F427020

General Info

Members Datasets Scaffolds Average Seq Length
375 181 750 188

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10056096|Ga0105247_100560964
Length 212
Sequence MLAYVFWHWPQPVIARGAYEDHLREIQQTLAANKSIGFKQSVVFRIRGASWLNTNDEAYEEWYLLDDSAAMDPLNDAAVSGACEEPHNRVAREAADGIGGLYRLREGVEDLDQANFATWLSKPAGISYKTFYADLQSLTSQPRVALWGRQMTLGPTTEFCIHSQNPIELPPGYSGHTINLFSIYPRKSAAKLEPQPQAGNDPKPHVFVPSAP

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
161 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
162 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
163 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
164 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
165 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
166 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
167 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
168 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
169 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
170 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
171 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
174 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
175 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.4
Rhizosphere 97.07
Stem 0
Stem Tuber 0
Unclassified 26.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10056096 3300009101 Unclassified 2432
2 SwRhRL2b_contig_940246 2162886007 Bacteria 3786
3 MRS1b_contig_894375 2162886011 Bacteria 1377
4 CNAas_1000523 3300000532 Unclassified 3737
5 JGI24737J22298_10065218 3300001990 Unclassified 1091
6 JGI24751J29686_10000038 3300002459 Bacteria 80932
7 rootH1_10146683 3300003316 Bacteria 1094
8 rootL2_10300699 3300003322 Bacteria 1352
9 Ga0065714_10064462 3300005288 Bacteria 66145
10 Ga0065704_10001276 3300005289 Bacteria 8813
11 Ga0065712_10000135 3300005290 Bacteria 66145
12 Ga0065712_10215993 3300005290 Bacteria 1055
13 Ga0065712_10265688 3300005290 Bacteria 927
14 Ga0065715_10000518 3300005293 Bacteria 21761
15 Ga0065715_10003700 3300005293 Bacteria 5058
16 Ga0065715_10095497 3300005293 Bacteria 4073
17 Ga0070676_10103745 3300005328 Bacteria 1761
18 Ga0070690_100024399 3300005330 Unclassified 3717
19 Ga0070690_100395403 3300005330 Bacteria 1014
20 Ga0070670_100000073 3300005331 Bacteria 98443
21 Ga0070670_100691951 3300005331 Unclassified 916
22 Ga0068869_100027022 3300005334 Unclassified 3998
23 Ga0068869_100125852 3300005334 Bacteria 1965
24 Ga0068869_100265309 3300005334 Unclassified 1376
25 Ga0068869_100920869 3300005334 Unclassified 757
26 Ga0070666_10727011 3300005335 Unclassified 729
27 Ga0070682_100069651 3300005337 Bacteria 2247
28 Ga0070682_100665424 3300005337 Unclassified 831
29 Ga0068868_100025462 3300005338 Unclassified 4500
30 Ga0070660_100009748 3300005339 Bacteria 6769
31 Ga0070689_100092512 3300005340 Bacteria 2385
32 Ga0070687_100034615 3300005343 Bacteria 2502
33 Ga0070687_100037071 3300005343 Bacteria 2434
34 Ga0070661_100007782 3300005344 Bacteria 7395
35 Ga0070692_10010809 3300005345 Bacteria 4172
36 Ga0070692_10070159 3300005345 Unclassified 1865
37 Ga0070692_10453288 3300005345 Unclassified 821
38 Ga0070669_100861657 3300005353 Unclassified 772
39 Ga0070675_100203781 3300005354 Viruses 1717
40 Ga0070675_100502127 3300005354 Bacteria 1093
41 Ga0070671_100009104 3300005355 Bacteria 7972
42 Ga0070673_100011196 3300005364 Bacteria 6116
43 Ga0070673_100308634 3300005364 Bacteria 1395
44 Ga0070659_100006362 3300005366 Bacteria 8529
45 Ga0070667_100036105 3300005367 Unclassified 4143
46 Ga0070667_100861721 3300005367 Unclassified 842
47 Ga0070701_10021145 3300005438 Unclassified 3101
48 Ga0070701_10044310 3300005438 Bacteria 2279
49 Ga0070701_10491093 3300005438 Bacteria 795
50 Ga0070705_100118991 3300005440 Bacteria 1702
51 Ga0070705_100263459 3300005440 Bacteria 1217
52 Ga0070705_100292423 3300005440 Bacteria 1163
53 Ga0070700_100052158 3300005441 Bacteria 2549
54 Ga0070700_100282144 3300005441 Unclassified 1205
55 Ga0070694_100295824 3300005444 Bacteria 1239
56 Ga0070694_100338784 3300005444 Bacteria 1162
57 Ga0070694_100935875 3300005444 Unclassified 717
58 Ga0070678_100133789 3300005456 Bacteria 1974
59 Ga0070681_10004646 3300005458 Bacteria 13115
60 Ga0070681_10061839 3300005458 Bacteria 3719
61 Ga0068867_100110107 3300005459 Bacteria 2115
62 Ga0068867_101099975 3300005459 Unclassified 725
63 Ga0070685_10011496 3300005466 Unclassified 4633
64 Ga0070706_100000015 3300005467 Bacteria 188425
65 Ga0070707_100083424 3300005468 Bacteria 3088
66 Ga0070707_100665447 3300005468 Viruses 1004
67 Ga0070698_100008421 3300005471 Bacteria 11147
68 Ga0070698_100028005 3300005471 Bacteria 5856
69 Ga0070698_100040094 3300005471 Bacteria 4815
70 Ga0070699_100016099 3300005518 Bacteria 6419
71 Ga0070699_100257171 3300005518 Bacteria 1561
72 Ga0070679_100110587 3300005530 Bacteria 2734
73 Ga0070684_100173430 3300005535 Bacteria 1959
74 Ga0070697_100007769 3300005536 Bacteria 8351
75 Ga0070697_100084611 3300005536 Bacteria 2616
76 Ga0068853_100004345 3300005539 Bacteria 10966
77 Ga0068853_100015636 3300005539 Bacteria 6233
78 Ga0070672_100010581 3300005543 Bacteria 6403
79 Ga0070695_100020513 3300005545 Bacteria 4035
80 Ga0070695_100116683 3300005545 Bacteria 1820
81 Ga0070695_100373089 3300005545 Viruses 1075
82 Ga0070696_100227110 3300005546 Bacteria 1403
83 Ga0070696_100643711 3300005546 Unclassified 859
84 Ga0070696_100755740 3300005546 Unclassified 797
85 Ga0070696_101002690 3300005546 Unclassified 698
86 Ga0070693_100016559 3300005547 Bacteria 3818
87 Ga0070693_100097961 3300005547 Bacteria 1781
88 Ga0070693_100574328 3300005547 Unclassified 810
89 Ga0070693_100612120 3300005547 Bacteria 788
90 Ga0070693_100850411 3300005547 Bacteria 680
91 Ga0068855_100692488 3300005563 Bacteria 1091
92 Ga0070664_100002580 3300005564 Bacteria 14610
93 Ga0068857_100002670 3300005577 Bacteria 14644
94 Ga0068857_100074019 3300005577 Bacteria 3036
95 Ga0068857_100145552 3300005577 Bacteria 2144
96 Ga0068857_100183307 3300005577 Bacteria 1905
97 Ga0068857_100255342 3300005577 Bacteria 1608
98 Ga0068854_100084513 3300005578 Bacteria 2349
99 Ga0068854_100346955 3300005578 Bacteria 1214
100 Ga0068854_100601440 3300005578 Bacteria 939
101 Ga0070702_100019928 3300005615 Unclassified 3506
102 Ga0070702_100509148 3300005615 Unclassified 886
103 Ga0070702_100629077 3300005615 Unclassified 809
104 Ga0068852_100333855 3300005616 Bacteria 1476
105 Ga0068852_100480298 3300005616 Bacteria 1235
106 Ga0068859_100036108 3300005617 Unclassified 4960
107 Ga0068859_100043033 3300005617 Bacteria 4538
108 Ga0068859_100131924 3300005617 Bacteria 2570
109 Ga0068859_100169577 3300005617 Bacteria 2263
110 Ga0068859_100199686 3300005617 Bacteria 2084
111 Ga0068859_100292351 3300005617 Bacteria 1722
112 Ga0068859_100302854 3300005617 Unclassified 1692
113 Ga0068859_100407746 3300005617 Bacteria 1455
114 Ga0068859_100430022 3300005617 Bacteria 1416
115 Ga0068859_101318141 3300005617 Bacteria 796
116 Ga0068864_100009825 3300005618 Bacteria 7890
117 Ga0068864_100130076 3300005618 Unclassified 2260
118 Ga0068864_100203585 3300005618 Bacteria 1819
119 Ga0068864_100326583 3300005618 Bacteria 1442
120 Ga0068866_10005031 3300005718 Bacteria 5442
121 Ga0068861_100022748 3300005719 Bacteria 4520
122 Ga0068861_100536530 3300005719 Bacteria 1064
123 Ga0068870_10139923 3300005840 Bacteria 1415
124 Ga0068870_10263039 3300005840 Bacteria 1074
125 Ga0068863_100064324 3300005841 Unclassified 3469
126 Ga0068863_100095443 3300005841 Bacteria 2822
127 Ga0068863_100201765 3300005841 Unclassified 1913
128 Ga0068863_100391015 3300005841 Bacteria 1359
129 Ga0068858_100069609 3300005842 Bacteria 3262
130 Ga0068858_100130917 3300005842 Bacteria 2352
131 Ga0068858_100785698 3300005842 Unclassified 928
132 Ga0068858_100870007 3300005842 Bacteria 881
133 Ga0068860_100025300 3300005843 Bacteria 5729
134 Ga0068860_100078184 3300005843 Unclassified 3147
135 Ga0068860_100078315 3300005843 Bacteria 3143
136 Ga0068860_100261260 3300005843 Unclassified 1688
137 Ga0081539_10000487 3300005985 Bacteria 83994
138 Ga0081539_10003495 3300005985 Bacteria 19198
139 Ga0081539_10147958 3300005985 Bacteria 1133
140 Ga0070716_100095989 3300006173 Bacteria 1806
141 Ga0070712_100289844 3300006175 Bacteria 1321
142 Ga0097621_100001343 3300006237 Bacteria 16907
143 Ga0097621_100019601 3300006237 Bacteria 5196
144 Ga0068871_100007860 3300006358 Bacteria 7641
145 Ga0068871_100047482 3300006358 Unclassified 3463
146 Ga0068871_100331421 3300006358 Bacteria 1342
147 Ga0075430_100246819 3300006846 Unclassified 1479
148 Ga0075433_10268981 3300006852 Bacteria 1510
149 Ga0075429_100099180 3300006880 Unclassified 2541
150 Ga0068865_100101354 3300006881 Unclassified 2108
151 Ga0075436_100023126 3300006914 Bacteria 4269
152 Ga0097620_100036109 3300006931 Unclassified 4960
153 Ga0097620_100043031 3300006931 Bacteria 4538
154 Ga0097620_100131916 3300006931 Bacteria 2570
155 Ga0097620_100169574 3300006931 Bacteria 2263
156 Ga0097620_100199694 3300006931 Bacteria 2084
157 Ga0097620_100292353 3300006931 Bacteria 1722
158 Ga0097620_100302865 3300006931 Unclassified 1692
159 Ga0097620_100407731 3300006931 Bacteria 1455
160 Ga0097620_100430029 3300006931 Bacteria 1416
161 Ga0097620_101318045 3300006931 Bacteria 796
162 Ga0075435_100006392 3300007076 Bacteria 8330
163 Ga0105251_10177299 3300009011 Bacteria 960
164 Ga0111539_10006562 3300009094 Bacteria 14995
165 Ga0105245_10266389 3300009098 Viruses 1669
166 Ga0105245_10720712 3300009098 Bacteria 1032
167 Ga0105247_10037314 3300009101 Bacteria 2965
168 Ga0105247_10445279 3300009101 Unclassified 932
169 Ga0114129_10637750 3300009147 Bacteria 1376
170 Ga0114129_10659711 3300009147 Bacteria 1349
171 Ga0114129_10738744 3300009147 Bacteria 1261
172 Ga0114129_10897947 3300009147 Bacteria 1123
173 Ga0105243_10001952 3300009148 Bacteria 17560
174 Ga0105243_10155802 3300009148 Bacteria 1964
175 Ga0105243_10926131 3300009148 Unclassified 869
176 Ga0105243_11329366 3300009148 Unclassified 737
177 Ga0105243_11356216 3300009148 Bacteria 730
178 Ga0105241_10019131 3300009174 Bacteria 5050
179 Ga0105241_10020033 3300009174 Bacteria 4940
180 Ga0105241_10056913 3300009174 Bacteria 2998
181 Ga0105241_10120961 3300009174 Bacteria 2108
182 Ga0105241_10159871 3300009174 Bacteria 1851
183 Ga0105241_10164511 3300009174 Bacteria 1827
184 Ga0105241_10204147 3300009174 Bacteria 1652
185 Ga0105241_10230483 3300009174 Bacteria 1561
186 Ga0105241_10357162 3300009174 Bacteria 1270
187 Ga0105241_10464856 3300009174 Unclassified 1121
188 Ga0105241_10617513 3300009174 Unclassified 981
189 Ga0105242_10033566 3300009176 Unclassified 4110
190 Ga0105242_10056575 3300009176 Bacteria 3210
191 Ga0105248_10109993 3300009177 Bacteria 3107
192 Ga0105248_10111760 3300009177 Unclassified 3081
193 Ga0105248_10256935 3300009177 Bacteria 1967
194 Ga0105248_10382956 3300009177 Bacteria 1584
195 Ga0105248_10499928 3300009177 Bacteria 1371
196 Ga0105248_10745966 3300009177 Bacteria 1105
197 Ga0105248_10757417 3300009177 Bacteria 1096
198 Ga0105248_10914206 3300009177 Unclassified 991
199 Ga0105238_10002642 3300009551 Bacteria 17857
200 Ga0105238_10006395 3300009551 Bacteria 11722
201 Ga0105238_11009656 3300009551 Unclassified 853
202 Ga0105249_10012618 3300009553 Bacteria 7450
203 Ga0105249_11062101 3300009553 Unclassified 879
204 Ga0105249_11283847 3300009553 Unclassified 804
205 Ga0105239_10598710 3300010375 Unclassified 1257
206 Ga0105239_10755319 3300010375 Unclassified 1113
207 Ga0105239_11617773 3300010375 Bacteria 749
208 Ga0105246_10193766 3300011119 Bacteria 1575
209 Ga0105246_10221590 3300011119 Bacteria 1483
210 Ga0105246_10232892 3300011119 Bacteria 1451
211 Ga0105246_11100839 3300011119 Unclassified 725
212 Ga0157373_10006338 3300013100 Bacteria 8839
213 Ga0157374_10032330 3300013296 Unclassified 4762
214 Ga0157378_11173410 3300013297 Unclassified 807
215 Ga0163162_10010879 3300013306 Bacteria 8856
216 Ga0163162_10053986 3300013306 Bacteria 4040
217 Ga0163162_10246965 3300013306 Bacteria 1916
218 Ga0157372_10195691 3300013307 Bacteria 2342
219 Ga0157372_10845446 3300013307 Bacteria 1062
220 Ga0157375_10115459 3300013308 Unclassified 2787
221 Ga0157375_11082788 3300013308 Unclassified 938
222 Ga0163163_10000466 3300014325 Bacteria 36943
223 Ga0163163_10068892 3300014325 Bacteria 3522
224 Ga0163163_10072427 3300014325 Bacteria 3435
225 Ga0163163_10245294 3300014325 Bacteria 1841
226 Ga0163163_10469592 3300014325 Bacteria 1319
227 Ga0163163_10681724 3300014325 Unclassified 1091
228 Ga0157380_10412769 3300014326 Bacteria 1285
229 Ga0157380_10464895 3300014326 Bacteria 1219
230 Ga0157380_11295219 3300014326 Bacteria 776
231 Ga0157377_10538937 3300014745 Unclassified 822
232 Ga0157379_10058845 3300014968 Bacteria 3436
233 Ga0157379_10264830 3300014968 Bacteria 1562
234 Ga0157376_10075065 3300014969 Unclassified 2884
235 Ga0163161_10006702 3300017792 Bacteria 7968
236 Ga0163161_10587877 3300017792 Unclassified 916
237 Ga0207642_10011495 3300025899 Unclassified 3161
238 Ga0207710_10000389 3300025900 Bacteria 29876
239 Ga0207680_10649386 3300025903 Unclassified 755
240 Ga0207647_10003482 3300025904 Bacteria 11800
241 Ga0207647_10055240 3300025904 Bacteria 2441
242 Ga0207647_10203129 3300025904 Bacteria 1146
243 Ga0207643_10038551 3300025908 Bacteria 2684
244 Ga0207643_10152622 3300025908 Bacteria 1385
245 Ga0207684_10000083 3300025910 Bacteria 176092
246 Ga0207654_10034685 3300025911 Archaea 2805
247 Ga0207654_10062482 3300025911 Bacteria 2182
248 Ga0207654_10091567 3300025911 Bacteria 1855
249 Ga0207654_10149595 3300025911 Bacteria 1497
250 Ga0207654_10481487 3300025911 Unclassified 874
251 Ga0207707_10015795 3300025912 Bacteria 6582
252 Ga0207707_10140489 3300025912 Bacteria 2112
253 Ga0207693_10544984 3300025915 Bacteria 905
254 Ga0207660_10011883 3300025917 Bacteria 5679
255 Ga0207662_10021871 3300025918 Unclassified 3660
256 Ga0207662_10276765 3300025918 Unclassified 1109
257 Ga0207662_10386680 3300025918 Bacteria 946
258 Ga0207657_10021188 3300025919 Bacteria 6123
259 Ga0207649_10034811 3300025920 Bacteria 3021
260 Ga0207652_10052074 3300025921 Bacteria 3512
261 Ga0207646_10023701 3300025922 Bacteria 5634
262 Ga0207694_10003054 3300025924 Bacteria 13422
263 Ga0207694_10023376 3300025924 Bacteria 4691
264 Ga0207650_10000006 3300025925 Bacteria 544730
265 Ga0207650_10613089 3300025925 Unclassified 916
266 Ga0207687_10032505 3300025927 Unclassified 3534
267 Ga0207644_10960422 3300025931 Bacteria 717
268 Ga0207690_10004343 3300025932 Bacteria 8374
269 Ga0207706_10729208 3300025933 Unclassified 845
270 Ga0207686_10023163 3300025934 Unclassified 3583
271 Ga0207709_10180855 3300025935 Bacteria 1489
272 Ga0207709_10390926 3300025935 Bacteria 1061
273 Ga0207670_10067094 3300025936 Unclassified 2467
274 Ga0207670_10976409 3300025936 Bacteria 712
275 Ga0207670_11407143 3300025936 Bacteria 592
276 Ga0207665_10126545 3300025939 Bacteria 1810
277 Ga0207665_10158941 3300025939 Bacteria 1624
278 Ga0207691_10003837 3300025940 Bacteria 14582
279 Ga0207711_10028460 3300025941 Bacteria 4702
280 Ga0207711_10046400 3300025941 Bacteria 3712
281 Ga0207711_10164065 3300025941 Bacteria 2013
282 Ga0207711_10616774 3300025941 Unclassified 1012
283 Ga0207689_10002536 3300025942 Bacteria 16961
284 Ga0207689_10636480 3300025942 Unclassified 898
285 Ga0207689_10692013 3300025942 Unclassified 860
286 Ga0207679_10005396 3300025945 Bacteria 8007
287 Ga0207679_10351848 3300025945 Unclassified 1284
288 Ga0207679_10750506 3300025945 Bacteria 888
289 Ga0207679_11162372 3300025945 Bacteria 708
290 Ga0207667_10930724 3300025949 Unclassified 860
291 Ga0207651_10121347 3300025960 Unclassified 1983
292 Ga0207651_10428543 3300025960 Unclassified 1131
293 Ga0207712_10085159 3300025961 Unclassified 2312
294 Ga0207712_10253553 3300025961 Bacteria 1424
295 Ga0207640_10086220 3300025981 Bacteria 2161
296 Ga0207640_10229194 3300025981 Unclassified 1428
297 Ga0207658_10168188 3300025986 Viruses 1803
298 Ga0207703_10194705 3300026035 Bacteria 1798
299 Ga0207703_10216807 3300026035 Bacteria 1709
300 Ga0207703_10252079 3300026035 Bacteria 1591
301 Ga0207639_10050710 3300026041 Bacteria 3153
302 Ga0207639_11101221 3300026041 Unclassified 745
303 Ga0207678_10664889 3300026067 Unclassified 915
304 Ga0207708_10005449 3300026075 Bacteria 9387
305 Ga0207708_10052094 3300026075 Unclassified 3117
306 Ga0207641_10019825 3300026088 Bacteria 5520
307 Ga0207641_10340832 3300026088 Bacteria 1426
308 Ga0207641_10543358 3300026088 Unclassified 1132
309 Ga0207641_10653733 3300026088 Unclassified 1033
310 Ga0207641_10702478 3300026088 Bacteria 996
311 Ga0207648_10027694 3300026089 Bacteria 5029
312 Ga0207676_10106413 3300026095 Bacteria 2337
313 Ga0207676_10635697 3300026095 Bacteria 1028
314 Ga0207676_11119174 3300026095 Viruses 779
315 Ga0207676_11493936 3300026095 Unclassified 672
316 Ga0207674_10000834 3300026116 Bacteria 40210
317 Ga0207674_10094378 3300026116 Bacteria 2978
318 Ga0207674_10108705 3300026116 Bacteria 2749
319 Ga0207674_10137607 3300026116 Bacteria 2403
320 Ga0207674_10143423 3300026116 Bacteria 2347
321 Ga0207675_100003117 3300026118 Bacteria 16262
322 Ga0207675_100012658 3300026118 Bacteria 7882
323 Ga0207675_100056048 3300026118 Bacteria 3677
324 Ga0207683_10076298 3300026121 Bacteria 2967
325 Ga0207698_10273813 3300026142 Bacteria 1558
326 Ga0207698_10437371 3300026142 Bacteria 1259
327 Ga0268264_10024961 3300028381 Bacteria 4885
328 Ga0268264_10351372 3300028381 Bacteria 1403
329 Ga0268264_10402928 3300028381 Bacteria 1315
330 Ga0268264_10563026 3300028381 Bacteria 1119
331 Ga0307408_100060825 3300031548 Bacteria 2755
332 Ga0307405_10108707 3300031731 Bacteria 1874
333 Ga0307413_10572716 3300031824 Unclassified 920
334 Ga0307415_100462485 3300032126 Unclassified 1100
335 Ga0373951_0003140 3300035091 Bacteria 4071
336 Ga0373941_0056573 3300035115 Bacteria 1264
337 Ga0495672_0393005 3300047320 Unclassified 636
338 Ga0496106_0019735 3300048909 Bacteria 5000
339 Ga0496106_0241732 3300048909 Bacteria 1442
340 Ga0496107_0481082 3300048910 Unclassified 921
341 Ga0496108_0084660 3300048911 Bacteria 2691
342 Ga0496108_0561015 3300048911 Bacteria 996
343 Ga0496110_1230864 3300048913 Unclassified 658
344 Ga0496112_0083049 3300048915 Bacteria 3168
345 Ga0496112_0388905 3300048915 Bacteria 1335
346 Ga0496113_0073686 3300048916 Bacteria 2602
347 Ga0501291_016133 3300049514 Bacteria 1137
348 Ga0501291_030244 3300049514 Unclassified 910
349 Ga0501296_003095 3300049519 Bacteria 1766
350 Ga0501298_005523 3300049521 Bacteria 2034
351 Ga0501299_027363 3300049522 Bacteria 1081
352 Ga0501198_011907 3300049649 Bacteria 1303
353 Ga0501206_004697 3300049653 Bacteria 1746
354 Ga0501216_009683 3300049660 Bacteria 1540
355 Ga0501223_022420 3300049663 Bacteria 1233
356 Ga0501227_044265 3300049665 Bacteria 1108
357 Ga0501235_002210 3300049669 Bacteria 4186
358 Ga0501235_004935 3300049669 Bacteria 2892
359 Ga0501243_007436 3300049675 Bacteria 1674
360 Ga0501221_038922 3300049704 Bacteria 1029
361 Ga0501225_0008102 3300049705 Bacteria 3023
362 Ga0501225_0081878 3300049705 Unclassified 927
363 Ga0501271_002907 3300049768 Bacteria 1557
364 Ga0501272_007435 3300049769 Bacteria 1187
365 Ga0501283_001695 3300049779 Bacteria 2866
366 Ga0501283_083362 3300049779 Unclassified 604
367 nmdc:mga09592_500070_c1 3300050508 Bacteria 1047
368 nmdc:mga06r32_1415716_c1 3300050510 Unclassified 637
369 nmdc:mga06r32_454686_c1 3300050510 Bacteria 1260
370 nmdc:mga08y16_23581_c1 3300050511 Bacteria 6500
371 nmdc:mga0n895_586365_c1 3300050512 Bacteria 1118
372 nmdc:mga08x19_7479_c1 3300050514 Bacteria 6488
373 nmdc:mga0a205_21072_c1 3300050515 Bacteria 6163
374 nmdc:mga0a205_312475_c1 3300050515 Bacteria 1443
375 nmdc:mga0a205_315908_c1 3300050515 Bacteria 1434
376 Ga0105247_10056096
377 SwRhRL2b_contig_940246
378 MRS1b_contig_894375
379 CNAas_1000523
380 JGI24737J22298_10065218
381 JGI24751J29686_10000038
382 rootH1_10146683
383 rootL2_10300699
384 Ga0065714_10064462
385 Ga0065704_10001276
386 Ga0065712_10000135
387 Ga0065712_10215993
388 Ga0065712_10265688
389 Ga0065715_10000518
390 Ga0065715_10003700
391 Ga0065715_10095497
392 Ga0070676_10103745
393 Ga0070690_100024399
394 Ga0070690_100395403
395 Ga0070670_100000073
396 Ga0070670_100691951
397 Ga0068869_100027022
398 Ga0068869_100125852
399 Ga0068869_100265309
400 Ga0068869_100920869
401 Ga0070666_10727011
402 Ga0070682_100069651
403 Ga0070682_100665424
404 Ga0068868_100025462
405 Ga0070660_100009748
406 Ga0070689_100092512
407 Ga0070687_100034615
408 Ga0070687_100037071
409 Ga0070661_100007782
410 Ga0070692_10010809
411 Ga0070692_10070159
412 Ga0070692_10453288
413 Ga0070669_100861657
414 Ga0070675_100203781
415 Ga0070675_100502127
416 Ga0070671_100009104
417 Ga0070673_100011196
418 Ga0070673_100308634
419 Ga0070659_100006362
420 Ga0070667_100036105
421 Ga0070667_100861721
422 Ga0070701_10021145
423 Ga0070701_10044310
424 Ga0070701_10491093
425 Ga0070705_100118991
426 Ga0070705_100263459
427 Ga0070705_100292423
428 Ga0070700_100052158
429 Ga0070700_100282144
430 Ga0070694_100295824
431 Ga0070694_100338784
432 Ga0070694_100935875
433 Ga0070678_100133789
434 Ga0070681_10004646
435 Ga0070681_10061839
436 Ga0068867_100110107
437 Ga0068867_101099975
438 Ga0070685_10011496
439 Ga0070706_100000015
440 Ga0070707_100083424
441 Ga0070707_100665447
442 Ga0070698_100008421
443 Ga0070698_100028005
444 Ga0070698_100040094
445 Ga0070699_100016099
446 Ga0070699_100257171
447 Ga0070679_100110587
448 Ga0070684_100173430
449 Ga0070697_100007769
450 Ga0070697_100084611
451 Ga0068853_100004345
452 Ga0068853_100015636
453 Ga0070672_100010581
454 Ga0070695_100020513
455 Ga0070695_100116683
456 Ga0070695_100373089
457 Ga0070696_100227110
458 Ga0070696_100643711
459 Ga0070696_100755740
460 Ga0070696_101002690
461 Ga0070693_100016559
462 Ga0070693_100097961
463 Ga0070693_100574328
464 Ga0070693_100612120
465 Ga0070693_100850411
466 Ga0068855_100692488
467 Ga0070664_100002580
468 Ga0068857_100002670
469 Ga0068857_100074019
470 Ga0068857_100145552
471 Ga0068857_100183307
472 Ga0068857_100255342
473 Ga0068854_100084513
474 Ga0068854_100346955
475 Ga0068854_100601440
476 Ga0070702_100019928
477 Ga0070702_100509148
478 Ga0070702_100629077
479 Ga0068852_100333855
480 Ga0068852_100480298
481 Ga0068859_100036108
482 Ga0068859_100043033
483 Ga0068859_100131924
484 Ga0068859_100169577
485 Ga0068859_100199686
486 Ga0068859_100292351
487 Ga0068859_100302854
488 Ga0068859_100407746
489 Ga0068859_100430022
490 Ga0068859_101318141
491 Ga0068864_100009825
492 Ga0068864_100130076
493 Ga0068864_100203585
494 Ga0068864_100326583
495 Ga0068866_10005031
496 Ga0068861_100022748
497 Ga0068861_100536530
498 Ga0068870_10139923
499 Ga0068870_10263039
500 Ga0068863_100064324
501 Ga0068863_100095443
502 Ga0068863_100201765
503 Ga0068863_100391015
504 Ga0068858_100069609
505 Ga0068858_100130917
506 Ga0068858_100785698
507 Ga0068858_100870007
508 Ga0068860_100025300
509 Ga0068860_100078184
510 Ga0068860_100078315
511 Ga0068860_100261260
512 Ga0081539_10000487
513 Ga0081539_10003495
514 Ga0081539_10147958
515 Ga0070716_100095989
516 Ga0070712_100289844
517 Ga0097621_100001343
518 Ga0097621_100019601
519 Ga0068871_100007860
520 Ga0068871_100047482
521 Ga0068871_100331421
522 Ga0075430_100246819
523 Ga0075433_10268981
524 Ga0075429_100099180
525 Ga0068865_100101354
526 Ga0075436_100023126
527 Ga0097620_100036109
528 Ga0097620_100043031
529 Ga0097620_100131916
530 Ga0097620_100169574
531 Ga0097620_100199694
532 Ga0097620_100292353
533 Ga0097620_100302865
534 Ga0097620_100407731
535 Ga0097620_100430029
536 Ga0097620_101318045
537 Ga0075435_100006392
538 Ga0105251_10177299
539 Ga0111539_10006562
540 Ga0105245_10266389
541 Ga0105245_10720712
542 Ga0105247_10037314
543 Ga0105247_10445279
544 Ga0114129_10637750
545 Ga0114129_10659711
546 Ga0114129_10738744
547 Ga0114129_10897947
548 Ga0105243_10001952
549 Ga0105243_10155802
550 Ga0105243_10926131
551 Ga0105243_11329366
552 Ga0105243_11356216
553 Ga0105241_10019131
554 Ga0105241_10020033
555 Ga0105241_10056913
556 Ga0105241_10120961
557 Ga0105241_10159871
558 Ga0105241_10164511
559 Ga0105241_10204147
560 Ga0105241_10230483
561 Ga0105241_10357162
562 Ga0105241_10464856
563 Ga0105241_10617513
564 Ga0105242_10033566
565 Ga0105242_10056575
566 Ga0105248_10109993
567 Ga0105248_10111760
568 Ga0105248_10256935
569 Ga0105248_10382956
570 Ga0105248_10499928
571 Ga0105248_10745966
572 Ga0105248_10757417
573 Ga0105248_10914206
574 Ga0105238_10002642
575 Ga0105238_10006395
576 Ga0105238_11009656
577 Ga0105249_10012618
578 Ga0105249_11062101
579 Ga0105249_11283847
580 Ga0105239_10598710
581 Ga0105239_10755319
582 Ga0105239_11617773
583 Ga0105246_10193766
584 Ga0105246_10221590
585 Ga0105246_10232892
586 Ga0105246_11100839
587 Ga0157373_10006338
588 Ga0157374_10032330
589 Ga0157378_11173410
590 Ga0163162_10010879
591 Ga0163162_10053986
592 Ga0163162_10246965
593 Ga0157372_10195691
594 Ga0157372_10845446
595 Ga0157375_10115459
596 Ga0157375_11082788
597 Ga0163163_10000466
598 Ga0163163_10068892
599 Ga0163163_10072427
600 Ga0163163_10245294
601 Ga0163163_10469592
602 Ga0163163_10681724
603 Ga0157380_10412769
604 Ga0157380_10464895
605 Ga0157380_11295219
606 Ga0157377_10538937
607 Ga0157379_10058845
608 Ga0157379_10264830
609 Ga0157376_10075065
610 Ga0163161_10006702
611 Ga0163161_10587877
612 Ga0207642_10011495
613 Ga0207710_10000389
614 Ga0207680_10649386
615 Ga0207647_10003482
616 Ga0207647_10055240
617 Ga0207647_10203129
618 Ga0207643_10038551
619 Ga0207643_10152622
620 Ga0207684_10000083
621 Ga0207654_10034685
622 Ga0207654_10062482
623 Ga0207654_10091567
624 Ga0207654_10149595
625 Ga0207654_10481487
626 Ga0207707_10015795
627 Ga0207707_10140489
628 Ga0207693_10544984
629 Ga0207660_10011883
630 Ga0207662_10021871
631 Ga0207662_10276765
632 Ga0207662_10386680
633 Ga0207657_10021188
634 Ga0207649_10034811
635 Ga0207652_10052074
636 Ga0207646_10023701
637 Ga0207694_10003054
638 Ga0207694_10023376
639 Ga0207650_10000006
640 Ga0207650_10613089
641 Ga0207687_10032505
642 Ga0207644_10960422
643 Ga0207690_10004343
644 Ga0207706_10729208
645 Ga0207686_10023163
646 Ga0207709_10180855
647 Ga0207709_10390926
648 Ga0207670_10067094
649 Ga0207670_10976409
650 Ga0207670_11407143
651 Ga0207665_10126545
652 Ga0207665_10158941
653 Ga0207691_10003837
654 Ga0207711_10028460
655 Ga0207711_10046400
656 Ga0207711_10164065
657 Ga0207711_10616774
658 Ga0207689_10002536
659 Ga0207689_10636480
660 Ga0207689_10692013
661 Ga0207679_10005396
662 Ga0207679_10351848
663 Ga0207679_10750506
664 Ga0207679_11162372
665 Ga0207667_10930724
666 Ga0207651_10121347
667 Ga0207651_10428543
668 Ga0207712_10085159
669 Ga0207712_10253553
670 Ga0207640_10086220
671 Ga0207640_10229194
672 Ga0207658_10168188
673 Ga0207703_10194705
674 Ga0207703_10216807
675 Ga0207703_10252079
676 Ga0207639_10050710
677 Ga0207639_11101221
678 Ga0207678_10664889
679 Ga0207708_10005449
680 Ga0207708_10052094
681 Ga0207641_10019825
682 Ga0207641_10340832
683 Ga0207641_10543358
684 Ga0207641_10653733
685 Ga0207641_10702478
686 Ga0207648_10027694
687 Ga0207676_10106413
688 Ga0207676_10635697
689 Ga0207676_11119174
690 Ga0207676_11493936
691 Ga0207674_10000834
692 Ga0207674_10094378
693 Ga0207674_10108705
694 Ga0207674_10137607
695 Ga0207674_10143423
696 Ga0207675_100003117
697 Ga0207675_100012658
698 Ga0207675_100056048
699 Ga0207683_10076298
700 Ga0207698_10273813
701 Ga0207698_10437371
702 Ga0268264_10024961
703 Ga0268264_10351372
704 Ga0268264_10402928
705 Ga0268264_10563026
706 Ga0307408_100060825
707 Ga0307405_10108707
708 Ga0307413_10572716
709 Ga0307415_100462485
710 Ga0373951_0003140
711 Ga0373941_0056573
712 Ga0495672_0393005
713 Ga0496106_0019735
714 Ga0496106_0241732
715 Ga0496107_0481082
716 Ga0496108_0084660
717 Ga0496108_0561015
718 Ga0496110_1230864
719 Ga0496112_0083049
720 Ga0496112_0388905
721 Ga0496113_0073686
722 Ga0501291_016133
723 Ga0501291_030244
724 Ga0501296_003095
725 Ga0501298_005523
726 Ga0501299_027363
727 Ga0501198_011907
728 Ga0501206_004697
729 Ga0501216_009683
730 Ga0501223_022420
731 Ga0501227_044265
732 Ga0501235_002210
733 Ga0501235_004935
734 Ga0501243_007436
735 Ga0501221_038922
736 Ga0501225_0008102
737 Ga0501225_0081878
738 Ga0501271_002907
739 Ga0501272_007435
740 Ga0501283_001695
741 Ga0501283_083362
742 nmdc:mga09592_500070_c1
743 nmdc:mga06r32_1415716_c1
744 nmdc:mga06r32_454686_c1
745 nmdc:mga08y16_23581_c1
746 nmdc:mga0n895_586365_c1
747 nmdc:mga08x19_7479_c1
748 nmdc:mga0a205_21072_c1
749 nmdc:mga0a205_312475_c1
750 nmdc:mga0a205_315908_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b0c-assembly1.cif.gz_B polyketide cyclase oac from cannabis sativa, y27f mutant 0.7646 1 106
5b0d-assembly1.cif.gz_A polyketide cyclase oac from cannabis sativa, y27w mutant 0.7617 1 106
5b0c-assembly1.cif.gz_B polyketide cyclase oac from cannabis sativa, y27f mutant 0.7581 1 106
5b0d-assembly1.cif.gz_A polyketide cyclase oac from cannabis sativa, y27w mutant 0.7553 1 106
3kng-assembly1.cif.gz_B crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution 0.75 2 110
ID Description Score Start End Superfamily
af_Q9VXK0_45_165_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7822 2 101 3.30.70.100
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.779 2 101 3.30.70.100
af_A0A0R0GC68_3_111_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7593 2 101 3.30.70.100
3gz7B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7554 2 101 3.30.70.100
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.749 1 109 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A402AQZ7-F1-model_v4 Uncharacterized protein 0.9634 1 138
AF-A0A538TV13-F1-model_v4 Uncharacterized protein 0.9561 1 185
AF-A0A536NNL0-F1-model_v4 ABM domain-containing protein 0.955 1 182
AF-A0A524Q7I5-F1-model_v4 Uncharacterized protein 0.9542 1 184
AF-A0A7Y5K8F1-F1-model_v4 Uncharacterized protein 0.9506 1 184

Map