F426970

General Info

Members Datasets Scaffolds Average Seq Length
375 213 750 188

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100251868|Ga0070684_1002518681
Length 187
Sequence VGFARRIYIGSTMAASNSTLLDARAVDRTLRRMADEILEKNDGTDDLVIVGIQRRGVQLAARIVSSISEREGVKIPSGALDITLYRDDLQTVGPRPVVGPTDIPIDIEGKVVVIVDDVLYTGRTIRAALDELADFAVLIDRGGRELPIQPDVVGKVVSVPAGHRVDVFVKELDDKDAVILAPKEQAP

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
194 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.33
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.07
Rhizosphere 98.67
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100251868 3300005535 Bacteria 1614
2 Ga0070658_10068297 3300005327 Bacteria 2905
3 Ga0070658_10120493 3300005327 Bacteria 2180
4 Ga0070658_10153026 3300005327 Bacteria 1932
5 Ga0070683_100001680 3300005329 Bacteria 17190
6 Ga0070683_100025049 3300005329 Bacteria 5353
7 Ga0070683_100026298 3300005329 Bacteria 5238
8 Ga0070683_100030598 3300005329 Bacteria 4889
9 Ga0070683_100057967 3300005329 Bacteria 3598
10 Ga0070683_100087658 3300005329 Bacteria 2920
11 Ga0070683_100241245 3300005329 Bacteria 1719
12 Ga0070683_100690329 3300005329 Bacteria 977
13 Ga0070690_100176320 3300005330 Bacteria 1474
14 Ga0070670_100197710 3300005331 Bacteria 1747
15 Ga0070677_10056385 3300005333 Bacteria 1607
16 Ga0070677_10105524 3300005333 Bacteria 1250
17 Ga0068869_100035402 3300005334 Bacteria 3538
18 Ga0070666_10466741 3300005335 Bacteria 913
19 Ga0070680_100000691 3300005336 Bacteria 23416
20 Ga0070680_100016555 3300005336 Bacteria 5801
21 Ga0070680_100016700 3300005336 Bacteria 5778
22 Ga0070680_100130351 3300005336 Bacteria 2103
23 Ga0070680_100275904 3300005336 Bacteria 1424
24 Ga0070680_100904024 3300005336 Bacteria 762
25 Ga0070660_100129459 3300005339 Bacteria 2019
26 Ga0070660_100131530 3300005339 Bacteria 2003
27 Ga0070660_100151235 3300005339 Bacteria 1866
28 Ga0070660_100178931 3300005339 Bacteria 1716
29 Ga0070689_100270565 3300005340 Bacteria 1406
30 Ga0070661_100006348 3300005344 Bacteria 8153
31 Ga0070668_100127709 3300005347 Bacteria 2038
32 Ga0070669_100309154 3300005353 Bacteria 1273
33 Ga0070674_100540732 3300005356 Bacteria 976
34 Ga0070673_100090874 3300005364 Bacteria 2495
35 Ga0070673_101160335 3300005364 Bacteria 723
36 Ga0070688_100182536 3300005365 Bacteria 1456
37 Ga0070659_100075960 3300005366 Bacteria 2679
38 Ga0070714_100006745 3300005435 Bacteria 8898
39 Ga0070714_100014705 3300005435 Bacteria 6289
40 Ga0070714_100042308 3300005435 Bacteria 3848
41 Ga0070714_100332134 3300005435 Bacteria 1424
42 Ga0070713_100146495 3300005436 Bacteria 2097
43 Ga0070710_10359587 3300005437 Bacteria 966
44 Ga0070710_10366242 3300005437 Unclassified 958
45 Ga0070708_100000024 3300005445 Bacteria 104177
46 Ga0070708_100014559 3300005445 Bacteria 6478
47 Ga0070678_101096659 3300005456 Bacteria 735
48 Ga0070681_10008902 3300005458 Bacteria 9865
49 Ga0070681_10010867 3300005458 Bacteria 8998
50 Ga0070681_10056643 3300005458 Bacteria 3900
51 Ga0070681_10154494 3300005458 Bacteria 2220
52 Ga0068867_100039694 3300005459 Bacteria 3432
53 Ga0070685_10393993 3300005466 Bacteria 957
54 Ga0070698_100033733 3300005471 Bacteria 5302
55 Ga0070699_100004580 3300005518 Bacteria 12234
56 Ga0070679_100000066 3300005530 Bacteria 78387
57 Ga0070679_100037551 3300005530 Bacteria 4813
58 Ga0070679_100082877 3300005530 Bacteria 3196
59 Ga0070679_100703055 3300005530 Bacteria 953
60 Ga0070684_100027665 3300005535 Bacteria 4788
61 Ga0070684_100037742 3300005535 Bacteria 4146
62 Ga0070684_100133371 3300005535 Bacteria 2242
63 Ga0070684_100913212 3300005535 Bacteria 823
64 Ga0070697_100357435 3300005536 Bacteria 1262
65 Ga0070697_100399155 3300005536 Bacteria 1193
66 Ga0068853_100100592 3300005539 Bacteria 2556
67 Ga0068853_100231284 3300005539 Bacteria 1691
68 Ga0070672_100386723 3300005543 Bacteria 1197
69 Ga0070695_100227433 3300005545 Bacteria 1347
70 Ga0070695_100370277 3300005545 Bacteria 1078
71 Ga0070696_100001493 3300005546 Bacteria 15337
72 Ga0070696_100215608 3300005546 Bacteria 1438
73 Ga0070704_100040613 3300005549 Bacteria 3204
74 Ga0068855_100028619 3300005563 Bacteria 6666
75 Ga0068855_100700612 3300005563 Bacteria 1084
76 Ga0070664_100025391 3300005564 Bacteria 4910
77 Ga0070664_100037210 3300005564 Bacteria 4090
78 Ga0070664_100625496 3300005564 Bacteria 999
79 Ga0068857_100298639 3300005577 Bacteria 1484
80 Ga0068852_100020072 3300005616 Bacteria 5307
81 Ga0068852_100187107 3300005616 Bacteria 1951
82 Ga0068852_100374236 3300005616 Bacteria 1396
83 Ga0068864_101542092 3300005618 Bacteria 668
84 Ga0068861_100859834 3300005719 Bacteria 856
85 Ga0068863_100559075 3300005841 Bacteria 1130
86 Ga0068860_101293599 3300005843 Bacteria 750
87 Ga0068862_100037399 3300005844 Bacteria 4114
88 Ga0081539_10000375 3300005985 Bacteria 97516
89 Ga0070716_100041146 3300006173 Bacteria 2573
90 Ga0070716_100236731 3300006173 Bacteria 1236
91 Ga0068865_100424024 3300006881 Bacteria 1094
92 Ga0105240_10021805 3300009093 Bacteria 8512
93 Ga0105240_10046088 3300009093 Bacteria 5526
94 Ga0105240_10146941 3300009093 Bacteria 2812
95 Ga0105240_10300554 3300009093 Bacteria 1836
96 Ga0111539_10166282 3300009094 Bacteria 2579
97 Ga0105243_10052894 3300009148 Bacteria 3219
98 Ga0105241_10058099 3300009174 Bacteria 2970
99 Ga0105242_10030039 3300009176 Bacteria 4338
100 Ga0105237_10150516 3300009545 Bacteria 2323
101 Ga0105237_10180169 3300009545 Bacteria 2113
102 Ga0105238_10009907 3300009551 Bacteria 9555
103 Ga0105238_10070821 3300009551 Bacteria 3485
104 Ga0105238_10361244 3300009551 Bacteria 1442
105 Ga0105238_10515589 3300009551 Bacteria 1198
106 Ga0105249_10000234 3300009553 Bacteria 62911
107 Ga0105249_10124766 3300009553 Bacteria 2450
108 Ga0105239_10992615 3300010375 Bacteria 965
109 Ga0157373_10139312 3300013100 Bacteria 1706
110 Ga0157373_10157787 3300013100 Bacteria 1596
111 Ga0157371_10033908 3300013102 Bacteria 3665
112 Ga0157370_10004097 3300013104 Bacteria 16899
113 Ga0157370_10012732 3300013104 Bacteria 8705
114 Ga0157370_10069187 3300013104 Bacteria 3334
115 Ga0157370_10146747 3300013104 Bacteria 2196
116 Ga0157370_10620961 3300013104 Bacteria 989
117 Ga0157370_10895679 3300013104 Bacteria 805
118 Ga0157369_10020802 3300013105 Bacteria 7334
119 Ga0157369_10028792 3300013105 Bacteria 6143
120 Ga0157369_10044602 3300013105 Bacteria 4825
121 Ga0157369_10326175 3300013105 Bacteria 1596
122 Ga0157369_10498399 3300013105 Bacteria 1260
123 Ga0157369_10743725 3300013105 Bacteria 1009
124 Ga0157374_10366020 3300013296 Bacteria 1434
125 Ga0157374_11855975 3300013296 Bacteria 628
126 Ga0157378_10140305 3300013297 Bacteria 2244
127 Ga0157372_10001783 3300013307 Bacteria 23363
128 Ga0157372_10002211 3300013307 Bacteria 21124
129 Ga0157372_10005614 3300013307 Bacteria 13341
130 Ga0157372_10006062 3300013307 Bacteria 12845
131 Ga0157372_10041897 3300013307 Bacteria 5063
132 Ga0157372_10258387 3300013307 Bacteria 2022
133 Ga0157372_10298197 3300013307 Bacteria 1875
134 Ga0157372_10313186 3300013307 Bacteria 1827
135 Ga0157372_10472767 3300013307 Bacteria 1461
136 Ga0157375_10039753 3300013308 Bacteria 4529
137 Ga0157375_10085450 3300013308 Bacteria 3205
138 Ga0157375_11004073 3300013308 Bacteria 974
139 Ga0163163_10762536 3300014325 Bacteria 1031
140 Ga0182008_10002456 3300014497 Bacteria 11610
141 Ga0157376_10034883 3300014969 Bacteria 4065
142 Ga0157376_10042150 3300014969 Bacteria 3741
143 Ga0157376_10512542 3300014969 Bacteria 1181
144 Ga0163161_10301165 3300017792 Bacteria 1263
145 Ga0206356_11821911 3300020070 Bacteria 1601
146 Ga0206354_10074954 3300020081 Bacteria 1251
147 Ga0206353_10443024 3300020082 Bacteria 3658
148 Ga0206353_11203629 3300020082 Bacteria 2607
149 Ga0224712_10021315 3300022467 Bacteria 2216
150 Ga0207656_10273125 3300025321 Bacteria 832
151 Ga0207682_10102582 3300025893 Bacteria 1252
152 Ga0207647_10171929 3300025904 Bacteria 1261
153 Ga0207699_10035205 3300025906 Bacteria 2847
154 Ga0207645_10033093 3300025907 Bacteria 3323
155 Ga0207705_10007822 3300025909 Bacteria 7850
156 Ga0207705_10073257 3300025909 Bacteria 2485
157 Ga0207705_10232341 3300025909 Bacteria 1403
158 Ga0207684_10075113 3300025910 Bacteria 2872
159 Ga0207654_10089310 3300025911 Bacteria 1874
160 Ga0207707_10005986 3300025912 Bacteria 10643
161 Ga0207707_10007977 3300025912 Bacteria 9198
162 Ga0207707_10037612 3300025912 Bacteria 4230
163 Ga0207707_10095637 3300025912 Bacteria 2596
164 Ga0207707_10400860 3300025912 Bacteria 1178
165 Ga0207695_10080513 3300025913 Bacteria 3298
166 Ga0207695_10145399 3300025913 Bacteria 2316
167 Ga0207660_10000589 3300025917 Bacteria 24492
168 Ga0207660_10035804 3300025917 Bacteria 3448
169 Ga0207660_10144897 3300025917 Bacteria 1819
170 Ga0207660_10289762 3300025917 Bacteria 1301
171 Ga0207662_10023993 3300025918 Bacteria 3508
172 Ga0207657_10023366 3300025919 Bacteria 5757
173 Ga0207657_10024285 3300025919 Bacteria 5619
174 Ga0207657_10108774 3300025919 Bacteria 2291
175 Ga0207657_10228909 3300025919 Bacteria 1487
176 Ga0207657_10316367 3300025919 Bacteria 1235
177 Ga0207649_10050346 3300025920 Bacteria 2576
178 Ga0207649_10082519 3300025920 Bacteria 2084
179 Ga0207649_10205983 3300025920 Bacteria 1392
180 Ga0207649_10432018 3300025920 Bacteria 991
181 Ga0207652_10001220 3300025921 Bacteria 23031
182 Ga0207652_10014965 3300025921 Bacteria 6293
183 Ga0207652_10043680 3300025921 Bacteria 3817
184 Ga0207652_10252939 3300025921 Bacteria 1589
185 Ga0207646_10024764 3300025922 Bacteria 5493
186 Ga0207681_10320093 3300025923 Bacteria 1233
187 Ga0207694_10046489 3300025924 Bacteria 3355
188 Ga0207694_10276540 3300025924 Bacteria 1378
189 Ga0207659_10029523 3300025926 Bacteria 3738
190 Ga0207700_10090844 3300025928 Bacteria 2411
191 Ga0207700_10638716 3300025928 Bacteria 949
192 Ga0207664_10032502 3300025929 Bacteria 3999
193 Ga0207664_10037721 3300025929 Bacteria 3743
194 Ga0207664_10142913 3300025929 Bacteria 2026
195 Ga0207664_10360563 3300025929 Bacteria 1288
196 Ga0207664_10837855 3300025929 Bacteria 827
197 Ga0207690_10140585 3300025932 Bacteria 1778
198 Ga0207690_10193920 3300025932 Bacteria 1538
199 Ga0207690_10405707 3300025932 Bacteria 1087
200 Ga0207670_10089444 3300025936 Bacteria 2173
201 Ga0207704_10090969 3300025938 Bacteria 2004
202 Ga0207665_10007293 3300025939 Bacteria 7316
203 Ga0207665_10098060 3300025939 Bacteria 2041
204 Ga0207665_10237998 3300025939 Bacteria 1340
205 Ga0207691_10247154 3300025940 Bacteria 1541
206 Ga0207691_10646117 3300025940 Bacteria 894
207 Ga0207689_10069839 3300025942 Bacteria 2886
208 Ga0207661_10002162 3300025944 Bacteria 13541
209 Ga0207661_10025852 3300025944 Bacteria 4467
210 Ga0207661_10045354 3300025944 Bacteria 3479
211 Ga0207661_10083155 3300025944 Bacteria 2648
212 Ga0207661_10164757 3300025944 Bacteria 1925
213 Ga0207661_10360936 3300025944 Bacteria 1312
214 Ga0207679_10020284 3300025945 Bacteria 4484
215 Ga0207679_10728593 3300025945 Bacteria 901
216 Ga0207667_10088451 3300025949 Bacteria 3203
217 Ga0207667_10503080 3300025949 Bacteria 1229
218 Ga0207712_10000747 3300025961 Bacteria 24620
219 Ga0207668_10154834 3300025972 Bacteria 1779
220 Ga0207677_10254860 3300026023 Bacteria 1427
221 Ga0207703_10255599 3300026035 Bacteria 1581
222 Ga0207639_10065292 3300026041 Bacteria 2825
223 Ga0207702_10204502 3300026078 Bacteria 1832
224 Ga0207676_10934810 3300026095 Bacteria 852
225 Ga0207674_10010641 3300026116 Bacteria 10402
226 Ga0207674_10163656 3300026116 Bacteria 2179
227 Ga0207674_11085305 3300026116 Bacteria 770
228 Ga0207675_100365416 3300026118 Bacteria 1416
229 Ga0207675_100577623 3300026118 Bacteria 1125
230 Ga0207683_10392332 3300026121 Bacteria 1276
231 Ga0207698_10021564 3300026142 Bacteria 4459
232 Ga0207698_10340864 3300026142 Bacteria 1412
233 Ga0268266_10268259 3300028379 Bacteria 1584
234 Ga0265327_10027109 3300031251 Bacteria 3303
235 Ga0307408_100073822 3300031548 Bacteria 2529
236 Ga0265314_10011090 3300031711 Bacteria 7471
237 Ga0316576_10001551 3300031727 Bacteria 12452
238 Ga0307405_10139191 3300031731 Bacteria 1689
239 Ga0307405_10434094 3300031731 Bacteria 1037
240 Ga0307413_10091030 3300031824 Bacteria 1986
241 Ga0307413_10179077 3300031824 Bacteria 1509
242 Ga0307413_10226639 3300031824 Bacteria 1369
243 Ga0307413_10403362 3300031824 Bacteria 1072
244 Ga0307410_10204092 3300031852 Bacteria 1511
245 Ga0307407_10190161 3300031903 Bacteria 1367
246 Ga0307412_10134382 3300031911 Bacteria 1802
247 Ga0307412_10274280 3300031911 Bacteria 1321
248 Ga0307412_10560660 3300031911 Bacteria 961
249 Ga0307409_100644387 3300031995 Bacteria 1052
250 Ga0307416_100039839 3300032002 Bacteria 3643
251 Ga0307416_100183628 3300032002 Bacteria 1963
252 Ga0307416_101004073 3300032002 Bacteria 937
253 Ga0307414_10317687 3300032004 Bacteria 1324
254 Ga0307411_10223359 3300032005 Bacteria 1463
255 Ga0307415_100093190 3300032126 Bacteria 2187
256 Ga0307415_100441916 3300032126 Bacteria 1122
257 Ga0373934_0001589 3300035086 Bacteria 8338
258 Ga0373936_0196279 3300035113 Bacteria 890
259 Ga0373945_0018819 3300035116 Bacteria 2353
260 Ga0373953_0062278 3300035117 Bacteria 1527
261 Ga0373956_0035809 3300035119 Bacteria 2190
262 Ga0373943_0095906 3300035170 Bacteria 1543
263 Ga0373955_0134650 3300035172 Bacteria 1444
264 Ga0373924_0023466 3300035410 Bacteria 2421
265 Ga0373935_0243403 3300035692 Bacteria 1257
266 Ga0373927_0005645 3300035695 Bacteria 8601
267 Ga0373927_0027412 3300035695 Bacteria 3719
268 Ga0373927_0067580 3300035695 Bacteria 2313
269 Ga0373933_0035156 3300035724 Bacteria 2925
270 Ga0373933_0083454 3300035724 Bacteria 1962
271 Ga0373947_0027429 3300035725 Bacteria 3333
272 Ga0373947_0415826 3300035725 Bacteria 908
273 Ga0373937_0000434 3300036401 Bacteria 38905
274 Ga0373937_0025435 3300036401 Bacteria 5343
275 Ga0373925_0061717 3300037068 Bacteria 2816
276 Ga0373925_0493643 3300037068 Bacteria 1005
277 Ga0436363_0984502 3300039450 Bacteria 725
278 Ga0451577_0000001 3300042876 Bacteria 2461803
279 Ga0466966_0018581 3300044684 Bacteria 4582
280 Ga0466961_0231144 3300044693 Bacteria 1138
281 Ga0466963_0191174 3300044694 Bacteria 1430
282 Ga0466971_0054642 3300044719 Bacteria 1800
283 Ga0466959_0008265 3300045049 Bacteria 7349
284 Ga0466959_0145070 3300045049 Bacteria 1676
285 Ga0466967_0075175 3300045976 Bacteria 3036
286 Ga0466967_0083125 3300045976 Bacteria 2895
287 Ga0466967_0162090 3300045976 Bacteria 2100
288 Ga0495592_0127329 3300046454 Bacteria 1785
289 Ga0495629_0056505 3300046459 Bacteria 2744
290 Ga0495629_0113789 3300046459 Bacteria 1886
291 Ga0495651_0044275 3300046462 Bacteria 3450
292 Ga0495651_0061776 3300046462 Bacteria 2867
293 Ga0495653_0195651 3300046463 Unclassified 1376
294 Ga0495580_0016769 3300046472 Bacteria 5497
295 Ga0495580_0024655 3300046472 Bacteria 4401
296 Ga0495580_0069601 3300046472 Bacteria 2459
297 Ga0495582_0216238 3300046473 Bacteria 1096
298 Ga0495605_0236653 3300046474 Bacteria 785
299 Ga0495639_0363383 3300046475 Bacteria 728
300 Ga0495639_0457810 3300046475 Bacteria 648
301 Ga0495662_0036070 3300046476 Bacteria 2387
302 Ga0495594_0001245 3300046499 Bacteria 13340
303 Ga0495594_0017885 3300046499 Bacteria 3750
304 Ga0495594_0089917 3300046499 Bacteria 1720
305 Ga0495618_0110653 3300046514 Bacteria 1758
306 Ga0495628_0051409 3300046516 Bacteria 3258
307 Ga0495630_0036439 3300046517 Bacteria 3677
308 Ga0495666_0085165 3300046526 Bacteria 1493
309 Ga0495652_0012993 3300046529 Bacteria 7505
310 Ga0495652_0257857 3300046529 Bacteria 1289
311 Ga0495665_0002536 3300046531 Bacteria 9852
312 Ga0495665_0044394 3300046531 Bacteria 2361
313 Ga0495640_0039891 3300046533 Bacteria 3292
314 Ga0495640_0137303 3300046533 Bacteria 1578
315 Ga0495586_0008587 3300046535 Bacteria 5439
316 Ga0495586_0030808 3300046535 Bacteria 2871
317 Ga0495586_0049932 3300046535 Bacteria 2263
318 Ga0495587_0015397 3300046536 Bacteria 4777
319 Ga0495645_0000941 3300046543 Bacteria 19851
320 Ga0495645_0018913 3300046543 Bacteria 4954
321 Ga0495645_0027538 3300046543 Bacteria 4130
322 Ga0495622_0172738 3300046557 Bacteria 971
323 Ga0495667_0000950 3300046559 Bacteria 18711
324 Ga0495667_0004544 3300046559 Bacteria 9367
325 Ga0495635_0274364 3300046663 Bacteria 1134
326 Ga0495588_0250212 3300046674 Bacteria 934
327 Ga0495657_0224860 3300046675 Bacteria 1137
328 Ga0495599_0000671 3300046678 Bacteria 19365
329 Ga0495599_0025296 3300046678 Bacteria 3715
330 Ga0495623_0009307 3300046679 Bacteria 6378
331 Ga0495623_0012700 3300046679 Bacteria 5453
332 Ga0495646_0301169 3300046680 Bacteria 848
333 Ga0495658_0061690 3300046683 Bacteria 2153
334 Ga0495658_0092385 3300046683 Bacteria 1794
335 Ga0495613_0425032 3300046689 Bacteria 903
336 Ga0495600_0095979 3300046809 Bacteria 1933
337 Ga0495581_0057419 3300047315 Bacteria 2246
338 Ga0495581_0076231 3300047315 Bacteria 1940
339 Ga0495581_0224416 3300047315 Bacteria 1099
340 Ga0495674_0061711 3300047319 Bacteria 3266
341 Ga0495672_0005989 3300047320 Bacteria 9524
342 Ga0495680_0212584 3300047322 Bacteria 1384
343 Ga0495675_0006554 3300047444 Bacteria 7129
344 Ga0495675_0104492 3300047444 Bacteria 1770
345 Ga0495684_0145058 3300047471 Bacteria 1778
346 Ga0495684_0148610 3300047471 Bacteria 1753
347 Ga0495684_0189903 3300047471 Bacteria 1519
348 Ga0495602_0029384 3300048088 Bacteria 5235
349 Ga0495602_0079079 3300048088 Bacteria 2775
350 Ga0496104_0229644 3300048907 Bacteria 1768
351 Ga0496105_0663979 3300048908 Bacteria 803
352 Ga0496112_0077230 3300048915 Bacteria 3293
353 Ga0496115_0095157 3300048918 Bacteria 2438
354 Ga0501290_012956 3300049513 Bacteria 1084
355 Ga0501298_036490 3300049521 Bacteria 984
356 Ga0501032_0055391 3300049569 Bacteria 2668
357 Ga0501034_0184394 3300049571 Bacteria 2051
358 Ga0501038_0081632 3300049574 Bacteria 2724
359 Ga0501043_0057539 3300049579 Bacteria 3053
360 Ga0501047_0032329 3300049581 Bacteria 5050
361 Ga0501047_0043002 3300049581 Bacteria 4365
362 Ga0501070_0177675 3300049586 Bacteria 1752
363 Ga0501223_091038 3300049663 Bacteria 620
364 Ga0501035_0100659 3300049822 Bacteria 2537
365 Ga0501044_0238936 3300049823 Bacteria 1761
366 nmdc:mga05p37_288971_c1 3300050507 Bacteria 1952
367 nmdc:mga0qj67_692857_c1 3300050509 Bacteria 811
368 nmdc:mga08y16_136403_c1 3300050511 Bacteria 2550
369 nmdc:mga0n895_18619_c1 3300050512 Bacteria 6431
370 nmdc:mga0rr50_175462_c1 3300050513 Bacteria 1749
371 nmdc:mga0a205_839_c1 3300050515 Bacteria 25119
372 Ga0495612_0024414 3300053078 Bacteria 2426
373 Ga0495595_0135444 3300053084 Unclassified 1206
374 Ga0495619_0031019 3300053085 Bacteria 3462
375 2887486847 2887478801 Bacteria 8972725
376 Ga0070684_100251868
377 Ga0070658_10068297
378 Ga0070658_10120493
379 Ga0070658_10153026
380 Ga0070683_100001680
381 Ga0070683_100025049
382 Ga0070683_100026298
383 Ga0070683_100030598
384 Ga0070683_100057967
385 Ga0070683_100087658
386 Ga0070683_100241245
387 Ga0070683_100690329
388 Ga0070690_100176320
389 Ga0070670_100197710
390 Ga0070677_10056385
391 Ga0070677_10105524
392 Ga0068869_100035402
393 Ga0070666_10466741
394 Ga0070680_100000691
395 Ga0070680_100016555
396 Ga0070680_100016700
397 Ga0070680_100130351
398 Ga0070680_100275904
399 Ga0070680_100904024
400 Ga0070660_100129459
401 Ga0070660_100131530
402 Ga0070660_100151235
403 Ga0070660_100178931
404 Ga0070689_100270565
405 Ga0070661_100006348
406 Ga0070668_100127709
407 Ga0070669_100309154
408 Ga0070674_100540732
409 Ga0070673_100090874
410 Ga0070673_101160335
411 Ga0070688_100182536
412 Ga0070659_100075960
413 Ga0070714_100006745
414 Ga0070714_100014705
415 Ga0070714_100042308
416 Ga0070714_100332134
417 Ga0070713_100146495
418 Ga0070710_10359587
419 Ga0070710_10366242
420 Ga0070708_100000024
421 Ga0070708_100014559
422 Ga0070678_101096659
423 Ga0070681_10008902
424 Ga0070681_10010867
425 Ga0070681_10056643
426 Ga0070681_10154494
427 Ga0068867_100039694
428 Ga0070685_10393993
429 Ga0070698_100033733
430 Ga0070699_100004580
431 Ga0070679_100000066
432 Ga0070679_100037551
433 Ga0070679_100082877
434 Ga0070679_100703055
435 Ga0070684_100027665
436 Ga0070684_100037742
437 Ga0070684_100133371
438 Ga0070684_100913212
439 Ga0070697_100357435
440 Ga0070697_100399155
441 Ga0068853_100100592
442 Ga0068853_100231284
443 Ga0070672_100386723
444 Ga0070695_100227433
445 Ga0070695_100370277
446 Ga0070696_100001493
447 Ga0070696_100215608
448 Ga0070704_100040613
449 Ga0068855_100028619
450 Ga0068855_100700612
451 Ga0070664_100025391
452 Ga0070664_100037210
453 Ga0070664_100625496
454 Ga0068857_100298639
455 Ga0068852_100020072
456 Ga0068852_100187107
457 Ga0068852_100374236
458 Ga0068864_101542092
459 Ga0068861_100859834
460 Ga0068863_100559075
461 Ga0068860_101293599
462 Ga0068862_100037399
463 Ga0081539_10000375
464 Ga0070716_100041146
465 Ga0070716_100236731
466 Ga0068865_100424024
467 Ga0105240_10021805
468 Ga0105240_10046088
469 Ga0105240_10146941
470 Ga0105240_10300554
471 Ga0111539_10166282
472 Ga0105243_10052894
473 Ga0105241_10058099
474 Ga0105242_10030039
475 Ga0105237_10150516
476 Ga0105237_10180169
477 Ga0105238_10009907
478 Ga0105238_10070821
479 Ga0105238_10361244
480 Ga0105238_10515589
481 Ga0105249_10000234
482 Ga0105249_10124766
483 Ga0105239_10992615
484 Ga0157373_10139312
485 Ga0157373_10157787
486 Ga0157371_10033908
487 Ga0157370_10004097
488 Ga0157370_10012732
489 Ga0157370_10069187
490 Ga0157370_10146747
491 Ga0157370_10620961
492 Ga0157370_10895679
493 Ga0157369_10020802
494 Ga0157369_10028792
495 Ga0157369_10044602
496 Ga0157369_10326175
497 Ga0157369_10498399
498 Ga0157369_10743725
499 Ga0157374_10366020
500 Ga0157374_11855975
501 Ga0157378_10140305
502 Ga0157372_10001783
503 Ga0157372_10002211
504 Ga0157372_10005614
505 Ga0157372_10006062
506 Ga0157372_10041897
507 Ga0157372_10258387
508 Ga0157372_10298197
509 Ga0157372_10313186
510 Ga0157372_10472767
511 Ga0157375_10039753
512 Ga0157375_10085450
513 Ga0157375_11004073
514 Ga0163163_10762536
515 Ga0182008_10002456
516 Ga0157376_10034883
517 Ga0157376_10042150
518 Ga0157376_10512542
519 Ga0163161_10301165
520 Ga0206356_11821911
521 Ga0206354_10074954
522 Ga0206353_10443024
523 Ga0206353_11203629
524 Ga0224712_10021315
525 Ga0207656_10273125
526 Ga0207682_10102582
527 Ga0207647_10171929
528 Ga0207699_10035205
529 Ga0207645_10033093
530 Ga0207705_10007822
531 Ga0207705_10073257
532 Ga0207705_10232341
533 Ga0207684_10075113
534 Ga0207654_10089310
535 Ga0207707_10005986
536 Ga0207707_10007977
537 Ga0207707_10037612
538 Ga0207707_10095637
539 Ga0207707_10400860
540 Ga0207695_10080513
541 Ga0207695_10145399
542 Ga0207660_10000589
543 Ga0207660_10035804
544 Ga0207660_10144897
545 Ga0207660_10289762
546 Ga0207662_10023993
547 Ga0207657_10023366
548 Ga0207657_10024285
549 Ga0207657_10108774
550 Ga0207657_10228909
551 Ga0207657_10316367
552 Ga0207649_10050346
553 Ga0207649_10082519
554 Ga0207649_10205983
555 Ga0207649_10432018
556 Ga0207652_10001220
557 Ga0207652_10014965
558 Ga0207652_10043680
559 Ga0207652_10252939
560 Ga0207646_10024764
561 Ga0207681_10320093
562 Ga0207694_10046489
563 Ga0207694_10276540
564 Ga0207659_10029523
565 Ga0207700_10090844
566 Ga0207700_10638716
567 Ga0207664_10032502
568 Ga0207664_10037721
569 Ga0207664_10142913
570 Ga0207664_10360563
571 Ga0207664_10837855
572 Ga0207690_10140585
573 Ga0207690_10193920
574 Ga0207690_10405707
575 Ga0207670_10089444
576 Ga0207704_10090969
577 Ga0207665_10007293
578 Ga0207665_10098060
579 Ga0207665_10237998
580 Ga0207691_10247154
581 Ga0207691_10646117
582 Ga0207689_10069839
583 Ga0207661_10002162
584 Ga0207661_10025852
585 Ga0207661_10045354
586 Ga0207661_10083155
587 Ga0207661_10164757
588 Ga0207661_10360936
589 Ga0207679_10020284
590 Ga0207679_10728593
591 Ga0207667_10088451
592 Ga0207667_10503080
593 Ga0207712_10000747
594 Ga0207668_10154834
595 Ga0207677_10254860
596 Ga0207703_10255599
597 Ga0207639_10065292
598 Ga0207702_10204502
599 Ga0207676_10934810
600 Ga0207674_10010641
601 Ga0207674_10163656
602 Ga0207674_11085305
603 Ga0207675_100365416
604 Ga0207675_100577623
605 Ga0207683_10392332
606 Ga0207698_10021564
607 Ga0207698_10340864
608 Ga0268266_10268259
609 Ga0265327_10027109
610 Ga0307408_100073822
611 Ga0265314_10011090
612 Ga0316576_10001551
613 Ga0307405_10139191
614 Ga0307405_10434094
615 Ga0307413_10091030
616 Ga0307413_10179077
617 Ga0307413_10226639
618 Ga0307413_10403362
619 Ga0307410_10204092
620 Ga0307407_10190161
621 Ga0307412_10134382
622 Ga0307412_10274280
623 Ga0307412_10560660
624 Ga0307409_100644387
625 Ga0307416_100039839
626 Ga0307416_100183628
627 Ga0307416_101004073
628 Ga0307414_10317687
629 Ga0307411_10223359
630 Ga0307415_100093190
631 Ga0307415_100441916
632 Ga0373934_0001589
633 Ga0373936_0196279
634 Ga0373945_0018819
635 Ga0373953_0062278
636 Ga0373956_0035809
637 Ga0373943_0095906
638 Ga0373955_0134650
639 Ga0373924_0023466
640 Ga0373935_0243403
641 Ga0373927_0005645
642 Ga0373927_0027412
643 Ga0373927_0067580
644 Ga0373933_0035156
645 Ga0373933_0083454
646 Ga0373947_0027429
647 Ga0373947_0415826
648 Ga0373937_0000434
649 Ga0373937_0025435
650 Ga0373925_0061717
651 Ga0373925_0493643
652 Ga0436363_0984502
653 Ga0451577_0000001
654 Ga0466966_0018581
655 Ga0466961_0231144
656 Ga0466963_0191174
657 Ga0466971_0054642
658 Ga0466959_0008265
659 Ga0466959_0145070
660 Ga0466967_0075175
661 Ga0466967_0083125
662 Ga0466967_0162090
663 Ga0495592_0127329
664 Ga0495629_0056505
665 Ga0495629_0113789
666 Ga0495651_0044275
667 Ga0495651_0061776
668 Ga0495653_0195651
669 Ga0495580_0016769
670 Ga0495580_0024655
671 Ga0495580_0069601
672 Ga0495582_0216238
673 Ga0495605_0236653
674 Ga0495639_0363383
675 Ga0495639_0457810
676 Ga0495662_0036070
677 Ga0495594_0001245
678 Ga0495594_0017885
679 Ga0495594_0089917
680 Ga0495618_0110653
681 Ga0495628_0051409
682 Ga0495630_0036439
683 Ga0495666_0085165
684 Ga0495652_0012993
685 Ga0495652_0257857
686 Ga0495665_0002536
687 Ga0495665_0044394
688 Ga0495640_0039891
689 Ga0495640_0137303
690 Ga0495586_0008587
691 Ga0495586_0030808
692 Ga0495586_0049932
693 Ga0495587_0015397
694 Ga0495645_0000941
695 Ga0495645_0018913
696 Ga0495645_0027538
697 Ga0495622_0172738
698 Ga0495667_0000950
699 Ga0495667_0004544
700 Ga0495635_0274364
701 Ga0495588_0250212
702 Ga0495657_0224860
703 Ga0495599_0000671
704 Ga0495599_0025296
705 Ga0495623_0009307
706 Ga0495623_0012700
707 Ga0495646_0301169
708 Ga0495658_0061690
709 Ga0495658_0092385
710 Ga0495613_0425032
711 Ga0495600_0095979
712 Ga0495581_0057419
713 Ga0495581_0076231
714 Ga0495581_0224416
715 Ga0495674_0061711
716 Ga0495672_0005989
717 Ga0495680_0212584
718 Ga0495675_0006554
719 Ga0495675_0104492
720 Ga0495684_0145058
721 Ga0495684_0148610
722 Ga0495684_0189903
723 Ga0495602_0029384
724 Ga0495602_0079079
725 Ga0496104_0229644
726 Ga0496105_0663979
727 Ga0496112_0077230
728 Ga0496115_0095157
729 Ga0501290_012956
730 Ga0501298_036490
731 Ga0501032_0055391
732 Ga0501034_0184394
733 Ga0501038_0081632
734 Ga0501043_0057539
735 Ga0501047_0032329
736 Ga0501047_0043002
737 Ga0501070_0177675
738 Ga0501223_091038
739 Ga0501035_0100659
740 Ga0501044_0238936
741 nmdc:mga05p37_288971_c1
742 nmdc:mga0qj67_692857_c1
743 nmdc:mga08y16_136403_c1
744 nmdc:mga0n895_18619_c1
745 nmdc:mga0rr50_175462_c1
746 nmdc:mga0a205_839_c1
747 Ga0495612_0024414
748 Ga0495595_0135444
749 Ga0495619_0031019
750 2887486847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

16

173

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p81-assembly1.cif.gz_D structure of ancestral pyrr protein (ancorangepyrr) 0.9533 6 179
1non-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus 0.9497 6 179
4p81-assembly1.cif.gz_C structure of ancestral pyrr protein (ancorangepyrr) 0.9484 1 177
4p81-assembly1.cif.gz_A structure of ancestral pyrr protein (ancorangepyrr) 0.9445 6 179
1ufr-assembly2.cif.gz_D crystal structure of tt1027 from thermus thermophilus hb8 0.9419 6 179
ID Description Score Start End Superfamily
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.91 6 179 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8998 6 179 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8874 5 177 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8415 5 177 3.40.50.2020
3acdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7825 6 181 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A2E5U5T0-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9414 6 178 GO:0004845
GO:0006355
AF-A0A2V7M9A5-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9401 16 176 GO:0004845
GO:0006355
AF-A0A7C4X884-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9394 5 181 GO:0004845
GO:0006355
AF-A0A2E1X054-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9357 5 180 GO:0004845
GO:0006355
AF-A0A534PYK6-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9314 1 178 GO:0004845
GO:0006355

Map