F427089

General Info

Members Datasets Scaffolds Average Seq Length
375 173 375 188

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100011268|Ga0307415_1000112683
Length 205
Sequence LRHPLEAARPGLYRRMMRFALVLAFLILAACSKPQSQQATNEAEPSAEAGPVKGVDRSHKGKPAPDAVFNDPDGGEISLGDFKGTPVLINLWATWCAPCVKELPTLDRLAASHRVDGQLGVVAISQDMGPQQSVEAFLGKLKIQDLGAFHDPKMGLSGALDAQVLPTSILFDADGREVWRYVGDLDWTGPEAAKLLAEGGVGRTG

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
173 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.33
Rhizosphere 94.13
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10025438 3300001991 Bacteria 1147
2 Ga0065715_10559073 3300005293 Bacteria 735
3 Ga0070658_10010002 3300005327 Bacteria 7618
4 Ga0070658_10021514 3300005327 Bacteria 5170
5 Ga0070658_10106976 3300005327 Bacteria 2314
6 Ga0070658_10130821 3300005327 Bacteria 2092
7 Ga0070658_10141660 3300005327 Bacteria 2009
8 Ga0070658_10494654 3300005327 Bacteria 1056
9 Ga0070658_10803999 3300005327 Unclassified 817
10 Ga0070690_100085132 3300005330 Bacteria 2073
11 Ga0070670_100166362 3300005331 Bacteria 1912
12 Ga0070677_10112666 3300005333 Bacteria 1217
13 Ga0070677_10345369 3300005333 Bacteria 769
14 Ga0070666_10000753 3300005335 Bacteria 19635
15 Ga0070680_100215099 3300005336 Bacteria 1622
16 Ga0068868_100010090 3300005338 Bacteria 6823
17 Ga0068868_100060483 3300005338 Bacteria 2999
18 Ga0070660_100009960 3300005339 Bacteria 6703
19 Ga0070660_100081437 3300005339 Bacteria 2541
20 Ga0070660_100121794 3300005339 Bacteria 2082
21 Ga0070660_100175983 3300005339 Bacteria 1730
22 Ga0070660_100296020 3300005339 Bacteria 1326
23 Ga0070689_100744087 3300005340 Bacteria 859
24 Ga0070687_100395404 3300005343 Bacteria 905
25 Ga0070661_100014342 3300005344 Bacteria 5583
26 Ga0070661_100318157 3300005344 Bacteria 1215
27 Ga0070661_100525597 3300005344 Bacteria 949
28 Ga0070669_100192769 3300005353 Bacteria 1599
29 Ga0070675_100133439 3300005354 Bacteria 2118
30 Ga0070671_100000051 3300005355 Bacteria 79207
31 Ga0070671_100005658 3300005355 Bacteria 9948
32 Ga0070671_100008324 3300005355 Bacteria 8304
33 Ga0070671_100194639 3300005355 Bacteria 1719
34 Ga0070674_100024211 3300005356 Bacteria 3938
35 Ga0070674_100069104 3300005356 Bacteria 2491
36 Ga0070673_100014605 3300005364 Bacteria 5478
37 Ga0070673_100015936 3300005364 Bacteria 5296
38 Ga0070673_100151353 3300005364 Bacteria 1965
39 Ga0070673_100331275 3300005364 Bacteria 1347
40 Ga0070659_100002531 3300005366 Bacteria 12994
41 Ga0070659_100022901 3300005366 Bacteria 4774
42 Ga0070659_100038915 3300005366 Bacteria 3710
43 Ga0070659_100074719 3300005366 Bacteria 2700
44 Ga0070659_100212037 3300005366 Bacteria 1596
45 Ga0070659_100284553 3300005366 Bacteria 1376
46 Ga0070659_100434452 3300005366 Bacteria 1111
47 Ga0070667_100051318 3300005367 Bacteria 3477
48 Ga0070709_10112095 3300005434 Bacteria 1835
49 Ga0070714_100144050 3300005435 Bacteria 2141
50 Ga0070713_100019697 3300005436 Bacteria 5159
51 Ga0070663_100044873 3300005455 Bacteria 3119
52 Ga0070663_100137020 3300005455 Bacteria 1865
53 Ga0070678_100010816 3300005456 Bacteria 5594
54 Ga0070678_100024271 3300005456 Bacteria 4056
55 Ga0070662_100098921 3300005457 Bacteria 2204
56 Ga0070662_100135508 3300005457 Bacteria 1903
57 Ga0070662_100218362 3300005457 Bacteria 1520
58 Ga0068867_100014664 3300005459 Bacteria 5554
59 Ga0070679_100365406 3300005530 Bacteria 1390
60 Ga0070684_100443778 3300005535 Bacteria 1199
61 Ga0068853_100014309 3300005539 Bacteria 6493
62 Ga0068853_100027860 3300005539 Bacteria 4750
63 Ga0068853_100090936 3300005539 Bacteria 2683
64 Ga0070672_100003732 3300005543 Bacteria 9912
65 Ga0070672_100028979 3300005543 Bacteria 4146
66 Ga0070672_100298997 3300005543 Bacteria 1364
67 Ga0070672_100353163 3300005543 Bacteria 1254
68 Ga0070686_100172835 3300005544 Bacteria 1529
69 Ga0070693_100096197 3300005547 Bacteria 1795
70 Ga0070665_100003344 3300005548 Bacteria 17169
71 Ga0070665_100003837 3300005548 Bacteria 15903
72 Ga0070665_100023061 3300005548 Bacteria 6269
73 Ga0068855_100312957 3300005563 Bacteria 1737
74 Ga0070664_100006520 3300005564 Bacteria 9411
75 Ga0070664_100049385 3300005564 Bacteria 3558
76 Ga0070664_100049398 3300005564 Bacteria 3558
77 Ga0070664_100057237 3300005564 Bacteria 3313
78 Ga0070664_101022493 3300005564 Bacteria 777
79 Ga0068857_100034776 3300005577 Bacteria 4457
80 Ga0068857_100531470 3300005577 Bacteria 1106
81 Ga0068854_100060782 3300005578 Bacteria 2734
82 Ga0068854_100096755 3300005578 Bacteria 2206
83 Ga0068856_100054512 3300005614 Bacteria 3944
84 Ga0068856_100099312 3300005614 Bacteria 2902
85 Ga0068852_100002345 3300005616 Bacteria 13033
86 Ga0068852_100025103 3300005616 Bacteria 4824
87 Ga0068852_100036780 3300005616 Bacteria 4100
88 Ga0068852_100226919 3300005616 Bacteria 1779
89 Ga0068852_100843379 3300005616 Bacteria 932
90 Ga0068859_100126409 3300005617 Bacteria 2626
91 Ga0068864_100016194 3300005618 Bacteria 6206
92 Ga0068866_10124162 3300005718 Bacteria 1459
93 Ga0068851_10061352 3300005834 Bacteria 1927
94 Ga0068863_100122043 3300005841 Bacteria 2485
95 Ga0068858_100184526 3300005842 Bacteria 1970
96 Ga0081539_10035648 3300005985 Bacteria 2986
97 Ga0070717_10006369 3300006028 Bacteria 8676
98 Ga0097621_100001388 3300006237 Bacteria 16665
99 Ga0068871_100006176 3300006358 Bacteria 8442
100 Ga0097620_100126415 3300006931 Bacteria 2626
101 Ga0105240_10072909 3300009093 Bacteria 4242
102 Ga0105240_10725969 3300009093 Bacteria 1082
103 Ga0105245_10205399 3300009098 Bacteria 1894
104 Ga0105243_10089749 3300009148 Bacteria 2528
105 Ga0105241_10639529 3300009174 Bacteria 965
106 Ga0105248_10330631 3300009177 Bacteria 1716
107 Ga0105248_10427085 3300009177 Bacteria 1492
108 Ga0105237_10023331 3300009545 Bacteria 6341
109 Ga0105238_10026958 3300009551 Bacteria 5857
110 Ga0105238_10181080 3300009551 Bacteria 2084
111 Ga0105238_11175378 3300009551 Bacteria 791
112 Ga0105239_11079000 3300010375 Bacteria 924
113 Ga0105246_10441043 3300011119 Bacteria 1092
114 Ga0157373_10120835 3300013100 Bacteria 1841
115 Ga0157373_10300426 3300013100 Bacteria 1139
116 Ga0157373_10333071 3300013100 Bacteria 1081
117 Ga0157373_10459211 3300013100 Bacteria 917
118 Ga0157371_10065258 3300013102 Bacteria 2578
119 Ga0157371_10420254 3300013102 Bacteria 980
120 Ga0157370_10040212 3300013104 Bacteria 4515
121 Ga0157370_10387378 3300013104 Bacteria 1287
122 Ga0157369_10013440 3300013105 Bacteria 9253
123 Ga0157369_10046538 3300013105 Bacteria 4714
124 Ga0157369_10652146 3300013105 Bacteria 1085
125 Ga0157378_10068744 3300013297 Bacteria 3176
126 Ga0157378_10419039 3300013297 Bacteria 1323
127 Ga0157378_11079704 3300013297 Bacteria 839
128 Ga0163162_10105699 3300013306 Bacteria 2909
129 Ga0157372_10007664 3300013307 Bacteria 11481
130 Ga0157375_10023990 3300013308 Bacteria 5638
131 Ga0157375_10262656 3300013308 Bacteria 1888
132 Ga0157375_10947333 3300013308 Bacteria 1003
133 Ga0157377_10293229 3300014745 Bacteria 1071
134 Ga0157379_10033652 3300014968 Bacteria 4570
135 Ga0157379_10123623 3300014968 Bacteria 2328
136 Ga0157376_10023468 3300014969 Bacteria 4827
137 Ga0163161_10524372 3300017792 Bacteria 968
138 Ga0207697_10033132 3300025315 Bacteria 2114
139 Ga0207656_10145560 3300025321 Bacteria 1119
140 Ga0207682_10004033 3300025893 Bacteria 6244
141 Ga0207688_10007755 3300025901 Bacteria 5846
142 Ga0207688_10014012 3300025901 Bacteria 4360
143 Ga0207680_10002819 3300025903 Bacteria 8141
144 Ga0207647_10019184 3300025904 Bacteria 4603
145 Ga0207647_10038029 3300025904 Bacteria 3046
146 Ga0207647_10065750 3300025904 Bacteria 2200
147 Ga0207645_10044456 3300025907 Bacteria 2842
148 Ga0207705_10020917 3300025909 Bacteria 4668
149 Ga0207705_10068893 3300025909 Bacteria 2562
150 Ga0207705_10073787 3300025909 Bacteria 2476
151 Ga0207705_10147354 3300025909 Bacteria 1762
152 Ga0207705_10311131 3300025909 Bacteria 1209
153 Ga0207654_10422574 3300025911 Bacteria 930
154 Ga0207707_10152873 3300025912 Bacteria 2018
155 Ga0207695_10022931 3300025913 Bacteria 7070
156 Ga0207660_10473192 3300025917 Bacteria 1015
157 Ga0207662_10060514 3300025918 Bacteria 2272
158 Ga0207662_10390762 3300025918 Bacteria 941
159 Ga0207657_10005081 3300025919 Bacteria 13794
160 Ga0207657_10008822 3300025919 Bacteria 10198
161 Ga0207657_10011457 3300025919 Bacteria 8804
162 Ga0207657_10073160 3300025919 Bacteria 2897
163 Ga0207657_10087941 3300025919 Bacteria 2598
164 Ga0207649_10008810 3300025920 Bacteria 5507
165 Ga0207649_10042998 3300025920 Bacteria 2759
166 Ga0207649_10060762 3300025920 Bacteria 2376
167 Ga0207649_10354793 3300025920 Bacteria 1086
168 Ga0207652_10571678 3300025921 Bacteria 1015
169 Ga0207681_10089064 3300025923 Bacteria 2199
170 Ga0207681_10228449 3300025923 Bacteria 1443
171 Ga0207694_10012746 3300025924 Bacteria 6334
172 Ga0207694_10653205 3300025924 Bacteria 886
173 Ga0207650_10020862 3300025925 Bacteria 4627
174 Ga0207650_10080546 3300025925 Bacteria 2469
175 Ga0207650_10103580 3300025925 Bacteria 2194
176 Ga0207650_10392805 3300025925 Bacteria 1147
177 Ga0207659_10043018 3300025926 Bacteria 3170
178 Ga0207659_10371682 3300025926 Bacteria 1190
179 Ga0207659_10680307 3300025926 Bacteria 880
180 Ga0207687_10066385 3300025927 Bacteria 2564
181 Ga0207700_10006481 3300025928 Bacteria 7070
182 Ga0207664_10235307 3300025929 Bacteria 1593
183 Ga0207644_10000243 3300025931 Bacteria 37412
184 Ga0207644_10000996 3300025931 Bacteria 18076
185 Ga0207644_10003062 3300025931 Bacteria 10764
186 Ga0207644_10098773 3300025931 Bacteria 2189
187 Ga0207644_10464849 3300025931 Bacteria 1040
188 Ga0207690_10014114 3300025932 Bacteria 4817
189 Ga0207690_10027770 3300025932 Bacteria 3579
190 Ga0207690_10133858 3300025932 Bacteria 1818
191 Ga0207690_10202027 3300025932 Bacteria 1510
192 Ga0207690_10339469 3300025932 Bacteria 1185
193 Ga0207690_10734429 3300025932 Bacteria 813
194 Ga0207706_10055135 3300025933 Bacteria 3506
195 Ga0207706_10281392 3300025933 Bacteria 1451
196 Ga0207706_10291901 3300025933 Bacteria 1422
197 Ga0207706_10565469 3300025933 Bacteria 978
198 Ga0207686_10056521 3300025934 Bacteria 2467
199 Ga0207709_10033135 3300025935 Bacteria 3031
200 Ga0207670_10656854 3300025936 Bacteria 865
201 Ga0207669_10035143 3300025937 Bacteria 2848
202 Ga0207669_10037728 3300025937 Bacteria 2775
203 Ga0207691_10034954 3300025940 Bacteria 4670
204 Ga0207691_10049560 3300025940 Bacteria 3848
205 Ga0207691_10299439 3300025940 Bacteria 1382
206 Ga0207691_10348806 3300025940 Bacteria 1266
207 Ga0207711_10001208 3300025941 Bacteria 24465
208 Ga0207711_10134922 3300025941 Bacteria 2216
209 Ga0207689_10092544 3300025942 Bacteria 2484
210 Ga0207689_11164037 3300025942 Bacteria 649
211 Ga0207679_10226000 3300025945 Bacteria 1577
212 Ga0207679_10589697 3300025945 Bacteria 1000
213 Ga0207679_11066134 3300025945 Bacteria 741
214 Ga0207667_10147775 3300025949 Bacteria 2419
215 Ga0207667_10363645 3300025949 Bacteria 1475
216 Ga0207667_10737664 3300025949 Bacteria 985
217 Ga0207651_10033435 3300025960 Bacteria 3317
218 Ga0207651_10354301 3300025960 Bacteria 1237
219 Ga0207668_10324481 3300025972 Bacteria 1279
220 Ga0207640_10066425 3300025981 Bacteria 2410
221 Ga0207640_10073299 3300025981 Bacteria 2313
222 Ga0207640_10075975 3300025981 Bacteria 2278
223 Ga0207640_10112280 3300025981 Bacteria 1935
224 Ga0207658_10002850 3300025986 Bacteria 12385
225 Ga0207677_10000529 3300026023 Bacteria 24143
226 Ga0207677_10253278 3300026023 Bacteria 1431
227 Ga0207703_10054235 3300026035 Bacteria 3259
228 Ga0207703_10074669 3300026035 Bacteria 2808
229 Ga0207639_10000074 3300026041 Bacteria 91671
230 Ga0207639_10068989 3300026041 Bacteria 2757
231 Ga0207639_10095153 3300026041 Bacteria 2393
232 Ga0207678_10004584 3300026067 Bacteria 12425
233 Ga0207678_10115764 3300026067 Bacteria 2287
234 Ga0207702_10029535 3300026078 Bacteria 4563
235 Ga0207702_10048049 3300026078 Bacteria 3598
236 Ga0207641_10015898 3300026088 Bacteria 6162
237 Ga0207648_10018832 3300026089 Bacteria 6240
238 Ga0207648_10028153 3300026089 Bacteria 4984
239 Ga0207676_10125781 3300026095 Bacteria 2171
240 Ga0207674_10046288 3300026116 Bacteria 4467
241 Ga0207674_10350833 3300026116 Bacteria 1426
242 Ga0207683_10004238 3300026121 Bacteria 12379
243 Ga0207683_10005095 3300026121 Bacteria 11274
244 Ga0207698_10005850 3300026142 Bacteria 7640
245 Ga0207698_10031093 3300026142 Bacteria 3849
246 Ga0207698_10076542 3300026142 Bacteria 2678
247 Ga0207698_10174569 3300026142 Bacteria 1896
248 Ga0207698_10297321 3300026142 Bacteria 1501
249 Ga0207698_10378912 3300026142 Bacteria 1345
250 Ga0207698_10417201 3300026142 Bacteria 1287
251 Ga0207698_10519556 3300026142 Bacteria 1162
252 Ga0207698_10716424 3300026142 Bacteria 997
253 Ga0268266_10004494 3300028379 Bacteria 13330
254 Ga0268266_10005157 3300028379 Bacteria 12305
255 Ga0307408_100001159 3300031548 Bacteria 20050
256 Ga0307408_100034475 3300031548 Bacteria 3546
257 Ga0307408_100474195 3300031548 Bacteria 1090
258 Ga0307405_10000240 3300031731 Bacteria 19933
259 Ga0307405_10130732 3300031731 Bacteria 1734
260 Ga0307413_10000616 3300031824 Bacteria 11983
261 Ga0307413_10006414 3300031824 Bacteria 5367
262 Ga0307413_10031914 3300031824 Bacteria 2978
263 Ga0307413_10039467 3300031824 Bacteria 2746
264 Ga0307413_10055708 3300031824 Bacteria 2407
265 Ga0307413_10729443 3300031824 Bacteria 826
266 Ga0307410_10011784 3300031852 Bacteria 5019
267 Ga0307410_10050359 3300031852 Bacteria 2800
268 Ga0307410_10051076 3300031852 Bacteria 2784
269 Ga0307410_10152802 3300031852 Bacteria 1720
270 Ga0307406_10011286 3300031901 Bacteria 5066
271 Ga0307406_10026141 3300031901 Bacteria 3502
272 Ga0307406_10490993 3300031901 Bacteria 994
273 Ga0307407_10000541 3300031903 Bacteria 11794
274 Ga0307407_10067466 3300031903 Bacteria 2114
275 Ga0307407_10317245 3300031903 Bacteria 1092
276 Ga0307407_10583080 3300031903 Bacteria 830
277 Ga0307412_10000248 3300031911 Bacteria 35008
278 Ga0307412_10172295 3300031911 Bacteria 1619
279 Ga0307409_100006369 3300031995 Bacteria 6927
280 Ga0307409_100022018 3300031995 Bacteria 4384
281 Ga0307409_100026614 3300031995 Bacteria 4082
282 Ga0307409_100248551 3300031995 Bacteria 1624
283 Ga0307416_100001974 3300032002 Bacteria 11501
284 Ga0307416_100030884 3300032002 Bacteria 4026
285 Ga0307416_100068524 3300032002 Bacteria 2932
286 Ga0307416_100350076 3300032002 Bacteria 1494
287 Ga0307414_10002750 3300032004 Bacteria 9260
288 Ga0307414_10007680 3300032004 Bacteria 6073
289 Ga0307414_10008907 3300032004 Bacteria 5731
290 Ga0307414_10029867 3300032004 Bacteria 3553
291 Ga0307414_10072633 3300032004 Bacteria 2486
292 Ga0307414_10100532 3300032004 Bacteria 2175
293 Ga0307411_10001520 3300032005 Bacteria 9552
294 Ga0307411_10003799 3300032005 Bacteria 7101
295 Ga0307411_10006791 3300032005 Bacteria 5761
296 Ga0307411_10053185 3300032005 Bacteria 2651
297 Ga0307411_10078645 3300032005 Bacteria 2261
298 Ga0307411_10147716 3300032005 Bacteria 1742
299 Ga0307411_10170135 3300032005 Bacteria 1642
300 Ga0307411_10369880 3300032005 Bacteria 1175
301 Ga0307415_100000898 3300032126 Bacteria 13619
302 Ga0307415_100003980 3300032126 Bacteria 7604
303 Ga0307415_100011268 3300032126 Bacteria 5109
304 Ga0307415_100059214 3300032126 Bacteria 2640
305 Ga0307415_100429770 3300032126 Bacteria 1136
306 Ga0307415_100779972 3300032126 Bacteria 870
307 Ga0373942_0022501 3300035207 Bacteria 1600
308 Ga0373931_0020928 3300035691 Bacteria 3277
309 Ga0373947_0139504 3300035725 Bacteria 1554
310 Ga0395899_0121342 3300037312 Bacteria 1872
311 Ga0395899_0385760 3300037312 Bacteria 930
312 Ga0395900_0005624 3300037418 Bacteria 13109
313 Ga0395900_0032789 3300037418 Bacteria 5343
314 Ga0395900_0088673 3300037418 Bacteria 3180
315 Ga0395900_0127237 3300037418 Bacteria 2612
316 Ga0395898_0005758 3300037466 Bacteria 13337
317 Ga0395898_0091759 3300037466 Bacteria 2922
318 Ga0395898_0114178 3300037466 Bacteria 2588
319 Ga0395898_0519923 3300037466 Bacteria 1131
320 Ga0395905_0000886 3300037471 Bacteria 39025
321 Ga0395905_0006839 3300037471 Bacteria 11406
322 Ga0395905_0012343 3300037471 Bacteria 8224
323 Ga0395905_0034826 3300037471 Bacteria 4728
324 Ga0395905_0173752 3300037471 Bacteria 2023
325 Ga0395905_0181349 3300037471 Bacteria 1977
326 Ga0395905_0625627 3300037471 Bacteria 978
327 Ga0395905_0925039 3300037471 Bacteria 775
328 Ga0436364_1116664 3300037853 Bacteria 977
329 Ga0395901_0019321 3300038443 Bacteria 6965
330 Ga0395901_0039825 3300038443 Bacteria 4864
331 Ga0395901_0056208 3300038443 Bacteria 4094
332 Ga0395901_0213394 3300038443 Bacteria 2019
333 Ga0395901_0304822 3300038443 Bacteria 1651
334 Ga0395901_0340516 3300038443 Bacteria 1549
335 Ga0395901_0875365 3300038443 Bacteria 882
336 Ga0451841_1126972 3300041498 Bacteria 956
337 Ga0439432_024219 3300042006 Bacteria 1996
338 Ga0439449_0023001 3300042007 Bacteria 2333
339 Ga0466972_0137500 3300044658 Bacteria 1150
340 Ga0466960_0000555 3300044901 Bacteria 12872
341 Ga0466967_0003377 3300045976 Bacteria 10396
342 Ga0466967_0210586 3300045976 Bacteria 1843
343 Ga0495654_0192260 3300046530 Bacteria 878
344 Ga0495668_0031495 3300046616 Bacteria 2988
345 Ga0495625_0274417 3300046660 Bacteria 1087
346 Ga0495669_0001738 3300046684 Bacteria 8920
347 Ga0495669_0005146 3300046684 Bacteria 5439
348 Ga0495669_0015926 3300046684 Bacteria 3219
349 Ga0495669_0037229 3300046684 Bacteria 2153
350 Ga0495669_0132381 3300046684 Bacteria 1174
351 Ga0495670_0086736 3300046691 Bacteria 1599
352 Ga0495677_0077283 3300047445 Bacteria 1245
353 Ga0495685_062657 3300047447 Bacteria 1252
354 Ga0496100_0000774 3300048903 Bacteria 15222
355 Ga0496101_0000256 3300048904 Bacteria 37912
356 Ga0496102_0080868 3300048905 Bacteria 2994
357 Ga0496103_0380749 3300048906 Bacteria 907
358 Ga0496104_0105907 3300048907 Bacteria 2695
359 Ga0496106_0009646 3300048909 Bacteria 7128
360 Ga0496107_0001584 3300048910 Bacteria 14147
361 Ga0496108_0000673 3300048911 Bacteria 26408
362 Ga0496108_0176657 3300048911 Bacteria 1849
363 Ga0496109_0011041 3300048912 Bacteria 7744
364 Ga0496109_0031197 3300048912 Bacteria 4781
365 Ga0496109_0577086 3300048912 Bacteria 1060
366 Ga0496110_0001683 3300048913 Bacteria 16224
367 Ga0496110_0222810 3300048913 Bacteria 1715
368 Ga0496111_0000247 3300048914 Bacteria 25998
369 Ga0496112_0000369 3300048915 Bacteria 29388
370 Ga0496112_0832454 3300048915 Bacteria 847
371 Ga0496113_0000242 3300048916 Bacteria 25756
372 Ga0496113_0400606 3300048916 Bacteria 1102
373 Ga0496114_0393615 3300048917 Bacteria 1227
374 Ga0501263_013909 3300049760 Bacteria 1026
375 Ga0501268_029739 3300049765 Bacteria 983

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100001159 Ga0307408_1000011596 151
2 3300031731 Ga0307405_10000240 Ga0307405_1000024019 151
3 3300031824 Ga0307413_10000616 Ga0307413_100006164 151
4 3300031901 Ga0307406_10011286 Ga0307406_100112861 151
5 3300031903 Ga0307407_10000541 Ga0307407_100005418 151
6 3300031911 Ga0307412_10000248 Ga0307412_100002488 151
7 3300031995 Ga0307409_100006369 Ga0307409_1000063699 151
8 3300032002 Ga0307416_100001974 Ga0307416_10000197410 151
9 3300032004 Ga0307414_10008907 Ga0307414_100089072 151
10 3300032005 Ga0307411_10001520 Ga0307411_100015204 151
11 3300032126 Ga0307415_100003980 Ga0307415_1000039802 151
12 3300049760 Ga0501263_013909 Ga0501263_013909_355_918 151
13 3300049765 Ga0501268_029739 Ga0501268_029739_301_864 151
14 3300038443 Ga0395901_0304822 Ga0395901_0304822_107_568 152
15 3300031824 Ga0307413_10039467 Ga0307413_100394674 156
16 3300031995 Ga0307409_100026614 Ga0307409_1000266144 156
17 3300032005 Ga0307411_10369880 Ga0307411_103698803 156
18 3300037471 Ga0395905_0925039 Ga0395905_0925039_95_667 163
19 3300005331 Ga0070670_100166362 Ga0070670_1001663622 166
20 3300005353 Ga0070669_100192769 Ga0070669_1001927691 166
21 3300005548 Ga0070665_100003344 Ga0070665_10000334411 166
22 3300025901 Ga0207688_10014012 Ga0207688_100140128 166
23 3300025923 Ga0207681_10089064 Ga0207681_100890644 166
24 3300025925 Ga0207650_10392805 Ga0207650_103928052 166
25 3300025942 Ga0207689_11164037 Ga0207689_111640371 166
26 3300028379 Ga0268266_10004494 Ga0268266_1000449411 166
27 3300005327 Ga0070658_10010002 Ga0070658_100100029 167
28 3300005366 Ga0070659_100002531 Ga0070659_10000253111 167
29 3300025932 Ga0207690_10339469 Ga0207690_103394692 167
30 3300032005 Ga0307411_10170135 Ga0307411_101701352 167
31 3300037471 Ga0395905_0181349 Ga0395905_0181349_1082_1654 167
32 3300046660 Ga0495625_0274417 Ga0495625_0274417_501_1055 167
33 3300031824 Ga0307413_10006414 Ga0307413_100064145 168
34 3300031852 Ga0307410_10050359 Ga0307410_100503592 168
35 3300031901 Ga0307406_10026141 Ga0307406_100261412 168
36 3300031903 Ga0307407_10067466 Ga0307407_100674663 168
37 3300031995 Ga0307409_100022018 Ga0307409_1000220184 168
38 3300032002 Ga0307416_100068524 Ga0307416_1000685244 168
39 3300032004 Ga0307414_10002750 Ga0307414_100027504 168
40 3300032005 Ga0307411_10003799 Ga0307411_100037995 168
41 3300032126 Ga0307415_100000898 Ga0307415_10000089811 168
42 3300026142 Ga0207698_10519556 Ga0207698_105195561 169
43 3300037418 Ga0395900_0032789 Ga0395900_0032789_2565_3131 169
44 3300037466 Ga0395898_0005758 Ga0395898_0005758_2848_3414 169
45 3300037466 Ga0395898_0091759 Ga0395898_0091759_904_1470 169
46 3300037471 Ga0395905_0000886 Ga0395905_0000886_32468_33034 169
47 3300037471 Ga0395905_0012343 Ga0395905_0012343_4633_5199 169
48 3300038443 Ga0395901_0019321 Ga0395901_0019321_2326_2892 169
49 3300045976 Ga0466967_0210586 Ga0466967_0210586_338_904 169
50 3300046530 Ga0495654_0192260 Ga0495654_0192260_112_672 169
51 3300046616 Ga0495668_0031495 Ga0495668_0031495_190_750 169
52 3300046684 Ga0495669_0001738 Ga0495669_0001738_5971_6531 169
53 3300046684 Ga0495669_0037229 Ga0495669_0037229_1079_1639 169
54 3300047447 Ga0495685_062657 Ga0495685_062657_615_1175 169
55 3300048912 Ga0496109_0577086 Ga0496109_0577086_275_853 169
56 3300005327 Ga0070658_10021514 Ga0070658_100215147 170
57 3300005327 Ga0070658_10141660 Ga0070658_101416603 170
58 3300005336 Ga0070680_100215099 Ga0070680_1002150992 170
59 3300005339 Ga0070660_100009960 Ga0070660_1000099604 170
60 3300005339 Ga0070660_100121794 Ga0070660_1001217942 170
61 3300005339 Ga0070660_100296020 Ga0070660_1002960203 170
62 3300005344 Ga0070661_100525597 Ga0070661_1005255971 170
63 3300005366 Ga0070659_100022901 Ga0070659_1000229014 170
64 3300005366 Ga0070659_100038915 Ga0070659_1000389154 170
65 3300005366 Ga0070659_100284553 Ga0070659_1002845533 170
66 3300005434 Ga0070709_10112095 Ga0070709_101120953 170
67 3300005435 Ga0070714_100144050 Ga0070714_1001440501 170
68 3300005436 Ga0070713_100019697 Ga0070713_1000196977 170
69 3300005530 Ga0070679_100365406 Ga0070679_1003654063 170
70 3300005535 Ga0070684_100443778 Ga0070684_1004437783 170
71 3300005539 Ga0068853_100014309 Ga0068853_1000143094 170
72 3300005539 Ga0068853_100027860 Ga0068853_1000278605 170
73 3300005563 Ga0068855_100312957 Ga0068855_1003129572 170
74 3300005577 Ga0068857_100034776 Ga0068857_1000347763 170
75 3300005578 Ga0068854_100096755 Ga0068854_1000967552 170
76 3300005614 Ga0068856_100054512 Ga0068856_1000545123 170
77 3300005616 Ga0068852_100002345 Ga0068852_1000023459 170
78 3300005616 Ga0068852_100036780 Ga0068852_1000367802 170
79 3300006028 Ga0070717_10006369 Ga0070717_1000636910 170
80 3300009093 Ga0105240_10072909 Ga0105240_100729093 170
81 3300009174 Ga0105241_10639529 Ga0105241_106395292 170
82 3300009545 Ga0105237_10023331 Ga0105237_100233312 170
83 3300009551 Ga0105238_10026958 Ga0105238_100269585 170
84 3300009551 Ga0105238_10181080 Ga0105238_101810802 170
85 3300013100 Ga0157373_10300426 Ga0157373_103004263 170
86 3300013100 Ga0157373_10459211 Ga0157373_104592112 170
87 3300013102 Ga0157371_10065258 Ga0157371_100652584 170
88 3300013102 Ga0157371_10420254 Ga0157371_104202542 170
89 3300013104 Ga0157370_10040212 Ga0157370_100402121 170
90 3300013104 Ga0157370_10387378 Ga0157370_103873783 170
91 3300013105 Ga0157369_10013440 Ga0157369_100134404 170
92 3300013105 Ga0157369_10046538 Ga0157369_100465382 170
93 3300013307 Ga0157372_10007664 Ga0157372_100076648 170
94 3300025904 Ga0207647_10019184 Ga0207647_100191844 170
95 3300025909 Ga0207705_10073787 Ga0207705_100737872 170
96 3300025909 Ga0207705_10147354 Ga0207705_101473542 170
97 3300025911 Ga0207654_10422574 Ga0207654_104225741 170
98 3300025912 Ga0207707_10152873 Ga0207707_101528731 170
99 3300025913 Ga0207695_10022931 Ga0207695_100229313 170
100 3300025917 Ga0207660_10473192 Ga0207660_104731922 170
101 3300025919 Ga0207657_10008822 Ga0207657_1000882210 170
102 3300025919 Ga0207657_10087941 Ga0207657_100879413 170
103 3300025920 Ga0207649_10354793 Ga0207649_103547932 170
104 3300025921 Ga0207652_10571678 Ga0207652_105716782 170
105 3300025924 Ga0207694_10012746 Ga0207694_100127468 170
106 3300025928 Ga0207700_10006481 Ga0207700_100064819 170
107 3300025929 Ga0207664_10235307 Ga0207664_102353071 170
108 3300025932 Ga0207690_10014114 Ga0207690_100141147 170
109 3300025932 Ga0207690_10027770 Ga0207690_100277704 170
110 3300025933 Ga0207706_10281392 Ga0207706_102813922 170
111 3300025949 Ga0207667_10147775 Ga0207667_101477753 170
112 3300025949 Ga0207667_10737664 Ga0207667_107376642 170
113 3300025981 Ga0207640_10066425 Ga0207640_100664253 170
114 3300026041 Ga0207639_10000074 Ga0207639_1000007468 170
115 3300026041 Ga0207639_10068989 Ga0207639_100689893 170
116 3300026078 Ga0207702_10029535 Ga0207702_100295354 170
117 3300026116 Ga0207674_10046288 Ga0207674_100462881 170
118 3300026142 Ga0207698_10005850 Ga0207698_100058506 170
119 3300026142 Ga0207698_10174569 Ga0207698_101745692 170
120 3300031548 Ga0307408_100034475 Ga0307408_1000344754 170
121 3300032004 Ga0307414_10072633 Ga0307414_100726332 170
122 3300032005 Ga0307411_10053185 Ga0307411_100531852 170
123 3300032126 Ga0307415_100059214 Ga0307415_1000592144 170
124 3300035725 Ga0373947_0139504 Ga0373947_0139504_624_1190 170
125 3300041498 Ga0451841_1126972 Ga0451841_1126972_119_754 170
126 3300046684 Ga0495669_0005146 Ga0495669_0005146_1590_2162 170
127 3300047445 Ga0495677_0077283 Ga0495677_0077283_263_835 170
128 3300005327 Ga0070658_10494654 Ga0070658_104946542 171
129 3300005344 Ga0070661_100318157 Ga0070661_1003181572 171
130 3300005547 Ga0070693_100096197 Ga0070693_1000961973 171
131 3300005616 Ga0068852_100843379 Ga0068852_1008433792 171
132 3300011119 Ga0105246_10441043 Ga0105246_104410432 171
133 3300013100 Ga0157373_10333071 Ga0157373_103330712 171
134 3300025920 Ga0207649_10060762 Ga0207649_100607623 171
135 3300025932 Ga0207690_10202027 Ga0207690_102020272 171
136 3300025949 Ga0207667_10363645 Ga0207667_103636451 171
137 3300025981 Ga0207640_10075975 Ga0207640_100759754 171
138 3300026116 Ga0207674_10350833 Ga0207674_103508332 171
139 3300026142 Ga0207698_10076542 Ga0207698_100765422 171
140 3300026142 Ga0207698_10378912 Ga0207698_103789122 171
141 3300031548 Ga0307408_100474195 Ga0307408_1004741952 171
142 3300031731 Ga0307405_10130732 Ga0307405_101307322 171
143 3300031824 Ga0307413_10031914 Ga0307413_100319143 171
144 3300031824 Ga0307413_10055708 Ga0307413_100557082 171
145 3300031824 Ga0307413_10729443 Ga0307413_107294431 171
146 3300031852 Ga0307410_10011784 Ga0307410_100117843 171
147 3300031852 Ga0307410_10152802 Ga0307410_101528023 171
148 3300031901 Ga0307406_10490993 Ga0307406_104909932 171
149 3300031903 Ga0307407_10317245 Ga0307407_103172452 171
150 3300031903 Ga0307407_10583080 Ga0307407_105830802 171
151 3300031911 Ga0307412_10172295 Ga0307412_101722952 171
152 3300031995 Ga0307409_100248551 Ga0307409_1002485513 171
153 3300032002 Ga0307416_100030884 Ga0307416_1000308843 171
154 3300032002 Ga0307416_100350076 Ga0307416_1003500762 171
155 3300032004 Ga0307414_10007680 Ga0307414_100076805 171
156 3300032004 Ga0307414_10100532 Ga0307414_101005323 171
157 3300032005 Ga0307411_10006791 Ga0307411_100067913 171
158 3300032005 Ga0307411_10147716 Ga0307411_101477162 171
159 3300032126 Ga0307415_100429770 Ga0307415_1004297702 171
160 3300032126 Ga0307415_100779972 Ga0307415_1007799722 171
161 3300042006 Ga0439432_024219 Ga0439432_024219_627_1202 171
162 3300042007 Ga0439449_0023001 Ga0439449_0023001_291_863 171
163 3300045976 Ga0466967_0003377 Ga0466967_0003377_5934_6512 171
164 3300005293 Ga0065715_10559073 Ga0065715_105590731 172
165 3300005327 Ga0070658_10130821 Ga0070658_101308213 172
166 3300005327 Ga0070658_10803999 Ga0070658_108039991 172
167 3300005333 Ga0070677_10112666 Ga0070677_101126662 172
168 3300005333 Ga0070677_10345369 Ga0070677_103453692 172
169 3300005343 Ga0070687_100395404 Ga0070687_1003954042 172
170 3300005354 Ga0070675_100133439 Ga0070675_1001334392 172
171 3300005364 Ga0070673_100331275 Ga0070673_1003312752 172
172 3300005366 Ga0070659_100212037 Ga0070659_1002120372 172
173 3300005457 Ga0070662_100135508 Ga0070662_1001355083 172
174 3300005457 Ga0070662_100218362 Ga0070662_1002183622 172
175 3300005543 Ga0070672_100028979 Ga0070672_1000289796 172
176 3300005564 Ga0070664_100049385 Ga0070664_1000493854 172
177 3300010375 Ga0105239_11079000 Ga0105239_110790002 172
178 3300013308 Ga0157375_10262656 Ga0157375_102626562 172
179 3300025315 Ga0207697_10033132 Ga0207697_100331323 172
180 3300025893 Ga0207682_10004033 Ga0207682_100040332 172
181 3300025901 Ga0207688_10007755 Ga0207688_100077553 172
182 3300025904 Ga0207647_10065750 Ga0207647_100657501 172
183 3300025909 Ga0207705_10068893 Ga0207705_100688933 172
184 3300025918 Ga0207662_10060514 Ga0207662_100605142 172
185 3300025919 Ga0207657_10011457 Ga0207657_100114576 172
186 3300025923 Ga0207681_10228449 Ga0207681_102284492 172
187 3300025925 Ga0207650_10020862 Ga0207650_100208628 172
188 3300025926 Ga0207659_10043018 Ga0207659_100430183 172
189 3300025926 Ga0207659_10371682 Ga0207659_103716822 172
190 3300025931 Ga0207644_10098773 Ga0207644_100987734 172
191 3300025932 Ga0207690_10734429 Ga0207690_107344291 172
192 3300025933 Ga0207706_10291901 Ga0207706_102919013 172
193 3300025933 Ga0207706_10565469 Ga0207706_105654692 172
194 3300025942 Ga0207689_10092544 Ga0207689_100925443 172
195 3300025945 Ga0207679_10589697 Ga0207679_105896971 172
196 3300025960 Ga0207651_10354301 Ga0207651_103543013 172
197 3300025972 Ga0207668_10324481 Ga0207668_103244811 172
198 3300026095 Ga0207676_10125781 Ga0207676_101257813 172
199 3300026142 Ga0207698_10716424 Ga0207698_107164242 172
200 3300031852 Ga0307410_10051076 Ga0307410_100510763 172
201 3300032004 Ga0307414_10029867 Ga0307414_100298673 172
202 3300032005 Ga0307411_10078645 Ga0307411_100786452 172
203 3300032126 Ga0307415_100011268 Ga0307415_1000112683 172
204 3300046684 Ga0495669_0132381 Ga0495669_0132381_41_610 172
205 3300046691 Ga0495670_0086736 Ga0495670_0086736_975_1550 172
206 3300048911 Ga0496108_0176657 Ga0496108_0176657_1012_1587 172
207 3300048912 Ga0496109_0031197 Ga0496109_0031197_2920_3495 172
208 3300048913 Ga0496110_0222810 Ga0496110_0222810_421_996 172
209 3300048916 Ga0496113_0400606 Ga0496113_0400606_246_824 172
210 3300001991 JGI24743J22301_10025438 JGI24743J22301_100254382 173
211 3300005327 Ga0070658_10106976 Ga0070658_101069762 173
212 3300005330 Ga0070690_100085132 Ga0070690_1000851323 173
213 3300005335 Ga0070666_10000753 Ga0070666_1000075320 173
214 3300005338 Ga0068868_100010090 Ga0068868_1000100905 173
215 3300005338 Ga0068868_100060483 Ga0068868_1000604833 173
216 3300005339 Ga0070660_100081437 Ga0070660_1000814374 173
217 3300005339 Ga0070660_100175983 Ga0070660_1001759832 173
218 3300005340 Ga0070689_100744087 Ga0070689_1007440872 173
219 3300005344 Ga0070661_100014342 Ga0070661_1000143426 173
220 3300005355 Ga0070671_100000051 Ga0070671_10000005126 173
221 3300005355 Ga0070671_100005658 Ga0070671_10000565810 173
222 3300005355 Ga0070671_100008324 Ga0070671_1000083249 173
223 3300005355 Ga0070671_100194639 Ga0070671_1001946393 173
224 3300005356 Ga0070674_100024211 Ga0070674_1000242113 173
225 3300005356 Ga0070674_100069104 Ga0070674_1000691043 173
226 3300005364 Ga0070673_100014605 Ga0070673_1000146055 173
227 3300005364 Ga0070673_100015936 Ga0070673_1000159362 173
228 3300005364 Ga0070673_100151353 Ga0070673_1001513533 173
229 3300005366 Ga0070659_100074719 Ga0070659_1000747192 173
230 3300005366 Ga0070659_100434452 Ga0070659_1004344522 173
231 3300005367 Ga0070667_100051318 Ga0070667_1000513185 173
232 3300005455 Ga0070663_100044873 Ga0070663_1000448733 173
233 3300005455 Ga0070663_100137020 Ga0070663_1001370202 173
234 3300005456 Ga0070678_100010816 Ga0070678_1000108166 173
235 3300005456 Ga0070678_100024271 Ga0070678_1000242717 173
236 3300005457 Ga0070662_100098921 Ga0070662_1000989212 173
237 3300005459 Ga0068867_100014664 Ga0068867_1000146645 173
238 3300005539 Ga0068853_100090936 Ga0068853_1000909363 173
239 3300005543 Ga0070672_100003732 Ga0070672_10000373211 173
240 3300005543 Ga0070672_100298997 Ga0070672_1002989971 173
241 3300005543 Ga0070672_100353163 Ga0070672_1003531632 173
242 3300005544 Ga0070686_100172835 Ga0070686_1001728352 173
243 3300005548 Ga0070665_100003837 Ga0070665_10000383715 173
244 3300005548 Ga0070665_100023061 Ga0070665_1000230616 173
245 3300005564 Ga0070664_100006520 Ga0070664_1000065202 173
246 3300005564 Ga0070664_100049398 Ga0070664_1000493983 173
247 3300005564 Ga0070664_100057237 Ga0070664_1000572374 173
248 3300005564 Ga0070664_101022493 Ga0070664_1010224932 173
249 3300005577 Ga0068857_100531470 Ga0068857_1005314702 173
250 3300005578 Ga0068854_100060782 Ga0068854_1000607823 173
251 3300005614 Ga0068856_100099312 Ga0068856_1000993124 173
252 3300005616 Ga0068852_100025103 Ga0068852_1000251033 173
253 3300005616 Ga0068852_100226919 Ga0068852_1002269192 173
254 3300005617 Ga0068859_100126409 Ga0068859_1001264092 173
255 3300005618 Ga0068864_100016194 Ga0068864_1000161945 173
256 3300005718 Ga0068866_10124162 Ga0068866_101241623 173
257 3300005834 Ga0068851_10061352 Ga0068851_100613522 173
258 3300005841 Ga0068863_100122043 Ga0068863_1001220432 173
259 3300005842 Ga0068858_100184526 Ga0068858_1001845262 173
260 3300005985 Ga0081539_10035648 Ga0081539_100356482 173
261 3300006237 Ga0097621_100001388 Ga0097621_10000138818 173
262 3300006358 Ga0068871_100006176 Ga0068871_1000061765 173
263 3300006931 Ga0097620_100126415 Ga0097620_1001264152 173
264 3300009093 Ga0105240_10725969 Ga0105240_107259692 173
265 3300009098 Ga0105245_10205399 Ga0105245_102053992 173
266 3300009148 Ga0105243_10089749 Ga0105243_100897493 173
267 3300009177 Ga0105248_10330631 Ga0105248_103306312 173
268 3300009177 Ga0105248_10427085 Ga0105248_104270852 173
269 3300009551 Ga0105238_11175378 Ga0105238_111753782 173
270 3300013100 Ga0157373_10120835 Ga0157373_101208353 173
271 3300013105 Ga0157369_10652146 Ga0157369_106521461 173
272 3300013297 Ga0157378_10068744 Ga0157378_100687441 173
273 3300013297 Ga0157378_10419039 Ga0157378_104190391 173
274 3300013297 Ga0157378_11079704 Ga0157378_110797041 173
275 3300013306 Ga0163162_10105699 Ga0163162_101056992 173
276 3300013308 Ga0157375_10023990 Ga0157375_100239909 173
277 3300013308 Ga0157375_10947333 Ga0157375_109473331 173
278 3300014745 Ga0157377_10293229 Ga0157377_102932291 173
279 3300014968 Ga0157379_10033652 Ga0157379_100336523 173
280 3300014968 Ga0157379_10123623 Ga0157379_101236232 173
281 3300014969 Ga0157376_10023468 Ga0157376_100234685 173
282 3300017792 Ga0163161_10524372 Ga0163161_105243722 173
283 3300025321 Ga0207656_10145560 Ga0207656_101455602 173
284 3300025903 Ga0207680_10002819 Ga0207680_100028197 173
285 3300025904 Ga0207647_10038029 Ga0207647_100380293 173
286 3300025907 Ga0207645_10044456 Ga0207645_100444563 173
287 3300025909 Ga0207705_10020917 Ga0207705_100209176 173
288 3300025909 Ga0207705_10311131 Ga0207705_103111312 173
289 3300025918 Ga0207662_10390762 Ga0207662_103907622 173
290 3300025919 Ga0207657_10005081 Ga0207657_100050813 173
291 3300025919 Ga0207657_10073160 Ga0207657_100731603 173
292 3300025920 Ga0207649_10008810 Ga0207649_100088105 173
293 3300025920 Ga0207649_10042998 Ga0207649_100429984 173
294 3300025924 Ga0207694_10653205 Ga0207694_106532052 173
295 3300025925 Ga0207650_10080546 Ga0207650_100805461 173
296 3300025925 Ga0207650_10103580 Ga0207650_101035803 173
297 3300025926 Ga0207659_10680307 Ga0207659_106803072 173
298 3300025927 Ga0207687_10066385 Ga0207687_100663853 173
299 3300025931 Ga0207644_10000243 Ga0207644_1000024330 173
300 3300025931 Ga0207644_10000996 Ga0207644_1000099620 173
301 3300025931 Ga0207644_10003062 Ga0207644_100030629 173
302 3300025931 Ga0207644_10464849 Ga0207644_104648492 173
303 3300025932 Ga0207690_10133858 Ga0207690_101338582 173
304 3300025933 Ga0207706_10055135 Ga0207706_100551352 173
305 3300025934 Ga0207686_10056521 Ga0207686_100565214 173
306 3300025935 Ga0207709_10033135 Ga0207709_100331354 173
307 3300025936 Ga0207670_10656854 Ga0207670_106568542 173
308 3300025937 Ga0207669_10035143 Ga0207669_100351432 173
309 3300025937 Ga0207669_10037728 Ga0207669_100377282 173
310 3300025940 Ga0207691_10034954 Ga0207691_100349545 173
311 3300025940 Ga0207691_10049560 Ga0207691_100495606 173
312 3300025940 Ga0207691_10299439 Ga0207691_102994391 173
313 3300025940 Ga0207691_10348806 Ga0207691_103488061 173
314 3300025941 Ga0207711_10001208 Ga0207711_100012083 173
315 3300025941 Ga0207711_10134922 Ga0207711_101349224 173
316 3300025945 Ga0207679_10226000 Ga0207679_102260002 173
317 3300025945 Ga0207679_11066134 Ga0207679_110661342 173
318 3300025960 Ga0207651_10033435 Ga0207651_100334353 173
319 3300025981 Ga0207640_10073299 Ga0207640_100732992 173
320 3300025981 Ga0207640_10112280 Ga0207640_101122803 173
321 3300025986 Ga0207658_10002850 Ga0207658_100028506 173
322 3300026023 Ga0207677_10000529 Ga0207677_1000052910 173
323 3300026023 Ga0207677_10253278 Ga0207677_102532782 173
324 3300026035 Ga0207703_10054235 Ga0207703_100542352 173
325 3300026035 Ga0207703_10074669 Ga0207703_100746692 173
326 3300026041 Ga0207639_10095153 Ga0207639_100951533 173
327 3300026067 Ga0207678_10004584 Ga0207678_1000458415 173
328 3300026067 Ga0207678_10115764 Ga0207678_101157643 173
329 3300026078 Ga0207702_10048049 Ga0207702_100480495 173
330 3300026088 Ga0207641_10015898 Ga0207641_100158985 173
331 3300026089 Ga0207648_10018832 Ga0207648_100188324 173
332 3300026089 Ga0207648_10028153 Ga0207648_100281534 173
333 3300026121 Ga0207683_10004238 Ga0207683_1000423812 173
334 3300026121 Ga0207683_10005095 Ga0207683_100050956 173
335 3300026142 Ga0207698_10031093 Ga0207698_100310934 173
336 3300026142 Ga0207698_10297321 Ga0207698_102973212 173
337 3300026142 Ga0207698_10417201 Ga0207698_104172011 173
338 3300028379 Ga0268266_10005157 Ga0268266_1000515715 173
339 3300035207 Ga0373942_0022501 Ga0373942_0022501_49_645 173
340 3300035691 Ga0373931_0020928 Ga0373931_0020928_1639_2217 173
341 3300037312 Ga0395899_0121342 Ga0395899_0121342_1166_1741 173
342 3300037312 Ga0395899_0385760 Ga0395899_0385760_221_796 173
343 3300037418 Ga0395900_0005624 Ga0395900_0005624_712_1287 173
344 3300037418 Ga0395900_0088673 Ga0395900_0088673_1129_1704 173
345 3300037418 Ga0395900_0127237 Ga0395900_0127237_1147_1725 173
346 3300037466 Ga0395898_0114178 Ga0395898_0114178_38_616 173
347 3300037466 Ga0395898_0519923 Ga0395898_0519923_323_898 173
348 3300037471 Ga0395905_0006839 Ga0395905_0006839_8530_9108 173
349 3300037471 Ga0395905_0034826 Ga0395905_0034826_1640_2215 173
350 3300037471 Ga0395905_0173752 Ga0395905_0173752_498_1070 173
351 3300037471 Ga0395905_0625627 Ga0395905_0625627_321_899 173
352 3300037853 Ga0436364_1116664 Ga0436364_1116664_229_801 173
353 3300038443 Ga0395901_0039825 Ga0395901_0039825_3197_3775 173
354 3300038443 Ga0395901_0056208 Ga0395901_0056208_1882_2460 173
355 3300038443 Ga0395901_0213394 Ga0395901_0213394_1388_1963 173
356 3300038443 Ga0395901_0340516 Ga0395901_0340516_322_897 173
357 3300038443 Ga0395901_0875365 Ga0395901_0875365_122_697 173
358 3300044658 Ga0466972_0137500 Ga0466972_0137500_50_625 173
359 3300044901 Ga0466960_0000555 Ga0466960_0000555_5486_6061 173
360 3300046684 Ga0495669_0015926 Ga0495669_0015926_632_1204 173
361 3300048903 Ga0496100_0000774 Ga0496100_0000774_4960_5538 173
362 3300048904 Ga0496101_0000256 Ga0496101_0000256_8901_9479 173
363 3300048905 Ga0496102_0080868 Ga0496102_0080868_1643_2221 173
364 3300048906 Ga0496103_0380749 Ga0496103_0380749_150_731 173
365 3300048907 Ga0496104_0105907 Ga0496104_0105907_967_1545 173
366 3300048909 Ga0496106_0009646 Ga0496106_0009646_4747_5325 173
367 3300048910 Ga0496107_0001584 Ga0496107_0001584_5550_6128 173
368 3300048911 Ga0496108_0000673 Ga0496108_0000673_19727_20305 173
369 3300048912 Ga0496109_0011041 Ga0496109_0011041_2584_3162 173
370 3300048913 Ga0496110_0001683 Ga0496110_0001683_8785_9363 173
371 3300048914 Ga0496111_0000247 Ga0496111_0000247_3843_4421 173
372 3300048915 Ga0496112_0000369 Ga0496112_0000369_24777_25355 173
373 3300048915 Ga0496112_0832454 Ga0496112_0832454_192_785 173
374 3300048916 Ga0496113_0000242 Ga0496113_0000242_15085_15663 173
375 3300048917 Ga0496114_0393615 Ga0496114_0393615_571_1149 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

60

178

0.93

PF13905

Thioredoxin_8

Thioredoxin-like

84

177

0.92

PF08534

Redoxin

Redoxin

59

196

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jfu-assembly1.cif.gz_A crystal structure of the soluble domain of tlpa from bradyrhizobium japonicum 0.904 22 169
4txo-assembly2.cif.gz_A crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) 0.8949 30 167
5um7-assembly1.cif.gz_A crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii 0.8749 26 165
3kcm-assembly1.cif.gz_A the crystal structure of thioredoxin protein from geobacter metallireducens 0.8738 27 165
2h1a-assembly1.cif.gz_A resa c74a variant 0.8617 29 165
ID Description Score Start End Superfamily
4txvC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9112 30 167 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8628 27 167 3.40.30.10
af_A0A1D6PSC0_375_455_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8565 46 92 3.40.30.10
3gl3B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8488 27 167 3.40.30.10
af_I6YGW6_98_222_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8462 38 163 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7G9SAA3-F1-model_v4 TlpA family protein disulfide reductase 0.9817 55 167 GO:0015036
GO:0017004
GO:0030313
AF-A0A7G9SAA3-F1-model_v4 TlpA family protein disulfide reductase 0.9564 55 167 GO:0015036
GO:0017004
GO:0030313
AF-A0A848HZZ5-F1-model_v4 TlpA family protein disulfide reductase 0.9531 22 167 GO:0015036
GO:0017004
GO:0030313
AF-A0A255Z0M9-F1-model_v4 Thioredoxin domain-containing protein 0.9281 21 167 GO:0016491
GO:0017004
AF-A0A2T4ZNI1-F1-model_v4 deleted 0.9134 22 167

Feature Viewer

pLDDT pTM Quality
88.99 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map