F427089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 375 | 173 | 375 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300032126|Ga0307415_100011268|Ga0307415_1000112683 |
| Length | 205 |
| Sequence | LRHPLEAARPGLYRRMMRFALVLAFLILAACSKPQSQQATNEAEPSAEAGPVKGVDRSHKGKPAPDAVFNDPDGGEISLGDFKGTPVLINLWATWCAPCVKELPTLDRLAASHRVDGQLGVVAISQDMGPQQSVEAFLGKLKIQDLGAFHDPKMGLSGALDAQVLPTSILFDADGREVWRYVGDLDWTGPEAAKLLAEGGVGRTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 146 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 147 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 169 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 170 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 171 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 172 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 173 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.33 |
| Rhizosphere | 94.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10025438 | 3300001991 | Bacteria | 1147 |
| 2 | Ga0065715_10559073 | 3300005293 | Bacteria | 735 |
| 3 | Ga0070658_10010002 | 3300005327 | Bacteria | 7618 |
| 4 | Ga0070658_10021514 | 3300005327 | Bacteria | 5170 |
| 5 | Ga0070658_10106976 | 3300005327 | Bacteria | 2314 |
| 6 | Ga0070658_10130821 | 3300005327 | Bacteria | 2092 |
| 7 | Ga0070658_10141660 | 3300005327 | Bacteria | 2009 |
| 8 | Ga0070658_10494654 | 3300005327 | Bacteria | 1056 |
| 9 | Ga0070658_10803999 | 3300005327 | Unclassified | 817 |
| 10 | Ga0070690_100085132 | 3300005330 | Bacteria | 2073 |
| 11 | Ga0070670_100166362 | 3300005331 | Bacteria | 1912 |
| 12 | Ga0070677_10112666 | 3300005333 | Bacteria | 1217 |
| 13 | Ga0070677_10345369 | 3300005333 | Bacteria | 769 |
| 14 | Ga0070666_10000753 | 3300005335 | Bacteria | 19635 |
| 15 | Ga0070680_100215099 | 3300005336 | Bacteria | 1622 |
| 16 | Ga0068868_100010090 | 3300005338 | Bacteria | 6823 |
| 17 | Ga0068868_100060483 | 3300005338 | Bacteria | 2999 |
| 18 | Ga0070660_100009960 | 3300005339 | Bacteria | 6703 |
| 19 | Ga0070660_100081437 | 3300005339 | Bacteria | 2541 |
| 20 | Ga0070660_100121794 | 3300005339 | Bacteria | 2082 |
| 21 | Ga0070660_100175983 | 3300005339 | Bacteria | 1730 |
| 22 | Ga0070660_100296020 | 3300005339 | Bacteria | 1326 |
| 23 | Ga0070689_100744087 | 3300005340 | Bacteria | 859 |
| 24 | Ga0070687_100395404 | 3300005343 | Bacteria | 905 |
| 25 | Ga0070661_100014342 | 3300005344 | Bacteria | 5583 |
| 26 | Ga0070661_100318157 | 3300005344 | Bacteria | 1215 |
| 27 | Ga0070661_100525597 | 3300005344 | Bacteria | 949 |
| 28 | Ga0070669_100192769 | 3300005353 | Bacteria | 1599 |
| 29 | Ga0070675_100133439 | 3300005354 | Bacteria | 2118 |
| 30 | Ga0070671_100000051 | 3300005355 | Bacteria | 79207 |
| 31 | Ga0070671_100005658 | 3300005355 | Bacteria | 9948 |
| 32 | Ga0070671_100008324 | 3300005355 | Bacteria | 8304 |
| 33 | Ga0070671_100194639 | 3300005355 | Bacteria | 1719 |
| 34 | Ga0070674_100024211 | 3300005356 | Bacteria | 3938 |
| 35 | Ga0070674_100069104 | 3300005356 | Bacteria | 2491 |
| 36 | Ga0070673_100014605 | 3300005364 | Bacteria | 5478 |
| 37 | Ga0070673_100015936 | 3300005364 | Bacteria | 5296 |
| 38 | Ga0070673_100151353 | 3300005364 | Bacteria | 1965 |
| 39 | Ga0070673_100331275 | 3300005364 | Bacteria | 1347 |
| 40 | Ga0070659_100002531 | 3300005366 | Bacteria | 12994 |
| 41 | Ga0070659_100022901 | 3300005366 | Bacteria | 4774 |
| 42 | Ga0070659_100038915 | 3300005366 | Bacteria | 3710 |
| 43 | Ga0070659_100074719 | 3300005366 | Bacteria | 2700 |
| 44 | Ga0070659_100212037 | 3300005366 | Bacteria | 1596 |
| 45 | Ga0070659_100284553 | 3300005366 | Bacteria | 1376 |
| 46 | Ga0070659_100434452 | 3300005366 | Bacteria | 1111 |
| 47 | Ga0070667_100051318 | 3300005367 | Bacteria | 3477 |
| 48 | Ga0070709_10112095 | 3300005434 | Bacteria | 1835 |
| 49 | Ga0070714_100144050 | 3300005435 | Bacteria | 2141 |
| 50 | Ga0070713_100019697 | 3300005436 | Bacteria | 5159 |
| 51 | Ga0070663_100044873 | 3300005455 | Bacteria | 3119 |
| 52 | Ga0070663_100137020 | 3300005455 | Bacteria | 1865 |
| 53 | Ga0070678_100010816 | 3300005456 | Bacteria | 5594 |
| 54 | Ga0070678_100024271 | 3300005456 | Bacteria | 4056 |
| 55 | Ga0070662_100098921 | 3300005457 | Bacteria | 2204 |
| 56 | Ga0070662_100135508 | 3300005457 | Bacteria | 1903 |
| 57 | Ga0070662_100218362 | 3300005457 | Bacteria | 1520 |
| 58 | Ga0068867_100014664 | 3300005459 | Bacteria | 5554 |
| 59 | Ga0070679_100365406 | 3300005530 | Bacteria | 1390 |
| 60 | Ga0070684_100443778 | 3300005535 | Bacteria | 1199 |
| 61 | Ga0068853_100014309 | 3300005539 | Bacteria | 6493 |
| 62 | Ga0068853_100027860 | 3300005539 | Bacteria | 4750 |
| 63 | Ga0068853_100090936 | 3300005539 | Bacteria | 2683 |
| 64 | Ga0070672_100003732 | 3300005543 | Bacteria | 9912 |
| 65 | Ga0070672_100028979 | 3300005543 | Bacteria | 4146 |
| 66 | Ga0070672_100298997 | 3300005543 | Bacteria | 1364 |
| 67 | Ga0070672_100353163 | 3300005543 | Bacteria | 1254 |
| 68 | Ga0070686_100172835 | 3300005544 | Bacteria | 1529 |
| 69 | Ga0070693_100096197 | 3300005547 | Bacteria | 1795 |
| 70 | Ga0070665_100003344 | 3300005548 | Bacteria | 17169 |
| 71 | Ga0070665_100003837 | 3300005548 | Bacteria | 15903 |
| 72 | Ga0070665_100023061 | 3300005548 | Bacteria | 6269 |
| 73 | Ga0068855_100312957 | 3300005563 | Bacteria | 1737 |
| 74 | Ga0070664_100006520 | 3300005564 | Bacteria | 9411 |
| 75 | Ga0070664_100049385 | 3300005564 | Bacteria | 3558 |
| 76 | Ga0070664_100049398 | 3300005564 | Bacteria | 3558 |
| 77 | Ga0070664_100057237 | 3300005564 | Bacteria | 3313 |
| 78 | Ga0070664_101022493 | 3300005564 | Bacteria | 777 |
| 79 | Ga0068857_100034776 | 3300005577 | Bacteria | 4457 |
| 80 | Ga0068857_100531470 | 3300005577 | Bacteria | 1106 |
| 81 | Ga0068854_100060782 | 3300005578 | Bacteria | 2734 |
| 82 | Ga0068854_100096755 | 3300005578 | Bacteria | 2206 |
| 83 | Ga0068856_100054512 | 3300005614 | Bacteria | 3944 |
| 84 | Ga0068856_100099312 | 3300005614 | Bacteria | 2902 |
| 85 | Ga0068852_100002345 | 3300005616 | Bacteria | 13033 |
| 86 | Ga0068852_100025103 | 3300005616 | Bacteria | 4824 |
| 87 | Ga0068852_100036780 | 3300005616 | Bacteria | 4100 |
| 88 | Ga0068852_100226919 | 3300005616 | Bacteria | 1779 |
| 89 | Ga0068852_100843379 | 3300005616 | Bacteria | 932 |
| 90 | Ga0068859_100126409 | 3300005617 | Bacteria | 2626 |
| 91 | Ga0068864_100016194 | 3300005618 | Bacteria | 6206 |
| 92 | Ga0068866_10124162 | 3300005718 | Bacteria | 1459 |
| 93 | Ga0068851_10061352 | 3300005834 | Bacteria | 1927 |
| 94 | Ga0068863_100122043 | 3300005841 | Bacteria | 2485 |
| 95 | Ga0068858_100184526 | 3300005842 | Bacteria | 1970 |
| 96 | Ga0081539_10035648 | 3300005985 | Bacteria | 2986 |
| 97 | Ga0070717_10006369 | 3300006028 | Bacteria | 8676 |
| 98 | Ga0097621_100001388 | 3300006237 | Bacteria | 16665 |
| 99 | Ga0068871_100006176 | 3300006358 | Bacteria | 8442 |
| 100 | Ga0097620_100126415 | 3300006931 | Bacteria | 2626 |
| 101 | Ga0105240_10072909 | 3300009093 | Bacteria | 4242 |
| 102 | Ga0105240_10725969 | 3300009093 | Bacteria | 1082 |
| 103 | Ga0105245_10205399 | 3300009098 | Bacteria | 1894 |
| 104 | Ga0105243_10089749 | 3300009148 | Bacteria | 2528 |
| 105 | Ga0105241_10639529 | 3300009174 | Bacteria | 965 |
| 106 | Ga0105248_10330631 | 3300009177 | Bacteria | 1716 |
| 107 | Ga0105248_10427085 | 3300009177 | Bacteria | 1492 |
| 108 | Ga0105237_10023331 | 3300009545 | Bacteria | 6341 |
| 109 | Ga0105238_10026958 | 3300009551 | Bacteria | 5857 |
| 110 | Ga0105238_10181080 | 3300009551 | Bacteria | 2084 |
| 111 | Ga0105238_11175378 | 3300009551 | Bacteria | 791 |
| 112 | Ga0105239_11079000 | 3300010375 | Bacteria | 924 |
| 113 | Ga0105246_10441043 | 3300011119 | Bacteria | 1092 |
| 114 | Ga0157373_10120835 | 3300013100 | Bacteria | 1841 |
| 115 | Ga0157373_10300426 | 3300013100 | Bacteria | 1139 |
| 116 | Ga0157373_10333071 | 3300013100 | Bacteria | 1081 |
| 117 | Ga0157373_10459211 | 3300013100 | Bacteria | 917 |
| 118 | Ga0157371_10065258 | 3300013102 | Bacteria | 2578 |
| 119 | Ga0157371_10420254 | 3300013102 | Bacteria | 980 |
| 120 | Ga0157370_10040212 | 3300013104 | Bacteria | 4515 |
| 121 | Ga0157370_10387378 | 3300013104 | Bacteria | 1287 |
| 122 | Ga0157369_10013440 | 3300013105 | Bacteria | 9253 |
| 123 | Ga0157369_10046538 | 3300013105 | Bacteria | 4714 |
| 124 | Ga0157369_10652146 | 3300013105 | Bacteria | 1085 |
| 125 | Ga0157378_10068744 | 3300013297 | Bacteria | 3176 |
| 126 | Ga0157378_10419039 | 3300013297 | Bacteria | 1323 |
| 127 | Ga0157378_11079704 | 3300013297 | Bacteria | 839 |
| 128 | Ga0163162_10105699 | 3300013306 | Bacteria | 2909 |
| 129 | Ga0157372_10007664 | 3300013307 | Bacteria | 11481 |
| 130 | Ga0157375_10023990 | 3300013308 | Bacteria | 5638 |
| 131 | Ga0157375_10262656 | 3300013308 | Bacteria | 1888 |
| 132 | Ga0157375_10947333 | 3300013308 | Bacteria | 1003 |
| 133 | Ga0157377_10293229 | 3300014745 | Bacteria | 1071 |
| 134 | Ga0157379_10033652 | 3300014968 | Bacteria | 4570 |
| 135 | Ga0157379_10123623 | 3300014968 | Bacteria | 2328 |
| 136 | Ga0157376_10023468 | 3300014969 | Bacteria | 4827 |
| 137 | Ga0163161_10524372 | 3300017792 | Bacteria | 968 |
| 138 | Ga0207697_10033132 | 3300025315 | Bacteria | 2114 |
| 139 | Ga0207656_10145560 | 3300025321 | Bacteria | 1119 |
| 140 | Ga0207682_10004033 | 3300025893 | Bacteria | 6244 |
| 141 | Ga0207688_10007755 | 3300025901 | Bacteria | 5846 |
| 142 | Ga0207688_10014012 | 3300025901 | Bacteria | 4360 |
| 143 | Ga0207680_10002819 | 3300025903 | Bacteria | 8141 |
| 144 | Ga0207647_10019184 | 3300025904 | Bacteria | 4603 |
| 145 | Ga0207647_10038029 | 3300025904 | Bacteria | 3046 |
| 146 | Ga0207647_10065750 | 3300025904 | Bacteria | 2200 |
| 147 | Ga0207645_10044456 | 3300025907 | Bacteria | 2842 |
| 148 | Ga0207705_10020917 | 3300025909 | Bacteria | 4668 |
| 149 | Ga0207705_10068893 | 3300025909 | Bacteria | 2562 |
| 150 | Ga0207705_10073787 | 3300025909 | Bacteria | 2476 |
| 151 | Ga0207705_10147354 | 3300025909 | Bacteria | 1762 |
| 152 | Ga0207705_10311131 | 3300025909 | Bacteria | 1209 |
| 153 | Ga0207654_10422574 | 3300025911 | Bacteria | 930 |
| 154 | Ga0207707_10152873 | 3300025912 | Bacteria | 2018 |
| 155 | Ga0207695_10022931 | 3300025913 | Bacteria | 7070 |
| 156 | Ga0207660_10473192 | 3300025917 | Bacteria | 1015 |
| 157 | Ga0207662_10060514 | 3300025918 | Bacteria | 2272 |
| 158 | Ga0207662_10390762 | 3300025918 | Bacteria | 941 |
| 159 | Ga0207657_10005081 | 3300025919 | Bacteria | 13794 |
| 160 | Ga0207657_10008822 | 3300025919 | Bacteria | 10198 |
| 161 | Ga0207657_10011457 | 3300025919 | Bacteria | 8804 |
| 162 | Ga0207657_10073160 | 3300025919 | Bacteria | 2897 |
| 163 | Ga0207657_10087941 | 3300025919 | Bacteria | 2598 |
| 164 | Ga0207649_10008810 | 3300025920 | Bacteria | 5507 |
| 165 | Ga0207649_10042998 | 3300025920 | Bacteria | 2759 |
| 166 | Ga0207649_10060762 | 3300025920 | Bacteria | 2376 |
| 167 | Ga0207649_10354793 | 3300025920 | Bacteria | 1086 |
| 168 | Ga0207652_10571678 | 3300025921 | Bacteria | 1015 |
| 169 | Ga0207681_10089064 | 3300025923 | Bacteria | 2199 |
| 170 | Ga0207681_10228449 | 3300025923 | Bacteria | 1443 |
| 171 | Ga0207694_10012746 | 3300025924 | Bacteria | 6334 |
| 172 | Ga0207694_10653205 | 3300025924 | Bacteria | 886 |
| 173 | Ga0207650_10020862 | 3300025925 | Bacteria | 4627 |
| 174 | Ga0207650_10080546 | 3300025925 | Bacteria | 2469 |
| 175 | Ga0207650_10103580 | 3300025925 | Bacteria | 2194 |
| 176 | Ga0207650_10392805 | 3300025925 | Bacteria | 1147 |
| 177 | Ga0207659_10043018 | 3300025926 | Bacteria | 3170 |
| 178 | Ga0207659_10371682 | 3300025926 | Bacteria | 1190 |
| 179 | Ga0207659_10680307 | 3300025926 | Bacteria | 880 |
| 180 | Ga0207687_10066385 | 3300025927 | Bacteria | 2564 |
| 181 | Ga0207700_10006481 | 3300025928 | Bacteria | 7070 |
| 182 | Ga0207664_10235307 | 3300025929 | Bacteria | 1593 |
| 183 | Ga0207644_10000243 | 3300025931 | Bacteria | 37412 |
| 184 | Ga0207644_10000996 | 3300025931 | Bacteria | 18076 |
| 185 | Ga0207644_10003062 | 3300025931 | Bacteria | 10764 |
| 186 | Ga0207644_10098773 | 3300025931 | Bacteria | 2189 |
| 187 | Ga0207644_10464849 | 3300025931 | Bacteria | 1040 |
| 188 | Ga0207690_10014114 | 3300025932 | Bacteria | 4817 |
| 189 | Ga0207690_10027770 | 3300025932 | Bacteria | 3579 |
| 190 | Ga0207690_10133858 | 3300025932 | Bacteria | 1818 |
| 191 | Ga0207690_10202027 | 3300025932 | Bacteria | 1510 |
| 192 | Ga0207690_10339469 | 3300025932 | Bacteria | 1185 |
| 193 | Ga0207690_10734429 | 3300025932 | Bacteria | 813 |
| 194 | Ga0207706_10055135 | 3300025933 | Bacteria | 3506 |
| 195 | Ga0207706_10281392 | 3300025933 | Bacteria | 1451 |
| 196 | Ga0207706_10291901 | 3300025933 | Bacteria | 1422 |
| 197 | Ga0207706_10565469 | 3300025933 | Bacteria | 978 |
| 198 | Ga0207686_10056521 | 3300025934 | Bacteria | 2467 |
| 199 | Ga0207709_10033135 | 3300025935 | Bacteria | 3031 |
| 200 | Ga0207670_10656854 | 3300025936 | Bacteria | 865 |
| 201 | Ga0207669_10035143 | 3300025937 | Bacteria | 2848 |
| 202 | Ga0207669_10037728 | 3300025937 | Bacteria | 2775 |
| 203 | Ga0207691_10034954 | 3300025940 | Bacteria | 4670 |
| 204 | Ga0207691_10049560 | 3300025940 | Bacteria | 3848 |
| 205 | Ga0207691_10299439 | 3300025940 | Bacteria | 1382 |
| 206 | Ga0207691_10348806 | 3300025940 | Bacteria | 1266 |
| 207 | Ga0207711_10001208 | 3300025941 | Bacteria | 24465 |
| 208 | Ga0207711_10134922 | 3300025941 | Bacteria | 2216 |
| 209 | Ga0207689_10092544 | 3300025942 | Bacteria | 2484 |
| 210 | Ga0207689_11164037 | 3300025942 | Bacteria | 649 |
| 211 | Ga0207679_10226000 | 3300025945 | Bacteria | 1577 |
| 212 | Ga0207679_10589697 | 3300025945 | Bacteria | 1000 |
| 213 | Ga0207679_11066134 | 3300025945 | Bacteria | 741 |
| 214 | Ga0207667_10147775 | 3300025949 | Bacteria | 2419 |
| 215 | Ga0207667_10363645 | 3300025949 | Bacteria | 1475 |
| 216 | Ga0207667_10737664 | 3300025949 | Bacteria | 985 |
| 217 | Ga0207651_10033435 | 3300025960 | Bacteria | 3317 |
| 218 | Ga0207651_10354301 | 3300025960 | Bacteria | 1237 |
| 219 | Ga0207668_10324481 | 3300025972 | Bacteria | 1279 |
| 220 | Ga0207640_10066425 | 3300025981 | Bacteria | 2410 |
| 221 | Ga0207640_10073299 | 3300025981 | Bacteria | 2313 |
| 222 | Ga0207640_10075975 | 3300025981 | Bacteria | 2278 |
| 223 | Ga0207640_10112280 | 3300025981 | Bacteria | 1935 |
| 224 | Ga0207658_10002850 | 3300025986 | Bacteria | 12385 |
| 225 | Ga0207677_10000529 | 3300026023 | Bacteria | 24143 |
| 226 | Ga0207677_10253278 | 3300026023 | Bacteria | 1431 |
| 227 | Ga0207703_10054235 | 3300026035 | Bacteria | 3259 |
| 228 | Ga0207703_10074669 | 3300026035 | Bacteria | 2808 |
| 229 | Ga0207639_10000074 | 3300026041 | Bacteria | 91671 |
| 230 | Ga0207639_10068989 | 3300026041 | Bacteria | 2757 |
| 231 | Ga0207639_10095153 | 3300026041 | Bacteria | 2393 |
| 232 | Ga0207678_10004584 | 3300026067 | Bacteria | 12425 |
| 233 | Ga0207678_10115764 | 3300026067 | Bacteria | 2287 |
| 234 | Ga0207702_10029535 | 3300026078 | Bacteria | 4563 |
| 235 | Ga0207702_10048049 | 3300026078 | Bacteria | 3598 |
| 236 | Ga0207641_10015898 | 3300026088 | Bacteria | 6162 |
| 237 | Ga0207648_10018832 | 3300026089 | Bacteria | 6240 |
| 238 | Ga0207648_10028153 | 3300026089 | Bacteria | 4984 |
| 239 | Ga0207676_10125781 | 3300026095 | Bacteria | 2171 |
| 240 | Ga0207674_10046288 | 3300026116 | Bacteria | 4467 |
| 241 | Ga0207674_10350833 | 3300026116 | Bacteria | 1426 |
| 242 | Ga0207683_10004238 | 3300026121 | Bacteria | 12379 |
| 243 | Ga0207683_10005095 | 3300026121 | Bacteria | 11274 |
| 244 | Ga0207698_10005850 | 3300026142 | Bacteria | 7640 |
| 245 | Ga0207698_10031093 | 3300026142 | Bacteria | 3849 |
| 246 | Ga0207698_10076542 | 3300026142 | Bacteria | 2678 |
| 247 | Ga0207698_10174569 | 3300026142 | Bacteria | 1896 |
| 248 | Ga0207698_10297321 | 3300026142 | Bacteria | 1501 |
| 249 | Ga0207698_10378912 | 3300026142 | Bacteria | 1345 |
| 250 | Ga0207698_10417201 | 3300026142 | Bacteria | 1287 |
| 251 | Ga0207698_10519556 | 3300026142 | Bacteria | 1162 |
| 252 | Ga0207698_10716424 | 3300026142 | Bacteria | 997 |
| 253 | Ga0268266_10004494 | 3300028379 | Bacteria | 13330 |
| 254 | Ga0268266_10005157 | 3300028379 | Bacteria | 12305 |
| 255 | Ga0307408_100001159 | 3300031548 | Bacteria | 20050 |
| 256 | Ga0307408_100034475 | 3300031548 | Bacteria | 3546 |
| 257 | Ga0307408_100474195 | 3300031548 | Bacteria | 1090 |
| 258 | Ga0307405_10000240 | 3300031731 | Bacteria | 19933 |
| 259 | Ga0307405_10130732 | 3300031731 | Bacteria | 1734 |
| 260 | Ga0307413_10000616 | 3300031824 | Bacteria | 11983 |
| 261 | Ga0307413_10006414 | 3300031824 | Bacteria | 5367 |
| 262 | Ga0307413_10031914 | 3300031824 | Bacteria | 2978 |
| 263 | Ga0307413_10039467 | 3300031824 | Bacteria | 2746 |
| 264 | Ga0307413_10055708 | 3300031824 | Bacteria | 2407 |
| 265 | Ga0307413_10729443 | 3300031824 | Bacteria | 826 |
| 266 | Ga0307410_10011784 | 3300031852 | Bacteria | 5019 |
| 267 | Ga0307410_10050359 | 3300031852 | Bacteria | 2800 |
| 268 | Ga0307410_10051076 | 3300031852 | Bacteria | 2784 |
| 269 | Ga0307410_10152802 | 3300031852 | Bacteria | 1720 |
| 270 | Ga0307406_10011286 | 3300031901 | Bacteria | 5066 |
| 271 | Ga0307406_10026141 | 3300031901 | Bacteria | 3502 |
| 272 | Ga0307406_10490993 | 3300031901 | Bacteria | 994 |
| 273 | Ga0307407_10000541 | 3300031903 | Bacteria | 11794 |
| 274 | Ga0307407_10067466 | 3300031903 | Bacteria | 2114 |
| 275 | Ga0307407_10317245 | 3300031903 | Bacteria | 1092 |
| 276 | Ga0307407_10583080 | 3300031903 | Bacteria | 830 |
| 277 | Ga0307412_10000248 | 3300031911 | Bacteria | 35008 |
| 278 | Ga0307412_10172295 | 3300031911 | Bacteria | 1619 |
| 279 | Ga0307409_100006369 | 3300031995 | Bacteria | 6927 |
| 280 | Ga0307409_100022018 | 3300031995 | Bacteria | 4384 |
| 281 | Ga0307409_100026614 | 3300031995 | Bacteria | 4082 |
| 282 | Ga0307409_100248551 | 3300031995 | Bacteria | 1624 |
| 283 | Ga0307416_100001974 | 3300032002 | Bacteria | 11501 |
| 284 | Ga0307416_100030884 | 3300032002 | Bacteria | 4026 |
| 285 | Ga0307416_100068524 | 3300032002 | Bacteria | 2932 |
| 286 | Ga0307416_100350076 | 3300032002 | Bacteria | 1494 |
| 287 | Ga0307414_10002750 | 3300032004 | Bacteria | 9260 |
| 288 | Ga0307414_10007680 | 3300032004 | Bacteria | 6073 |
| 289 | Ga0307414_10008907 | 3300032004 | Bacteria | 5731 |
| 290 | Ga0307414_10029867 | 3300032004 | Bacteria | 3553 |
| 291 | Ga0307414_10072633 | 3300032004 | Bacteria | 2486 |
| 292 | Ga0307414_10100532 | 3300032004 | Bacteria | 2175 |
| 293 | Ga0307411_10001520 | 3300032005 | Bacteria | 9552 |
| 294 | Ga0307411_10003799 | 3300032005 | Bacteria | 7101 |
| 295 | Ga0307411_10006791 | 3300032005 | Bacteria | 5761 |
| 296 | Ga0307411_10053185 | 3300032005 | Bacteria | 2651 |
| 297 | Ga0307411_10078645 | 3300032005 | Bacteria | 2261 |
| 298 | Ga0307411_10147716 | 3300032005 | Bacteria | 1742 |
| 299 | Ga0307411_10170135 | 3300032005 | Bacteria | 1642 |
| 300 | Ga0307411_10369880 | 3300032005 | Bacteria | 1175 |
| 301 | Ga0307415_100000898 | 3300032126 | Bacteria | 13619 |
| 302 | Ga0307415_100003980 | 3300032126 | Bacteria | 7604 |
| 303 | Ga0307415_100011268 | 3300032126 | Bacteria | 5109 |
| 304 | Ga0307415_100059214 | 3300032126 | Bacteria | 2640 |
| 305 | Ga0307415_100429770 | 3300032126 | Bacteria | 1136 |
| 306 | Ga0307415_100779972 | 3300032126 | Bacteria | 870 |
| 307 | Ga0373942_0022501 | 3300035207 | Bacteria | 1600 |
| 308 | Ga0373931_0020928 | 3300035691 | Bacteria | 3277 |
| 309 | Ga0373947_0139504 | 3300035725 | Bacteria | 1554 |
| 310 | Ga0395899_0121342 | 3300037312 | Bacteria | 1872 |
| 311 | Ga0395899_0385760 | 3300037312 | Bacteria | 930 |
| 312 | Ga0395900_0005624 | 3300037418 | Bacteria | 13109 |
| 313 | Ga0395900_0032789 | 3300037418 | Bacteria | 5343 |
| 314 | Ga0395900_0088673 | 3300037418 | Bacteria | 3180 |
| 315 | Ga0395900_0127237 | 3300037418 | Bacteria | 2612 |
| 316 | Ga0395898_0005758 | 3300037466 | Bacteria | 13337 |
| 317 | Ga0395898_0091759 | 3300037466 | Bacteria | 2922 |
| 318 | Ga0395898_0114178 | 3300037466 | Bacteria | 2588 |
| 319 | Ga0395898_0519923 | 3300037466 | Bacteria | 1131 |
| 320 | Ga0395905_0000886 | 3300037471 | Bacteria | 39025 |
| 321 | Ga0395905_0006839 | 3300037471 | Bacteria | 11406 |
| 322 | Ga0395905_0012343 | 3300037471 | Bacteria | 8224 |
| 323 | Ga0395905_0034826 | 3300037471 | Bacteria | 4728 |
| 324 | Ga0395905_0173752 | 3300037471 | Bacteria | 2023 |
| 325 | Ga0395905_0181349 | 3300037471 | Bacteria | 1977 |
| 326 | Ga0395905_0625627 | 3300037471 | Bacteria | 978 |
| 327 | Ga0395905_0925039 | 3300037471 | Bacteria | 775 |
| 328 | Ga0436364_1116664 | 3300037853 | Bacteria | 977 |
| 329 | Ga0395901_0019321 | 3300038443 | Bacteria | 6965 |
| 330 | Ga0395901_0039825 | 3300038443 | Bacteria | 4864 |
| 331 | Ga0395901_0056208 | 3300038443 | Bacteria | 4094 |
| 332 | Ga0395901_0213394 | 3300038443 | Bacteria | 2019 |
| 333 | Ga0395901_0304822 | 3300038443 | Bacteria | 1651 |
| 334 | Ga0395901_0340516 | 3300038443 | Bacteria | 1549 |
| 335 | Ga0395901_0875365 | 3300038443 | Bacteria | 882 |
| 336 | Ga0451841_1126972 | 3300041498 | Bacteria | 956 |
| 337 | Ga0439432_024219 | 3300042006 | Bacteria | 1996 |
| 338 | Ga0439449_0023001 | 3300042007 | Bacteria | 2333 |
| 339 | Ga0466972_0137500 | 3300044658 | Bacteria | 1150 |
| 340 | Ga0466960_0000555 | 3300044901 | Bacteria | 12872 |
| 341 | Ga0466967_0003377 | 3300045976 | Bacteria | 10396 |
| 342 | Ga0466967_0210586 | 3300045976 | Bacteria | 1843 |
| 343 | Ga0495654_0192260 | 3300046530 | Bacteria | 878 |
| 344 | Ga0495668_0031495 | 3300046616 | Bacteria | 2988 |
| 345 | Ga0495625_0274417 | 3300046660 | Bacteria | 1087 |
| 346 | Ga0495669_0001738 | 3300046684 | Bacteria | 8920 |
| 347 | Ga0495669_0005146 | 3300046684 | Bacteria | 5439 |
| 348 | Ga0495669_0015926 | 3300046684 | Bacteria | 3219 |
| 349 | Ga0495669_0037229 | 3300046684 | Bacteria | 2153 |
| 350 | Ga0495669_0132381 | 3300046684 | Bacteria | 1174 |
| 351 | Ga0495670_0086736 | 3300046691 | Bacteria | 1599 |
| 352 | Ga0495677_0077283 | 3300047445 | Bacteria | 1245 |
| 353 | Ga0495685_062657 | 3300047447 | Bacteria | 1252 |
| 354 | Ga0496100_0000774 | 3300048903 | Bacteria | 15222 |
| 355 | Ga0496101_0000256 | 3300048904 | Bacteria | 37912 |
| 356 | Ga0496102_0080868 | 3300048905 | Bacteria | 2994 |
| 357 | Ga0496103_0380749 | 3300048906 | Bacteria | 907 |
| 358 | Ga0496104_0105907 | 3300048907 | Bacteria | 2695 |
| 359 | Ga0496106_0009646 | 3300048909 | Bacteria | 7128 |
| 360 | Ga0496107_0001584 | 3300048910 | Bacteria | 14147 |
| 361 | Ga0496108_0000673 | 3300048911 | Bacteria | 26408 |
| 362 | Ga0496108_0176657 | 3300048911 | Bacteria | 1849 |
| 363 | Ga0496109_0011041 | 3300048912 | Bacteria | 7744 |
| 364 | Ga0496109_0031197 | 3300048912 | Bacteria | 4781 |
| 365 | Ga0496109_0577086 | 3300048912 | Bacteria | 1060 |
| 366 | Ga0496110_0001683 | 3300048913 | Bacteria | 16224 |
| 367 | Ga0496110_0222810 | 3300048913 | Bacteria | 1715 |
| 368 | Ga0496111_0000247 | 3300048914 | Bacteria | 25998 |
| 369 | Ga0496112_0000369 | 3300048915 | Bacteria | 29388 |
| 370 | Ga0496112_0832454 | 3300048915 | Bacteria | 847 |
| 371 | Ga0496113_0000242 | 3300048916 | Bacteria | 25756 |
| 372 | Ga0496113_0400606 | 3300048916 | Bacteria | 1102 |
| 373 | Ga0496114_0393615 | 3300048917 | Bacteria | 1227 |
| 374 | Ga0501263_013909 | 3300049760 | Bacteria | 1026 |
| 375 | Ga0501268_029739 | 3300049765 | Bacteria | 983 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100001159 | Ga0307408_1000011596 | 151 |
| 2 | 3300031731 | Ga0307405_10000240 | Ga0307405_1000024019 | 151 |
| 3 | 3300031824 | Ga0307413_10000616 | Ga0307413_100006164 | 151 |
| 4 | 3300031901 | Ga0307406_10011286 | Ga0307406_100112861 | 151 |
| 5 | 3300031903 | Ga0307407_10000541 | Ga0307407_100005418 | 151 |
| 6 | 3300031911 | Ga0307412_10000248 | Ga0307412_100002488 | 151 |
| 7 | 3300031995 | Ga0307409_100006369 | Ga0307409_1000063699 | 151 |
| 8 | 3300032002 | Ga0307416_100001974 | Ga0307416_10000197410 | 151 |
| 9 | 3300032004 | Ga0307414_10008907 | Ga0307414_100089072 | 151 |
| 10 | 3300032005 | Ga0307411_10001520 | Ga0307411_100015204 | 151 |
| 11 | 3300032126 | Ga0307415_100003980 | Ga0307415_1000039802 | 151 |
| 12 | 3300049760 | Ga0501263_013909 | Ga0501263_013909_355_918 | 151 |
| 13 | 3300049765 | Ga0501268_029739 | Ga0501268_029739_301_864 | 151 |
| 14 | 3300038443 | Ga0395901_0304822 | Ga0395901_0304822_107_568 | 152 |
| 15 | 3300031824 | Ga0307413_10039467 | Ga0307413_100394674 | 156 |
| 16 | 3300031995 | Ga0307409_100026614 | Ga0307409_1000266144 | 156 |
| 17 | 3300032005 | Ga0307411_10369880 | Ga0307411_103698803 | 156 |
| 18 | 3300037471 | Ga0395905_0925039 | Ga0395905_0925039_95_667 | 163 |
| 19 | 3300005331 | Ga0070670_100166362 | Ga0070670_1001663622 | 166 |
| 20 | 3300005353 | Ga0070669_100192769 | Ga0070669_1001927691 | 166 |
| 21 | 3300005548 | Ga0070665_100003344 | Ga0070665_10000334411 | 166 |
| 22 | 3300025901 | Ga0207688_10014012 | Ga0207688_100140128 | 166 |
| 23 | 3300025923 | Ga0207681_10089064 | Ga0207681_100890644 | 166 |
| 24 | 3300025925 | Ga0207650_10392805 | Ga0207650_103928052 | 166 |
| 25 | 3300025942 | Ga0207689_11164037 | Ga0207689_111640371 | 166 |
| 26 | 3300028379 | Ga0268266_10004494 | Ga0268266_1000449411 | 166 |
| 27 | 3300005327 | Ga0070658_10010002 | Ga0070658_100100029 | 167 |
| 28 | 3300005366 | Ga0070659_100002531 | Ga0070659_10000253111 | 167 |
| 29 | 3300025932 | Ga0207690_10339469 | Ga0207690_103394692 | 167 |
| 30 | 3300032005 | Ga0307411_10170135 | Ga0307411_101701352 | 167 |
| 31 | 3300037471 | Ga0395905_0181349 | Ga0395905_0181349_1082_1654 | 167 |
| 32 | 3300046660 | Ga0495625_0274417 | Ga0495625_0274417_501_1055 | 167 |
| 33 | 3300031824 | Ga0307413_10006414 | Ga0307413_100064145 | 168 |
| 34 | 3300031852 | Ga0307410_10050359 | Ga0307410_100503592 | 168 |
| 35 | 3300031901 | Ga0307406_10026141 | Ga0307406_100261412 | 168 |
| 36 | 3300031903 | Ga0307407_10067466 | Ga0307407_100674663 | 168 |
| 37 | 3300031995 | Ga0307409_100022018 | Ga0307409_1000220184 | 168 |
| 38 | 3300032002 | Ga0307416_100068524 | Ga0307416_1000685244 | 168 |
| 39 | 3300032004 | Ga0307414_10002750 | Ga0307414_100027504 | 168 |
| 40 | 3300032005 | Ga0307411_10003799 | Ga0307411_100037995 | 168 |
| 41 | 3300032126 | Ga0307415_100000898 | Ga0307415_10000089811 | 168 |
| 42 | 3300026142 | Ga0207698_10519556 | Ga0207698_105195561 | 169 |
| 43 | 3300037418 | Ga0395900_0032789 | Ga0395900_0032789_2565_3131 | 169 |
| 44 | 3300037466 | Ga0395898_0005758 | Ga0395898_0005758_2848_3414 | 169 |
| 45 | 3300037466 | Ga0395898_0091759 | Ga0395898_0091759_904_1470 | 169 |
| 46 | 3300037471 | Ga0395905_0000886 | Ga0395905_0000886_32468_33034 | 169 |
| 47 | 3300037471 | Ga0395905_0012343 | Ga0395905_0012343_4633_5199 | 169 |
| 48 | 3300038443 | Ga0395901_0019321 | Ga0395901_0019321_2326_2892 | 169 |
| 49 | 3300045976 | Ga0466967_0210586 | Ga0466967_0210586_338_904 | 169 |
| 50 | 3300046530 | Ga0495654_0192260 | Ga0495654_0192260_112_672 | 169 |
| 51 | 3300046616 | Ga0495668_0031495 | Ga0495668_0031495_190_750 | 169 |
| 52 | 3300046684 | Ga0495669_0001738 | Ga0495669_0001738_5971_6531 | 169 |
| 53 | 3300046684 | Ga0495669_0037229 | Ga0495669_0037229_1079_1639 | 169 |
| 54 | 3300047447 | Ga0495685_062657 | Ga0495685_062657_615_1175 | 169 |
| 55 | 3300048912 | Ga0496109_0577086 | Ga0496109_0577086_275_853 | 169 |
| 56 | 3300005327 | Ga0070658_10021514 | Ga0070658_100215147 | 170 |
| 57 | 3300005327 | Ga0070658_10141660 | Ga0070658_101416603 | 170 |
| 58 | 3300005336 | Ga0070680_100215099 | Ga0070680_1002150992 | 170 |
| 59 | 3300005339 | Ga0070660_100009960 | Ga0070660_1000099604 | 170 |
| 60 | 3300005339 | Ga0070660_100121794 | Ga0070660_1001217942 | 170 |
| 61 | 3300005339 | Ga0070660_100296020 | Ga0070660_1002960203 | 170 |
| 62 | 3300005344 | Ga0070661_100525597 | Ga0070661_1005255971 | 170 |
| 63 | 3300005366 | Ga0070659_100022901 | Ga0070659_1000229014 | 170 |
| 64 | 3300005366 | Ga0070659_100038915 | Ga0070659_1000389154 | 170 |
| 65 | 3300005366 | Ga0070659_100284553 | Ga0070659_1002845533 | 170 |
| 66 | 3300005434 | Ga0070709_10112095 | Ga0070709_101120953 | 170 |
| 67 | 3300005435 | Ga0070714_100144050 | Ga0070714_1001440501 | 170 |
| 68 | 3300005436 | Ga0070713_100019697 | Ga0070713_1000196977 | 170 |
| 69 | 3300005530 | Ga0070679_100365406 | Ga0070679_1003654063 | 170 |
| 70 | 3300005535 | Ga0070684_100443778 | Ga0070684_1004437783 | 170 |
| 71 | 3300005539 | Ga0068853_100014309 | Ga0068853_1000143094 | 170 |
| 72 | 3300005539 | Ga0068853_100027860 | Ga0068853_1000278605 | 170 |
| 73 | 3300005563 | Ga0068855_100312957 | Ga0068855_1003129572 | 170 |
| 74 | 3300005577 | Ga0068857_100034776 | Ga0068857_1000347763 | 170 |
| 75 | 3300005578 | Ga0068854_100096755 | Ga0068854_1000967552 | 170 |
| 76 | 3300005614 | Ga0068856_100054512 | Ga0068856_1000545123 | 170 |
| 77 | 3300005616 | Ga0068852_100002345 | Ga0068852_1000023459 | 170 |
| 78 | 3300005616 | Ga0068852_100036780 | Ga0068852_1000367802 | 170 |
| 79 | 3300006028 | Ga0070717_10006369 | Ga0070717_1000636910 | 170 |
| 80 | 3300009093 | Ga0105240_10072909 | Ga0105240_100729093 | 170 |
| 81 | 3300009174 | Ga0105241_10639529 | Ga0105241_106395292 | 170 |
| 82 | 3300009545 | Ga0105237_10023331 | Ga0105237_100233312 | 170 |
| 83 | 3300009551 | Ga0105238_10026958 | Ga0105238_100269585 | 170 |
| 84 | 3300009551 | Ga0105238_10181080 | Ga0105238_101810802 | 170 |
| 85 | 3300013100 | Ga0157373_10300426 | Ga0157373_103004263 | 170 |
| 86 | 3300013100 | Ga0157373_10459211 | Ga0157373_104592112 | 170 |
| 87 | 3300013102 | Ga0157371_10065258 | Ga0157371_100652584 | 170 |
| 88 | 3300013102 | Ga0157371_10420254 | Ga0157371_104202542 | 170 |
| 89 | 3300013104 | Ga0157370_10040212 | Ga0157370_100402121 | 170 |
| 90 | 3300013104 | Ga0157370_10387378 | Ga0157370_103873783 | 170 |
| 91 | 3300013105 | Ga0157369_10013440 | Ga0157369_100134404 | 170 |
| 92 | 3300013105 | Ga0157369_10046538 | Ga0157369_100465382 | 170 |
| 93 | 3300013307 | Ga0157372_10007664 | Ga0157372_100076648 | 170 |
| 94 | 3300025904 | Ga0207647_10019184 | Ga0207647_100191844 | 170 |
| 95 | 3300025909 | Ga0207705_10073787 | Ga0207705_100737872 | 170 |
| 96 | 3300025909 | Ga0207705_10147354 | Ga0207705_101473542 | 170 |
| 97 | 3300025911 | Ga0207654_10422574 | Ga0207654_104225741 | 170 |
| 98 | 3300025912 | Ga0207707_10152873 | Ga0207707_101528731 | 170 |
| 99 | 3300025913 | Ga0207695_10022931 | Ga0207695_100229313 | 170 |
| 100 | 3300025917 | Ga0207660_10473192 | Ga0207660_104731922 | 170 |
| 101 | 3300025919 | Ga0207657_10008822 | Ga0207657_1000882210 | 170 |
| 102 | 3300025919 | Ga0207657_10087941 | Ga0207657_100879413 | 170 |
| 103 | 3300025920 | Ga0207649_10354793 | Ga0207649_103547932 | 170 |
| 104 | 3300025921 | Ga0207652_10571678 | Ga0207652_105716782 | 170 |
| 105 | 3300025924 | Ga0207694_10012746 | Ga0207694_100127468 | 170 |
| 106 | 3300025928 | Ga0207700_10006481 | Ga0207700_100064819 | 170 |
| 107 | 3300025929 | Ga0207664_10235307 | Ga0207664_102353071 | 170 |
| 108 | 3300025932 | Ga0207690_10014114 | Ga0207690_100141147 | 170 |
| 109 | 3300025932 | Ga0207690_10027770 | Ga0207690_100277704 | 170 |
| 110 | 3300025933 | Ga0207706_10281392 | Ga0207706_102813922 | 170 |
| 111 | 3300025949 | Ga0207667_10147775 | Ga0207667_101477753 | 170 |
| 112 | 3300025949 | Ga0207667_10737664 | Ga0207667_107376642 | 170 |
| 113 | 3300025981 | Ga0207640_10066425 | Ga0207640_100664253 | 170 |
| 114 | 3300026041 | Ga0207639_10000074 | Ga0207639_1000007468 | 170 |
| 115 | 3300026041 | Ga0207639_10068989 | Ga0207639_100689893 | 170 |
| 116 | 3300026078 | Ga0207702_10029535 | Ga0207702_100295354 | 170 |
| 117 | 3300026116 | Ga0207674_10046288 | Ga0207674_100462881 | 170 |
| 118 | 3300026142 | Ga0207698_10005850 | Ga0207698_100058506 | 170 |
| 119 | 3300026142 | Ga0207698_10174569 | Ga0207698_101745692 | 170 |
| 120 | 3300031548 | Ga0307408_100034475 | Ga0307408_1000344754 | 170 |
| 121 | 3300032004 | Ga0307414_10072633 | Ga0307414_100726332 | 170 |
| 122 | 3300032005 | Ga0307411_10053185 | Ga0307411_100531852 | 170 |
| 123 | 3300032126 | Ga0307415_100059214 | Ga0307415_1000592144 | 170 |
| 124 | 3300035725 | Ga0373947_0139504 | Ga0373947_0139504_624_1190 | 170 |
| 125 | 3300041498 | Ga0451841_1126972 | Ga0451841_1126972_119_754 | 170 |
| 126 | 3300046684 | Ga0495669_0005146 | Ga0495669_0005146_1590_2162 | 170 |
| 127 | 3300047445 | Ga0495677_0077283 | Ga0495677_0077283_263_835 | 170 |
| 128 | 3300005327 | Ga0070658_10494654 | Ga0070658_104946542 | 171 |
| 129 | 3300005344 | Ga0070661_100318157 | Ga0070661_1003181572 | 171 |
| 130 | 3300005547 | Ga0070693_100096197 | Ga0070693_1000961973 | 171 |
| 131 | 3300005616 | Ga0068852_100843379 | Ga0068852_1008433792 | 171 |
| 132 | 3300011119 | Ga0105246_10441043 | Ga0105246_104410432 | 171 |
| 133 | 3300013100 | Ga0157373_10333071 | Ga0157373_103330712 | 171 |
| 134 | 3300025920 | Ga0207649_10060762 | Ga0207649_100607623 | 171 |
| 135 | 3300025932 | Ga0207690_10202027 | Ga0207690_102020272 | 171 |
| 136 | 3300025949 | Ga0207667_10363645 | Ga0207667_103636451 | 171 |
| 137 | 3300025981 | Ga0207640_10075975 | Ga0207640_100759754 | 171 |
| 138 | 3300026116 | Ga0207674_10350833 | Ga0207674_103508332 | 171 |
| 139 | 3300026142 | Ga0207698_10076542 | Ga0207698_100765422 | 171 |
| 140 | 3300026142 | Ga0207698_10378912 | Ga0207698_103789122 | 171 |
| 141 | 3300031548 | Ga0307408_100474195 | Ga0307408_1004741952 | 171 |
| 142 | 3300031731 | Ga0307405_10130732 | Ga0307405_101307322 | 171 |
| 143 | 3300031824 | Ga0307413_10031914 | Ga0307413_100319143 | 171 |
| 144 | 3300031824 | Ga0307413_10055708 | Ga0307413_100557082 | 171 |
| 145 | 3300031824 | Ga0307413_10729443 | Ga0307413_107294431 | 171 |
| 146 | 3300031852 | Ga0307410_10011784 | Ga0307410_100117843 | 171 |
| 147 | 3300031852 | Ga0307410_10152802 | Ga0307410_101528023 | 171 |
| 148 | 3300031901 | Ga0307406_10490993 | Ga0307406_104909932 | 171 |
| 149 | 3300031903 | Ga0307407_10317245 | Ga0307407_103172452 | 171 |
| 150 | 3300031903 | Ga0307407_10583080 | Ga0307407_105830802 | 171 |
| 151 | 3300031911 | Ga0307412_10172295 | Ga0307412_101722952 | 171 |
| 152 | 3300031995 | Ga0307409_100248551 | Ga0307409_1002485513 | 171 |
| 153 | 3300032002 | Ga0307416_100030884 | Ga0307416_1000308843 | 171 |
| 154 | 3300032002 | Ga0307416_100350076 | Ga0307416_1003500762 | 171 |
| 155 | 3300032004 | Ga0307414_10007680 | Ga0307414_100076805 | 171 |
| 156 | 3300032004 | Ga0307414_10100532 | Ga0307414_101005323 | 171 |
| 157 | 3300032005 | Ga0307411_10006791 | Ga0307411_100067913 | 171 |
| 158 | 3300032005 | Ga0307411_10147716 | Ga0307411_101477162 | 171 |
| 159 | 3300032126 | Ga0307415_100429770 | Ga0307415_1004297702 | 171 |
| 160 | 3300032126 | Ga0307415_100779972 | Ga0307415_1007799722 | 171 |
| 161 | 3300042006 | Ga0439432_024219 | Ga0439432_024219_627_1202 | 171 |
| 162 | 3300042007 | Ga0439449_0023001 | Ga0439449_0023001_291_863 | 171 |
| 163 | 3300045976 | Ga0466967_0003377 | Ga0466967_0003377_5934_6512 | 171 |
| 164 | 3300005293 | Ga0065715_10559073 | Ga0065715_105590731 | 172 |
| 165 | 3300005327 | Ga0070658_10130821 | Ga0070658_101308213 | 172 |
| 166 | 3300005327 | Ga0070658_10803999 | Ga0070658_108039991 | 172 |
| 167 | 3300005333 | Ga0070677_10112666 | Ga0070677_101126662 | 172 |
| 168 | 3300005333 | Ga0070677_10345369 | Ga0070677_103453692 | 172 |
| 169 | 3300005343 | Ga0070687_100395404 | Ga0070687_1003954042 | 172 |
| 170 | 3300005354 | Ga0070675_100133439 | Ga0070675_1001334392 | 172 |
| 171 | 3300005364 | Ga0070673_100331275 | Ga0070673_1003312752 | 172 |
| 172 | 3300005366 | Ga0070659_100212037 | Ga0070659_1002120372 | 172 |
| 173 | 3300005457 | Ga0070662_100135508 | Ga0070662_1001355083 | 172 |
| 174 | 3300005457 | Ga0070662_100218362 | Ga0070662_1002183622 | 172 |
| 175 | 3300005543 | Ga0070672_100028979 | Ga0070672_1000289796 | 172 |
| 176 | 3300005564 | Ga0070664_100049385 | Ga0070664_1000493854 | 172 |
| 177 | 3300010375 | Ga0105239_11079000 | Ga0105239_110790002 | 172 |
| 178 | 3300013308 | Ga0157375_10262656 | Ga0157375_102626562 | 172 |
| 179 | 3300025315 | Ga0207697_10033132 | Ga0207697_100331323 | 172 |
| 180 | 3300025893 | Ga0207682_10004033 | Ga0207682_100040332 | 172 |
| 181 | 3300025901 | Ga0207688_10007755 | Ga0207688_100077553 | 172 |
| 182 | 3300025904 | Ga0207647_10065750 | Ga0207647_100657501 | 172 |
| 183 | 3300025909 | Ga0207705_10068893 | Ga0207705_100688933 | 172 |
| 184 | 3300025918 | Ga0207662_10060514 | Ga0207662_100605142 | 172 |
| 185 | 3300025919 | Ga0207657_10011457 | Ga0207657_100114576 | 172 |
| 186 | 3300025923 | Ga0207681_10228449 | Ga0207681_102284492 | 172 |
| 187 | 3300025925 | Ga0207650_10020862 | Ga0207650_100208628 | 172 |
| 188 | 3300025926 | Ga0207659_10043018 | Ga0207659_100430183 | 172 |
| 189 | 3300025926 | Ga0207659_10371682 | Ga0207659_103716822 | 172 |
| 190 | 3300025931 | Ga0207644_10098773 | Ga0207644_100987734 | 172 |
| 191 | 3300025932 | Ga0207690_10734429 | Ga0207690_107344291 | 172 |
| 192 | 3300025933 | Ga0207706_10291901 | Ga0207706_102919013 | 172 |
| 193 | 3300025933 | Ga0207706_10565469 | Ga0207706_105654692 | 172 |
| 194 | 3300025942 | Ga0207689_10092544 | Ga0207689_100925443 | 172 |
| 195 | 3300025945 | Ga0207679_10589697 | Ga0207679_105896971 | 172 |
| 196 | 3300025960 | Ga0207651_10354301 | Ga0207651_103543013 | 172 |
| 197 | 3300025972 | Ga0207668_10324481 | Ga0207668_103244811 | 172 |
| 198 | 3300026095 | Ga0207676_10125781 | Ga0207676_101257813 | 172 |
| 199 | 3300026142 | Ga0207698_10716424 | Ga0207698_107164242 | 172 |
| 200 | 3300031852 | Ga0307410_10051076 | Ga0307410_100510763 | 172 |
| 201 | 3300032004 | Ga0307414_10029867 | Ga0307414_100298673 | 172 |
| 202 | 3300032005 | Ga0307411_10078645 | Ga0307411_100786452 | 172 |
| 203 | 3300032126 | Ga0307415_100011268 | Ga0307415_1000112683 | 172 |
| 204 | 3300046684 | Ga0495669_0132381 | Ga0495669_0132381_41_610 | 172 |
| 205 | 3300046691 | Ga0495670_0086736 | Ga0495670_0086736_975_1550 | 172 |
| 206 | 3300048911 | Ga0496108_0176657 | Ga0496108_0176657_1012_1587 | 172 |
| 207 | 3300048912 | Ga0496109_0031197 | Ga0496109_0031197_2920_3495 | 172 |
| 208 | 3300048913 | Ga0496110_0222810 | Ga0496110_0222810_421_996 | 172 |
| 209 | 3300048916 | Ga0496113_0400606 | Ga0496113_0400606_246_824 | 172 |
| 210 | 3300001991 | JGI24743J22301_10025438 | JGI24743J22301_100254382 | 173 |
| 211 | 3300005327 | Ga0070658_10106976 | Ga0070658_101069762 | 173 |
| 212 | 3300005330 | Ga0070690_100085132 | Ga0070690_1000851323 | 173 |
| 213 | 3300005335 | Ga0070666_10000753 | Ga0070666_1000075320 | 173 |
| 214 | 3300005338 | Ga0068868_100010090 | Ga0068868_1000100905 | 173 |
| 215 | 3300005338 | Ga0068868_100060483 | Ga0068868_1000604833 | 173 |
| 216 | 3300005339 | Ga0070660_100081437 | Ga0070660_1000814374 | 173 |
| 217 | 3300005339 | Ga0070660_100175983 | Ga0070660_1001759832 | 173 |
| 218 | 3300005340 | Ga0070689_100744087 | Ga0070689_1007440872 | 173 |
| 219 | 3300005344 | Ga0070661_100014342 | Ga0070661_1000143426 | 173 |
| 220 | 3300005355 | Ga0070671_100000051 | Ga0070671_10000005126 | 173 |
| 221 | 3300005355 | Ga0070671_100005658 | Ga0070671_10000565810 | 173 |
| 222 | 3300005355 | Ga0070671_100008324 | Ga0070671_1000083249 | 173 |
| 223 | 3300005355 | Ga0070671_100194639 | Ga0070671_1001946393 | 173 |
| 224 | 3300005356 | Ga0070674_100024211 | Ga0070674_1000242113 | 173 |
| 225 | 3300005356 | Ga0070674_100069104 | Ga0070674_1000691043 | 173 |
| 226 | 3300005364 | Ga0070673_100014605 | Ga0070673_1000146055 | 173 |
| 227 | 3300005364 | Ga0070673_100015936 | Ga0070673_1000159362 | 173 |
| 228 | 3300005364 | Ga0070673_100151353 | Ga0070673_1001513533 | 173 |
| 229 | 3300005366 | Ga0070659_100074719 | Ga0070659_1000747192 | 173 |
| 230 | 3300005366 | Ga0070659_100434452 | Ga0070659_1004344522 | 173 |
| 231 | 3300005367 | Ga0070667_100051318 | Ga0070667_1000513185 | 173 |
| 232 | 3300005455 | Ga0070663_100044873 | Ga0070663_1000448733 | 173 |
| 233 | 3300005455 | Ga0070663_100137020 | Ga0070663_1001370202 | 173 |
| 234 | 3300005456 | Ga0070678_100010816 | Ga0070678_1000108166 | 173 |
| 235 | 3300005456 | Ga0070678_100024271 | Ga0070678_1000242717 | 173 |
| 236 | 3300005457 | Ga0070662_100098921 | Ga0070662_1000989212 | 173 |
| 237 | 3300005459 | Ga0068867_100014664 | Ga0068867_1000146645 | 173 |
| 238 | 3300005539 | Ga0068853_100090936 | Ga0068853_1000909363 | 173 |
| 239 | 3300005543 | Ga0070672_100003732 | Ga0070672_10000373211 | 173 |
| 240 | 3300005543 | Ga0070672_100298997 | Ga0070672_1002989971 | 173 |
| 241 | 3300005543 | Ga0070672_100353163 | Ga0070672_1003531632 | 173 |
| 242 | 3300005544 | Ga0070686_100172835 | Ga0070686_1001728352 | 173 |
| 243 | 3300005548 | Ga0070665_100003837 | Ga0070665_10000383715 | 173 |
| 244 | 3300005548 | Ga0070665_100023061 | Ga0070665_1000230616 | 173 |
| 245 | 3300005564 | Ga0070664_100006520 | Ga0070664_1000065202 | 173 |
| 246 | 3300005564 | Ga0070664_100049398 | Ga0070664_1000493983 | 173 |
| 247 | 3300005564 | Ga0070664_100057237 | Ga0070664_1000572374 | 173 |
| 248 | 3300005564 | Ga0070664_101022493 | Ga0070664_1010224932 | 173 |
| 249 | 3300005577 | Ga0068857_100531470 | Ga0068857_1005314702 | 173 |
| 250 | 3300005578 | Ga0068854_100060782 | Ga0068854_1000607823 | 173 |
| 251 | 3300005614 | Ga0068856_100099312 | Ga0068856_1000993124 | 173 |
| 252 | 3300005616 | Ga0068852_100025103 | Ga0068852_1000251033 | 173 |
| 253 | 3300005616 | Ga0068852_100226919 | Ga0068852_1002269192 | 173 |
| 254 | 3300005617 | Ga0068859_100126409 | Ga0068859_1001264092 | 173 |
| 255 | 3300005618 | Ga0068864_100016194 | Ga0068864_1000161945 | 173 |
| 256 | 3300005718 | Ga0068866_10124162 | Ga0068866_101241623 | 173 |
| 257 | 3300005834 | Ga0068851_10061352 | Ga0068851_100613522 | 173 |
| 258 | 3300005841 | Ga0068863_100122043 | Ga0068863_1001220432 | 173 |
| 259 | 3300005842 | Ga0068858_100184526 | Ga0068858_1001845262 | 173 |
| 260 | 3300005985 | Ga0081539_10035648 | Ga0081539_100356482 | 173 |
| 261 | 3300006237 | Ga0097621_100001388 | Ga0097621_10000138818 | 173 |
| 262 | 3300006358 | Ga0068871_100006176 | Ga0068871_1000061765 | 173 |
| 263 | 3300006931 | Ga0097620_100126415 | Ga0097620_1001264152 | 173 |
| 264 | 3300009093 | Ga0105240_10725969 | Ga0105240_107259692 | 173 |
| 265 | 3300009098 | Ga0105245_10205399 | Ga0105245_102053992 | 173 |
| 266 | 3300009148 | Ga0105243_10089749 | Ga0105243_100897493 | 173 |
| 267 | 3300009177 | Ga0105248_10330631 | Ga0105248_103306312 | 173 |
| 268 | 3300009177 | Ga0105248_10427085 | Ga0105248_104270852 | 173 |
| 269 | 3300009551 | Ga0105238_11175378 | Ga0105238_111753782 | 173 |
| 270 | 3300013100 | Ga0157373_10120835 | Ga0157373_101208353 | 173 |
| 271 | 3300013105 | Ga0157369_10652146 | Ga0157369_106521461 | 173 |
| 272 | 3300013297 | Ga0157378_10068744 | Ga0157378_100687441 | 173 |
| 273 | 3300013297 | Ga0157378_10419039 | Ga0157378_104190391 | 173 |
| 274 | 3300013297 | Ga0157378_11079704 | Ga0157378_110797041 | 173 |
| 275 | 3300013306 | Ga0163162_10105699 | Ga0163162_101056992 | 173 |
| 276 | 3300013308 | Ga0157375_10023990 | Ga0157375_100239909 | 173 |
| 277 | 3300013308 | Ga0157375_10947333 | Ga0157375_109473331 | 173 |
| 278 | 3300014745 | Ga0157377_10293229 | Ga0157377_102932291 | 173 |
| 279 | 3300014968 | Ga0157379_10033652 | Ga0157379_100336523 | 173 |
| 280 | 3300014968 | Ga0157379_10123623 | Ga0157379_101236232 | 173 |
| 281 | 3300014969 | Ga0157376_10023468 | Ga0157376_100234685 | 173 |
| 282 | 3300017792 | Ga0163161_10524372 | Ga0163161_105243722 | 173 |
| 283 | 3300025321 | Ga0207656_10145560 | Ga0207656_101455602 | 173 |
| 284 | 3300025903 | Ga0207680_10002819 | Ga0207680_100028197 | 173 |
| 285 | 3300025904 | Ga0207647_10038029 | Ga0207647_100380293 | 173 |
| 286 | 3300025907 | Ga0207645_10044456 | Ga0207645_100444563 | 173 |
| 287 | 3300025909 | Ga0207705_10020917 | Ga0207705_100209176 | 173 |
| 288 | 3300025909 | Ga0207705_10311131 | Ga0207705_103111312 | 173 |
| 289 | 3300025918 | Ga0207662_10390762 | Ga0207662_103907622 | 173 |
| 290 | 3300025919 | Ga0207657_10005081 | Ga0207657_100050813 | 173 |
| 291 | 3300025919 | Ga0207657_10073160 | Ga0207657_100731603 | 173 |
| 292 | 3300025920 | Ga0207649_10008810 | Ga0207649_100088105 | 173 |
| 293 | 3300025920 | Ga0207649_10042998 | Ga0207649_100429984 | 173 |
| 294 | 3300025924 | Ga0207694_10653205 | Ga0207694_106532052 | 173 |
| 295 | 3300025925 | Ga0207650_10080546 | Ga0207650_100805461 | 173 |
| 296 | 3300025925 | Ga0207650_10103580 | Ga0207650_101035803 | 173 |
| 297 | 3300025926 | Ga0207659_10680307 | Ga0207659_106803072 | 173 |
| 298 | 3300025927 | Ga0207687_10066385 | Ga0207687_100663853 | 173 |
| 299 | 3300025931 | Ga0207644_10000243 | Ga0207644_1000024330 | 173 |
| 300 | 3300025931 | Ga0207644_10000996 | Ga0207644_1000099620 | 173 |
| 301 | 3300025931 | Ga0207644_10003062 | Ga0207644_100030629 | 173 |
| 302 | 3300025931 | Ga0207644_10464849 | Ga0207644_104648492 | 173 |
| 303 | 3300025932 | Ga0207690_10133858 | Ga0207690_101338582 | 173 |
| 304 | 3300025933 | Ga0207706_10055135 | Ga0207706_100551352 | 173 |
| 305 | 3300025934 | Ga0207686_10056521 | Ga0207686_100565214 | 173 |
| 306 | 3300025935 | Ga0207709_10033135 | Ga0207709_100331354 | 173 |
| 307 | 3300025936 | Ga0207670_10656854 | Ga0207670_106568542 | 173 |
| 308 | 3300025937 | Ga0207669_10035143 | Ga0207669_100351432 | 173 |
| 309 | 3300025937 | Ga0207669_10037728 | Ga0207669_100377282 | 173 |
| 310 | 3300025940 | Ga0207691_10034954 | Ga0207691_100349545 | 173 |
| 311 | 3300025940 | Ga0207691_10049560 | Ga0207691_100495606 | 173 |
| 312 | 3300025940 | Ga0207691_10299439 | Ga0207691_102994391 | 173 |
| 313 | 3300025940 | Ga0207691_10348806 | Ga0207691_103488061 | 173 |
| 314 | 3300025941 | Ga0207711_10001208 | Ga0207711_100012083 | 173 |
| 315 | 3300025941 | Ga0207711_10134922 | Ga0207711_101349224 | 173 |
| 316 | 3300025945 | Ga0207679_10226000 | Ga0207679_102260002 | 173 |
| 317 | 3300025945 | Ga0207679_11066134 | Ga0207679_110661342 | 173 |
| 318 | 3300025960 | Ga0207651_10033435 | Ga0207651_100334353 | 173 |
| 319 | 3300025981 | Ga0207640_10073299 | Ga0207640_100732992 | 173 |
| 320 | 3300025981 | Ga0207640_10112280 | Ga0207640_101122803 | 173 |
| 321 | 3300025986 | Ga0207658_10002850 | Ga0207658_100028506 | 173 |
| 322 | 3300026023 | Ga0207677_10000529 | Ga0207677_1000052910 | 173 |
| 323 | 3300026023 | Ga0207677_10253278 | Ga0207677_102532782 | 173 |
| 324 | 3300026035 | Ga0207703_10054235 | Ga0207703_100542352 | 173 |
| 325 | 3300026035 | Ga0207703_10074669 | Ga0207703_100746692 | 173 |
| 326 | 3300026041 | Ga0207639_10095153 | Ga0207639_100951533 | 173 |
| 327 | 3300026067 | Ga0207678_10004584 | Ga0207678_1000458415 | 173 |
| 328 | 3300026067 | Ga0207678_10115764 | Ga0207678_101157643 | 173 |
| 329 | 3300026078 | Ga0207702_10048049 | Ga0207702_100480495 | 173 |
| 330 | 3300026088 | Ga0207641_10015898 | Ga0207641_100158985 | 173 |
| 331 | 3300026089 | Ga0207648_10018832 | Ga0207648_100188324 | 173 |
| 332 | 3300026089 | Ga0207648_10028153 | Ga0207648_100281534 | 173 |
| 333 | 3300026121 | Ga0207683_10004238 | Ga0207683_1000423812 | 173 |
| 334 | 3300026121 | Ga0207683_10005095 | Ga0207683_100050956 | 173 |
| 335 | 3300026142 | Ga0207698_10031093 | Ga0207698_100310934 | 173 |
| 336 | 3300026142 | Ga0207698_10297321 | Ga0207698_102973212 | 173 |
| 337 | 3300026142 | Ga0207698_10417201 | Ga0207698_104172011 | 173 |
| 338 | 3300028379 | Ga0268266_10005157 | Ga0268266_1000515715 | 173 |
| 339 | 3300035207 | Ga0373942_0022501 | Ga0373942_0022501_49_645 | 173 |
| 340 | 3300035691 | Ga0373931_0020928 | Ga0373931_0020928_1639_2217 | 173 |
| 341 | 3300037312 | Ga0395899_0121342 | Ga0395899_0121342_1166_1741 | 173 |
| 342 | 3300037312 | Ga0395899_0385760 | Ga0395899_0385760_221_796 | 173 |
| 343 | 3300037418 | Ga0395900_0005624 | Ga0395900_0005624_712_1287 | 173 |
| 344 | 3300037418 | Ga0395900_0088673 | Ga0395900_0088673_1129_1704 | 173 |
| 345 | 3300037418 | Ga0395900_0127237 | Ga0395900_0127237_1147_1725 | 173 |
| 346 | 3300037466 | Ga0395898_0114178 | Ga0395898_0114178_38_616 | 173 |
| 347 | 3300037466 | Ga0395898_0519923 | Ga0395898_0519923_323_898 | 173 |
| 348 | 3300037471 | Ga0395905_0006839 | Ga0395905_0006839_8530_9108 | 173 |
| 349 | 3300037471 | Ga0395905_0034826 | Ga0395905_0034826_1640_2215 | 173 |
| 350 | 3300037471 | Ga0395905_0173752 | Ga0395905_0173752_498_1070 | 173 |
| 351 | 3300037471 | Ga0395905_0625627 | Ga0395905_0625627_321_899 | 173 |
| 352 | 3300037853 | Ga0436364_1116664 | Ga0436364_1116664_229_801 | 173 |
| 353 | 3300038443 | Ga0395901_0039825 | Ga0395901_0039825_3197_3775 | 173 |
| 354 | 3300038443 | Ga0395901_0056208 | Ga0395901_0056208_1882_2460 | 173 |
| 355 | 3300038443 | Ga0395901_0213394 | Ga0395901_0213394_1388_1963 | 173 |
| 356 | 3300038443 | Ga0395901_0340516 | Ga0395901_0340516_322_897 | 173 |
| 357 | 3300038443 | Ga0395901_0875365 | Ga0395901_0875365_122_697 | 173 |
| 358 | 3300044658 | Ga0466972_0137500 | Ga0466972_0137500_50_625 | 173 |
| 359 | 3300044901 | Ga0466960_0000555 | Ga0466960_0000555_5486_6061 | 173 |
| 360 | 3300046684 | Ga0495669_0015926 | Ga0495669_0015926_632_1204 | 173 |
| 361 | 3300048903 | Ga0496100_0000774 | Ga0496100_0000774_4960_5538 | 173 |
| 362 | 3300048904 | Ga0496101_0000256 | Ga0496101_0000256_8901_9479 | 173 |
| 363 | 3300048905 | Ga0496102_0080868 | Ga0496102_0080868_1643_2221 | 173 |
| 364 | 3300048906 | Ga0496103_0380749 | Ga0496103_0380749_150_731 | 173 |
| 365 | 3300048907 | Ga0496104_0105907 | Ga0496104_0105907_967_1545 | 173 |
| 366 | 3300048909 | Ga0496106_0009646 | Ga0496106_0009646_4747_5325 | 173 |
| 367 | 3300048910 | Ga0496107_0001584 | Ga0496107_0001584_5550_6128 | 173 |
| 368 | 3300048911 | Ga0496108_0000673 | Ga0496108_0000673_19727_20305 | 173 |
| 369 | 3300048912 | Ga0496109_0011041 | Ga0496109_0011041_2584_3162 | 173 |
| 370 | 3300048913 | Ga0496110_0001683 | Ga0496110_0001683_8785_9363 | 173 |
| 371 | 3300048914 | Ga0496111_0000247 | Ga0496111_0000247_3843_4421 | 173 |
| 372 | 3300048915 | Ga0496112_0000369 | Ga0496112_0000369_24777_25355 | 173 |
| 373 | 3300048915 | Ga0496112_0832454 | Ga0496112_0832454_192_785 | 173 |
| 374 | 3300048916 | Ga0496113_0000242 | Ga0496113_0000242_15085_15663 | 173 |
| 375 | 3300048917 | Ga0496114_0393615 | Ga0496114_0393615_571_1149 | 173 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jfu-assembly1.cif.gz_A | crystal structure of the soluble domain of tlpa from bradyrhizobium japonicum | 0.904 | 22 | 169 |
| 4txo-assembly2.cif.gz_A | crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) | 0.8949 | 30 | 167 |
| 5um7-assembly1.cif.gz_A | crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii | 0.8749 | 26 | 165 |
| 3kcm-assembly1.cif.gz_A | the crystal structure of thioredoxin protein from geobacter metallireducens | 0.8738 | 27 | 165 |
| 2h1a-assembly1.cif.gz_A | resa c74a variant | 0.8617 | 29 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4txvC00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9112 | 30 | 167 | 3.40.30.10 |
| 1st9A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8628 | 27 | 167 | 3.40.30.10 |
| af_A0A1D6PSC0_375_455_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8565 | 46 | 92 | 3.40.30.10 |
| 3gl3B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8488 | 27 | 167 | 3.40.30.10 |
| af_I6YGW6_98_222_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8462 | 38 | 163 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G9SAA3-F1-model_v4 | TlpA family protein disulfide reductase | 0.9817 | 55 | 167 |
GO:0015036
GO:0017004 GO:0030313 |
| AF-A0A7G9SAA3-F1-model_v4 | TlpA family protein disulfide reductase | 0.9564 | 55 | 167 |
GO:0015036
GO:0017004 GO:0030313 |
| AF-A0A848HZZ5-F1-model_v4 | TlpA family protein disulfide reductase | 0.9531 | 22 | 167 |
GO:0015036
GO:0017004 GO:0030313 |
| AF-A0A255Z0M9-F1-model_v4 | Thioredoxin domain-containing protein | 0.9281 | 21 | 167 |
GO:0016491
GO:0017004 |
| AF-A0A2T4ZNI1-F1-model_v4 | deleted | 0.9134 | 22 | 167 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar