234_755 171
268 3300048903 Ga0496100_0056032 Ga0496100_0056032_564_1085 171
269 3300048904 Ga0496101_0311275 Ga0496101_0311275_290_811 171
270 3300048912 Ga0496109_0025727 Ga0496109_0025727_4577_5098 171
271 3300048915 Ga0496112_0241392 Ga0496112_0241392_781_1302 171
272 3300048925 Ga0496122_0001753 Ga0496122_0001753_17106_17627 171
273 3300048926 Ga0496123_0003705 Ga0496123_0003705_11807_12328 171
274 3300048926 Ga0496123_0242576 Ga0496123_0242576_197_724 171
275 3300048927 Ga0496124_0033658 Ga0496124_0033658_3563_4090 171
276 3300048928 Ga0496125_0004347 Ga0496125_0004347_11613_12134 171
277 3300049162 Ga0501307_014910 Ga0501307_014910_47_568 171
278 3300049459 Ga0495678_000061 Ga0495678_000061_106059_106580 171
279 3300049459 Ga0495678_000193 Ga0495678_000193_66354_66875 171
280 3300049459 Ga0495678_054345 Ga0495678_054345_815_1336 171
281 3300049459 Ga0495678_066608 Ga0495678_066608_578_1099 171
282 3300049460 Ga0495682_0000130 Ga0495682_0000130_60980_61501 171
283 3300049529 Ga0501313_000280 Ga0501313_000280_1922_2443 171
284 3300049531 Ga0501315_020932 Ga0501315_020932_43_564 171
285 3300049532 Ga0501316_036992 Ga0501316_036992_108_629 171
286 3300049667 Ga0501230_016246 Ga0501230_016246_513_1034 171
287 3300050496 nmdc:mga07m45_536079_c1 nmdc:mga07m45_536079_c1_58_579 171
288 3300059505 Ga0587083_0017906 Ga0587083_0017906_556_1077 171
289 3300003322 rootL2_10038603 rootL2_100386033 172
290 3300025228 Ga0209672_112222 Ga0209672_1122222 172
291 3300037312 Ga0395899_0034898 Ga0395899_0034898_1935_2465 172
292 3300044656 Ga0466969_0148213 Ga0466969_0148213_103_633 172
293 3300046453 Ga0495627_000008 Ga0495627_000008_128796_129326 172
294 3300046522 Ga0495643_0000028 Ga0495643_0000028_215887_216411 172
295 3300046523 Ga0495644_0006849 Ga0495644_0006849_1161_1691 172
296 3300046524 Ga0495648_0409612 Ga0495648_0409612_20_544 172
297 3300046529 Ga0495652_0120178 Ga0495652_0120178_599_1117 172
298 3300046538 Ga0495609_0000340 Ga0495609_0000340_2783_3313 172
299 3300046543 Ga0495645_0017870 Ga0495645_0017870_826_1344 172
300 3300046558 Ga0495633_0111692 Ga0495633_0111692_106_639 172
301 3300046660 Ga0495625_0005529 Ga0495625_0005529_6665_7189 172
302 3300046660 Ga0495625_0099240 Ga0495625_0099240_1055_1579 172
303 3300046694 Ga0495649_0002621 Ga0495649_0002621_5207_5731 172
304 3300046810 Ga0495660_0001415 Ga0495660_0001415_590_1120 172
305 3300047320 Ga0495672_0000212 Ga0495672_0000212_67269_67793 172
306 3300048088 Ga0495602_0673608 Ga0495602_0673608_25_543 172
307 3300048919 Ga0496116_0031593 Ga0496116_0031593_737_1267 172
308 3300048927 Ga0496124_0004257 Ga0496124_0004257_1602_2138 172
309 3300049459 Ga0495678_000029 Ga0495678_000029_20558_21082 172
310 3300053108 Ga0500562_065692 Ga0500562_065692_368_892 172
311 3300031548 Ga0307408_100000546 Ga0307408_10000054615 173
312 3300044684 Ga0466966_0070719 Ga0466966_0070719_1143_1676 173
313 3300044693 Ga0466961_0439937 Ga0466961_0439937_44_577 173
314 3300044735 Ga0466968_0041049 Ga0466968_0041049_926_1456 173
315 3300044842 Ga0466957_0844764 Ga0466957_0844764_108_641 173
316 3300045049 Ga0466959_0046471 Ga0466959_0046471_2437_2970 173
317 3300046458 Ga0495591_005117 Ga0495591_005117_3495_4037 173
318 3300046460 Ga0495638_0012294 Ga0495638_0012294_1269_1796 173
319 3300046474 Ga0495605_0055249 Ga0495605_0055249_1243_1785 173
320 3300046491 Ga0495584_0013776 Ga0495584_0013776_2829_3371 173
321 3300046491 Ga0495584_0408471 Ga0495584_0408471_20_553 173
322 3300046492 Ga0495585_0120870 Ga0495585_0120870_222_764 173
323 3300046500 Ga0495596_0050518 Ga0495596_0050518_1003_1545 173
324 3300046501 Ga0495607_0063678 Ga0495607_0063678_349_891 173
325 3300046501 Ga0495607_0189553 Ga0495607_0189553_385_921 173
326 3300046506 Ga0495583_0001067 Ga0495583_0001067_12584_13117 173
327 3300046506 Ga0495583_0019947 Ga0495583_0019947_839_1381 173
328 3300046507 Ga0495606_0134856 Ga0495606_0134856_626_1168 173
329 3300046513 Ga0495616_0009502 Ga0495616_0009502_3566_4108 173
330 3300046520 Ga0495637_0056152 Ga0495637_0056152_738_1280 173
331 3300046520 Ga0495637_0063355 Ga0495637_0063355_763_1296 173
332 3300046522 Ga0495643_0070571 Ga0495643_0070571_724_1260 173
333 3300046523 Ga0495644_0019330 Ga0495644_0019330_102_644 173
334 3300046524 Ga0495648_0000648 Ga0495648_0000648_4296_4832 173
335 3300046524 Ga0495648_0135868 Ga0495648_0135868_514_1056 173
336 3300046528 Ga0495642_0036822 Ga0495642_0036822_147_689 173
337 3300046538 Ga0495609_0001492 Ga0495609_0001492_10611_11147 173
338 3300046538 Ga0495609_0028345 Ga0495609_0028345_1003_1545 173
339 3300046616 Ga0495668_0005360 Ga0495668_0005360_975_1517 173
340 3300046648 Ga0495611_0037055 Ga0495611_0037055_1571_2113 173
341 3300046665 Ga0495661_0034209 Ga0495661_0034209_42_584 173
342 3300046684 Ga0495669_0001448 Ga0495669_0001448_1731_2273 173
343 3300046691 Ga0495670_0055357 Ga0495670_0055357_1433_1975 173
344 3300046694 Ga0495649_0002364 Ga0495649_0002364_4407_4943 173
345 3300046810 Ga0495660_0024566 Ga0495660_0024566_2651_3193 173
346 3300047320 Ga0495672_0001165 Ga0495672_0001165_1067_1603 173
347 3300047323 Ga0495683_0219375 Ga0495683_0219375_85_627 173
348 3300047445 Ga0495677_0000242 Ga0495677_0000242_18413_18946 173
349 3300047446 Ga0495679_074004 Ga0495679_074004_310_852 173
350 3300047447 Ga0495685_000553 Ga0495685_000553_53_595 173
351 3300048091 Ga0495626_0009725 Ga0495626_0009725_4042_4575 173
352 3300048091 Ga0495626_0019945 Ga0495626_0019945_824_1360 173
353 3300048091 Ga0495626_0083174 Ga0495626_0083174_655_1197 173
354 3300048091 Ga0495626_0096802 Ga0495626_0096802_707_1240 173
355 3300061719 Ga0466962_0134762 Ga0466962_0134762_171_704 173
356 3300002737 JGI25162J39368_1000021 JGI25162J39368_100002162 174
357 3300003214 JGI25165J46597_1000049 JGI25165J46597_1000049161 174
358 3300003751 Ga0055538_1000023 Ga0055538_100002362 174
359 3300003752 Ga0055539_1000030 Ga0055539_100003062 174
360 3300003756 Ga0055533_1000039 Ga0055533_100003962 174
361 3300003759 Ga0055525_1000048 Ga0055525_1000048161 174
362 3300003841 Ga0055541_1000021 Ga0055541_1000021161 174
363 3300025207 Ga0209760_103094 Ga0209760_1030942 174
364 3300025224 Ga0209784_100004 Ga0209784_1000041104 174
365 3300025225 Ga0209566_100004 Ga0209566_1000041261 174
366 3300025226 Ga0209674_100006 Ga0209674_1000061261 174
367 3300025230 Ga0209563_100009 Ga0209563_1000091104 174
368 3300025231 Ga0207427_100821 Ga0207427_1008218 174
369 3300025233 Ga0209437_100004 Ga0209437_1000041104 174
370 3300025253 Ga0209677_100005 Ga0209677_1000051104 174
371 3300025261 Ga0209233_1000005 Ga0209233_10000051261 174
372 3300046462 Ga0495651_0001952 Ga0495651_0001952_3839_4363 174
373 3300046516 Ga0495628_0408250 Ga0495628_0408250_395_919 174
374 3300046529 Ga0495652_0046165 Ga0495652_0046165_648_1172 174
375 3300048088 Ga0495602_0012386 Ga0495602_0012386_5306_5830 174

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ykn-assembly1.cif.gz_F protocatechuate 3,4-dioxygenase y408e mutant bound to dhb 0.784 33 161
3mi1-assembly1.cif.gz_M axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase 0.7828 33 161
3pcd-assembly1.cif.gz_M protocatechuate 3,4-dioxygenase y447h mutant 0.7817 33 161
2pcd-assembly1.cif.gz_N-2 structure of protocatechuate 3,4-dioxygenase from pseudomonas aeruginosa at 2.15 angstroms resolution 0.7813 33 161
1ykk-assembly1.cif.gz_B protocatechuate 3,4-dioxygenase y408c mutant 0.7811 33 161
ID Description Score Start End Superfamily
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7576 5 173 2.60.130.10
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7337 37 126 2.60.40.10
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7337 5 173 2.60.130.10
af_F1Q5N7_256_358_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7287 38 161 2.60.40.1120
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7221 24 172 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A7X3FZJ0-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9167 6 174 GO:0005506
GO:0016702
AF-A0A2K4Y974-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha 0.9092 32 173 GO:0005506
GO:0016702
AF-A0A7X3FZJ0-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.8961 6 174 GO:0005506
GO:0016702
AF-A0A0Q4H2L1-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.8849 37 174 GO:0008199
GO:0009056
GO:0018578
AF-A0A4Q3K2H9-F1-model_v4 deleted 0.8606 6 144

Feature Viewer

pLDDT pTM Quality
88.2 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map