F426882

General Info

Members Datasets Scaffolds Average Seq Length
374 195 748 209

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_99279_c1|nmdc:mga0rr50_99279_c1_34_657
Length 207
Sequence MKLIDVTVPLDAHLASYPGNTPFSLEAIKRIARGDSSNVSSIHMSAHCGTHVDAPRHFFDNGGDADGLSLDMLIGRTRVIEVTSRTIAAEDLARLDLSEDVRVLIKTSNSRLWGDPEFHKEYVGVSESGAKHLVEHGLKVVGVDYLSVEQFRFPGAPAHHILLGGGVIVIEGLNLRDVEPGVYDMYCLPLRVVDSDGAPARVVLRRS

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.61
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 14.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_99279_c1 3300050513 Unclassified 2284
2 Ga0065712_10103885 3300005290 Bacteria 1974
3 Ga0065712_10111265 3300005290 Bacteria 1820
4 Ga0065715_10012559 3300005293 Bacteria 2297
5 Ga0065715_10018859 3300005293 Bacteria 2466
6 Ga0065707_10119810 3300005295 Bacteria 2149
7 Ga0070658_10127751 3300005327 Bacteria 2117
8 Ga0070676_10385656 3300005328 Bacteria 971
9 Ga0070683_100079540 3300005329 Bacteria 3068
10 Ga0070683_100271202 3300005329 Bacteria 1614
11 Ga0070690_100005537 3300005330 Bacteria 7104
12 Ga0070670_100091779 3300005331 Bacteria 2611
13 Ga0070670_100267719 3300005331 Bacteria 1490
14 Ga0070666_10027677 3300005335 Bacteria 3715
15 Ga0070666_10253697 3300005335 Bacteria 1246
16 Ga0070680_100105521 3300005336 Bacteria 2342
17 Ga0070680_100162977 3300005336 Bacteria 1874
18 Ga0070682_100127002 3300005337 Bacteria 1720
19 Ga0070660_100044564 3300005339 Bacteria 3394
20 Ga0070660_100195356 3300005339 Unclassified 1640
21 Ga0070689_100093463 3300005340 Bacteria 2374
22 Ga0070687_100113273 3300005343 Unclassified 1539
23 Ga0070687_100387501 3300005343 Bacteria 912
24 Ga0070668_100199071 3300005347 Bacteria 1644
25 Ga0070669_100053664 3300005353 Bacteria 2951
26 Ga0070675_100269159 3300005354 Unclassified 1495
27 Ga0070671_100071263 3300005355 Bacteria 2900
28 Ga0070671_100399615 3300005355 Bacteria 1175
29 Ga0070674_100261472 3300005356 Bacteria 1364
30 Ga0070674_100712108 3300005356 Bacteria 859
31 Ga0070673_100043698 3300005364 Bacteria 3464
32 Ga0070673_100048755 3300005364 Bacteria 3304
33 Ga0070673_100236047 3300005364 Bacteria 1588
34 Ga0070688_100036414 3300005365 Bacteria 2993
35 Ga0070688_100045990 3300005365 Bacteria 2701
36 Ga0070667_100002479 3300005367 Bacteria 16112
37 Ga0070667_100287471 3300005367 Bacteria 1478
38 Ga0070709_10125148 3300005434 Bacteria 1748
39 Ga0070711_100150616 3300005439 Bacteria 1754
40 Ga0070694_100134006 3300005444 Bacteria 1793
41 Ga0070662_100476169 3300005457 Bacteria 1039
42 Ga0070681_10008917 3300005458 Bacteria 9857
43 Ga0070681_10114470 3300005458 Bacteria 2636
44 Ga0068867_100240055 3300005459 Bacteria 1469
45 Ga0070685_10156799 3300005466 Bacteria 1447
46 Ga0070685_10483471 3300005466 Unclassified 873
47 Ga0070706_100178833 3300005467 Bacteria 1980
48 Ga0070706_100605476 3300005467 Bacteria 1018
49 Ga0070707_100172757 3300005468 Bacteria 2106
50 Ga0070707_100728066 3300005468 Unclassified 955
51 Ga0070707_100764246 3300005468 Unclassified 930
52 Ga0070698_100016579 3300005471 Bacteria 7776
53 Ga0070679_100007795 3300005530 Bacteria 10032
54 Ga0070679_100174502 3300005530 Bacteria 2122
55 Ga0070684_100119464 3300005535 Bacteria 2371
56 Ga0070697_100082539 3300005536 Bacteria 2649
57 Ga0070697_100128755 3300005536 Unclassified 2122
58 Ga0070672_100031746 3300005543 Bacteria 3979
59 Ga0070672_100276085 3300005543 Bacteria 1420
60 Ga0070672_100460635 3300005543 Bacteria 1096
61 Ga0070686_100001816 3300005544 Bacteria 11896
62 Ga0070686_100057250 3300005544 Bacteria 2503
63 Ga0070686_100210923 3300005544 Bacteria 1398
64 Ga0070686_100842812 3300005544 Unclassified 742
65 Ga0070695_100106570 3300005545 Bacteria 1895
66 Ga0070696_100342578 3300005546 Bacteria 1156
67 Ga0070693_100577563 3300005547 Bacteria 808
68 Ga0070665_100011043 3300005548 Bacteria 9129
69 Ga0068855_100137443 3300005563 Bacteria 2787
70 Ga0070664_100733254 3300005564 Bacteria 922
71 Ga0068857_100230410 3300005577 Bacteria 1694
72 Ga0068857_100367165 3300005577 Bacteria 1335
73 Ga0068854_100084106 3300005578 Bacteria 2354
74 Ga0068856_100003319 3300005614 Bacteria 16347
75 Ga0068856_100642383 3300005614 Unclassified 1082
76 Ga0070702_100522233 3300005615 Bacteria 876
77 Ga0068852_100232749 3300005616 Unclassified 1757
78 Ga0068852_100277300 3300005616 Bacteria 1615
79 Ga0068852_100913586 3300005616 Bacteria 895
80 Ga0068859_100086035 3300005617 Bacteria 3189
81 Ga0068859_100152941 3300005617 Bacteria 2383
82 Ga0068859_100666843 3300005617 Bacteria 1132
83 Ga0068859_101481252 3300005617 Unclassified 749
84 Ga0068864_100021087 3300005618 Bacteria 5456
85 Ga0068864_100211100 3300005618 Bacteria 1788
86 Ga0068863_100006880 3300005841 Bacteria 11143
87 Ga0068863_100131404 3300005841 Bacteria 2391
88 Ga0068863_100734799 3300005841 Bacteria 982
89 Ga0068858_100001614 3300005842 Bacteria 22989
90 Ga0068858_100020317 3300005842 Bacteria 6211
91 Ga0068858_100064707 3300005842 Bacteria 3385
92 Ga0068858_100290664 3300005842 Bacteria 1558
93 Ga0068860_100066926 3300005843 Bacteria 3413
94 Ga0068860_100396932 3300005843 Bacteria 1364
95 Ga0068860_100510034 3300005843 Bacteria 1202
96 Ga0068860_100587322 3300005843 Bacteria 1118
97 Ga0068860_100692587 3300005843 Bacteria 1028
98 Ga0081455_10007087 3300005937 Bacteria 11893
99 Ga0081539_10007638 3300005985 Bacteria 9744
100 Ga0097621_100007098 3300006237 Bacteria 7987
101 Ga0097621_100680541 3300006237 Bacteria 946
102 Ga0068871_100006445 3300006358 Bacteria 8306
103 Ga0068871_100373095 3300006358 Bacteria 1266
104 Ga0075428_100037202 3300006844 Bacteria 5359
105 Ga0075428_100101692 3300006844 Bacteria 3133
106 Ga0075433_10127211 3300006852 Bacteria 2262
107 Ga0075433_10261365 3300006852 Unclassified 1534
108 Ga0075434_100044042 3300006871 Bacteria 4427
109 Ga0075434_100178589 3300006871 Bacteria 2142
110 Ga0075434_100303942 3300006871 Bacteria 1616
111 Ga0075434_100731175 3300006871 Bacteria 1007
112 Ga0068865_100001011 3300006881 Bacteria 16168
113 Ga0075436_100016858 3300006914 Bacteria 4999
114 Ga0075436_100020174 3300006914 Bacteria 4574
115 Ga0075436_100023750 3300006914 Bacteria 4213
116 Ga0075436_100180750 3300006914 Bacteria 1491
117 Ga0097620_100086033 3300006931 Bacteria 3189
118 Ga0097620_100152947 3300006931 Bacteria 2383
119 Ga0097620_100666788 3300006931 Bacteria 1132
120 Ga0097620_101481165 3300006931 Unclassified 749
121 Ga0075435_100002285 3300007076 Bacteria 12655
122 Ga0075435_100005079 3300007076 Bacteria 9143
123 Ga0075435_100130247 3300007076 Bacteria 2105
124 Ga0075435_100520323 3300007076 Unclassified 1029
125 Ga0075435_100735530 3300007076 Bacteria 858
126 Ga0099794_10112539 3300007265 Bacteria 1365
127 Ga0111539_10004791 3300009094 Bacteria 17654
128 Ga0111539_10032428 3300009094 Bacteria 6342
129 Ga0111539_10380770 3300009094 Bacteria 1643
130 Ga0111539_10510501 3300009094 Bacteria 1400
131 Ga0111539_11185497 3300009094 Unclassified 887
132 Ga0105245_10182982 3300009098 Bacteria 2003
133 Ga0105245_10322451 3300009098 Bacteria 1522
134 Ga0105245_10685375 3300009098 Bacteria 1057
135 Ga0105247_10011306 3300009101 Bacteria 5385
136 Ga0105247_10126179 3300009101 Bacteria 1663
137 Ga0114129_10003915 3300009147 Bacteria 21010
138 Ga0114129_10053595 3300009147 Bacteria 5657
139 Ga0114129_10383972 3300009147 Bacteria 1854
140 Ga0114129_10904482 3300009147 Bacteria 1118
141 Ga0105243_10479490 3300009148 Unclassified 1173
142 Ga0105241_10085812 3300009174 Bacteria 2475
143 Ga0105241_10470725 3300009174 Bacteria 1115
144 Ga0105242_10014902 3300009176 Bacteria 6025
145 Ga0105242_10782350 3300009176 Unclassified 943
146 Ga0105248_10008605 3300009177 Bacteria 11208
147 Ga0105248_10079354 3300009177 Bacteria 3689
148 Ga0105248_10166771 3300009177 Bacteria 2482
149 Ga0105248_10184300 3300009177 Bacteria 2352
150 Ga0105248_10270586 3300009177 Bacteria 1913
151 Ga0105248_10273035 3300009177 Bacteria 1904
152 Ga0105248_11641875 3300009177 Bacteria 728
153 Ga0105237_10311843 3300009545 Bacteria 1576
154 Ga0105238_10124201 3300009551 Bacteria 2560
155 Ga0105238_10506134 3300009551 Bacteria 1209
156 Ga0105249_10268836 3300009553 Bacteria 1698
157 Ga0105249_10814320 3300009553 Bacteria 998
158 Ga0105239_10629421 3300010375 Unclassified 1225
159 Ga0105239_11465120 3300010375 Bacteria 789
160 Ga0157374_10307511 3300013296 Bacteria 1569
161 Ga0157378_10100541 3300013297 Bacteria 2640
162 Ga0163162_10068989 3300013306 Bacteria 3587
163 Ga0163162_10224063 3300013306 Unclassified 2010
164 Ga0163162_10249932 3300013306 Bacteria 1905
165 Ga0157375_10106872 3300013308 Bacteria 2891
166 Ga0157375_11025487 3300013308 Unclassified 964
167 Ga0163163_10035782 3300014325 Bacteria 4819
168 Ga0163163_10580421 3300014325 Bacteria 1184
169 Ga0157379_10016843 3300014968 Bacteria 6433
170 Ga0157379_10034175 3300014968 Bacteria 4531
171 Ga0157376_10212623 3300014969 Bacteria 1786
172 Ga0157376_10627946 3300014969 Bacteria 1072
173 Ga0182005_1026839 3300015265 Bacteria 1571
174 Ga0163161_10170247 3300017792 Bacteria 1665
175 Ga0207697_10087721 3300025315 Bacteria 1317
176 Ga0207682_10069652 3300025893 Bacteria 1488
177 Ga0207642_10087509 3300025899 Bacteria 1530
178 Ga0207642_10443290 3300025899 Unclassified 785
179 Ga0207710_10022403 3300025900 Bacteria 2711
180 Ga0207710_10064374 3300025900 Bacteria 1670
181 Ga0207680_10260365 3300025903 Bacteria 1200
182 Ga0207699_10044816 3300025906 Bacteria 2577
183 Ga0207699_10296084 3300025906 Bacteria 1129
184 Ga0207645_10147705 3300025907 Bacteria 1533
185 Ga0207684_10362295 3300025910 Bacteria 1247
186 Ga0207654_10126593 3300025911 Unclassified 1611
187 Ga0207707_10020165 3300025912 Bacteria 5819
188 Ga0207707_10163218 3300025912 Unclassified 1947
189 Ga0207671_10287575 3300025914 Bacteria 1297
190 Ga0207660_10050542 3300025917 Bacteria 2953
191 Ga0207660_10614110 3300025917 Bacteria 886
192 Ga0207662_10010794 3300025918 Bacteria 5048
193 Ga0207662_10044432 3300025918 Bacteria 2623
194 Ga0207662_10167351 3300025918 Bacteria 1408
195 Ga0207649_10038785 3300025920 Bacteria 2886
196 Ga0207649_10235265 3300025920 Unclassified 1312
197 Ga0207652_10030913 3300025921 Bacteria 4491
198 Ga0207646_10195437 3300025922 Bacteria 1827
199 Ga0207646_10278012 3300025922 Bacteria 1513
200 Ga0207646_10368229 3300025922 Bacteria 1298
201 Ga0207681_10035744 3300025923 Bacteria 3275
202 Ga0207650_10089862 3300025925 Bacteria 2345
203 Ga0207659_10234670 3300025926 Unclassified 1481
204 Ga0207659_10287243 3300025926 Unclassified 1347
205 Ga0207687_10058627 3300025927 Bacteria 2709
206 Ga0207687_10458867 3300025927 Bacteria 1058
207 Ga0207644_10098133 3300025931 Bacteria 2195
208 Ga0207644_10460232 3300025931 Bacteria 1046
209 Ga0207644_10556042 3300025931 Unclassified 950
210 Ga0207706_10283404 3300025933 Bacteria 1445
211 Ga0207686_10006736 3300025934 Bacteria 6188
212 Ga0207686_10222404 3300025934 Unclassified 1364
213 Ga0207686_10239556 3300025934 Bacteria 1320
214 Ga0207670_10093494 3300025936 Bacteria 2131
215 Ga0207670_10390820 3300025936 Bacteria 1110
216 Ga0207669_10168615 3300025937 Bacteria 1556
217 Ga0207669_10325776 3300025937 Bacteria 1178
218 Ga0207669_10365792 3300025937 Unclassified 1119
219 Ga0207704_10006224 3300025938 Bacteria 5550
220 Ga0207704_10617446 3300025938 Bacteria 889
221 Ga0207691_10199859 3300025940 Bacteria 1740
222 Ga0207711_10005018 3300025941 Bacteria 11228
223 Ga0207711_10027736 3300025941 Bacteria 4759
224 Ga0207711_10338963 3300025941 Bacteria 1391
225 Ga0207711_10420531 3300025941 Bacteria 1243
226 Ga0207711_10735572 3300025941 Bacteria 920
227 Ga0207689_10150784 3300025942 Bacteria 1916
228 Ga0207661_10241583 3300025944 Unclassified 1603
229 Ga0207661_10370439 3300025944 Bacteria 1295
230 Ga0207679_10157433 3300025945 Bacteria 1856
231 Ga0207679_10442568 3300025945 Bacteria 1151
232 Ga0207667_10374311 3300025949 Unclassified 1451
233 Ga0207651_10033770 3300025960 Bacteria 3304
234 Ga0207651_10093329 3300025960 Bacteria 2210
235 Ga0207651_10430308 3300025960 Bacteria 1128
236 Ga0207712_10241232 3300025961 Bacteria 1456
237 Ga0207712_10361195 3300025961 Bacteria 1210
238 Ga0207668_10282502 3300025972 Bacteria 1362
239 Ga0207640_10257206 3300025981 Unclassified 1358
240 Ga0207658_10211858 3300025986 Unclassified 1624
241 Ga0207658_10363218 3300025986 Bacteria 1264
242 Ga0207703_10036748 3300026035 Bacteria 3900
243 Ga0207703_10046537 3300026035 Bacteria 3493
244 Ga0207703_10057384 3300026035 Bacteria 3174
245 Ga0207703_10069397 3300026035 Bacteria 2906
246 Ga0207703_10127096 3300026035 Bacteria 2196
247 Ga0207708_10304327 3300026075 Bacteria 1297
248 Ga0207708_10533670 3300026075 Unclassified 987
249 Ga0207702_10356751 3300026078 Unclassified 1400
250 Ga0207641_10022823 3300026088 Bacteria 5152
251 Ga0207641_10425852 3300026088 Bacteria 1279
252 Ga0207641_10990067 3300026088 Bacteria 837
253 Ga0207648_10048993 3300026089 Bacteria 3698
254 Ga0207648_10298948 3300026089 Unclassified 1443
255 Ga0207676_10008987 3300026095 Bacteria 7108
256 Ga0207676_10029139 3300026095 Bacteria 4130
257 Ga0207676_10326551 3300026095 Bacteria 1410
258 Ga0207674_10265641 3300026116 Bacteria 1663
259 Ga0207674_10269646 3300026116 Bacteria 1649
260 Ga0207674_10751238 3300026116 Bacteria 941
261 Ga0207675_100029250 3300026118 Bacteria 5133
262 Ga0207675_100356529 3300026118 Bacteria 1434
263 Ga0207675_100705440 3300026118 Unclassified 1018
264 Ga0207683_10008190 3300026121 Bacteria 8941
265 Ga0207683_10106262 3300026121 Bacteria 2510
266 Ga0207698_10203286 3300026142 Unclassified 1776
267 Ga0207698_10899902 3300026142 Unclassified 892
268 Ga0207428_10010058 3300027907 Bacteria 8467
269 Ga0207428_10318969 3300027907 Unclassified 1148
270 Ga0207428_10576314 3300027907 Bacteria 812
271 Ga0268266_10002943 3300028379 Bacteria 17587
272 Ga0268264_10161050 3300028381 Bacteria 2021
273 Ga0268264_10373685 3300028381 Bacteria 1363
274 Ga0268264_11520170 3300028381 Unclassified 680
275 Ga0265314_10010668 3300031711 Bacteria 7646
276 Ga0373930_0000848 3300034816 Bacteria 4344
277 Ga0373938_0000376 3300034957 Bacteria 7149
278 Ga0373928_0002505 3300035084 Bacteria 3556
279 Ga0373928_0021317 3300035084 Unclassified 1366
280 Ga0373929_0000771 3300035085 Bacteria 6233
281 Ga0373949_0000714 3300035090 Bacteria 10781
282 Ga0373951_0000744 3300035091 Bacteria 8902
283 Ga0373952_0000291 3300035092 Bacteria 8305
284 Ga0373939_0000129 3300035114 Bacteria 22200
285 Ga0373941_0022755 3300035115 Bacteria 1782
286 Ga0373957_0222184 3300035120 Unclassified 791
287 Ga0373960_0000442 3300035121 Bacteria 8116
288 Ga0373943_0033494 3300035170 Unclassified 2448
289 Ga0373946_0021206 3300035171 Bacteria 2518
290 Ga0373942_0000050 3300035207 Bacteria 23361
291 Ga0373961_0000288 3300035241 Bacteria 22649
292 Ga0373962_0000450 3300035242 Bacteria 9037
293 Ga0373931_0030229 3300035691 Bacteria 2788
294 Ga0373931_0049313 3300035691 Bacteria 2235
295 Ga0373931_0248986 3300035691 Unclassified 1080
296 Ga0373935_0106313 3300035692 Bacteria 1857
297 Ga0373927_0078888 3300035695 Bacteria 2133
298 Ga0373947_0076572 3300035725 Bacteria 2062
299 Ga0373937_0510195 3300036401 Unclassified 1142
300 Ga0373937_1098084 3300036401 Archaea 744
301 Ga0395901_1035084 3300038443 Bacteria 795
302 Ga0466963_0034798 3300044694 Bacteria 3279
303 Ga0466963_0337521 3300044694 Bacteria 1061
304 Ga0451576_0025686 3300045051 Bacteria 6344
305 Ga0451576_0283528 3300045051 Bacteria 1732
306 Ga0451576_1151737 3300045051 Unclassified 811
307 Ga0466967_0277865 3300045976 Bacteria 1606
308 Ga0495592_0361568 3300046454 Unclassified 928
309 Ga0495629_0315085 3300046459 Unclassified 1070
310 Ga0495618_0317686 3300046514 Bacteria 965
311 Ga0495663_0191126 3300046525 Unclassified 712
312 Ga0495645_0005970 3300046543 Bacteria 8423
313 Ga0495667_0223975 3300046559 Bacteria 1200
314 Ga0495604_0113972 3300047317 Bacteria 1967
315 Ga0495684_0106621 3300047471 Bacteria 2117
316 Ga0496102_0017720 3300048905 Bacteria 6244
317 Ga0496102_0324324 3300048905 Bacteria 1451
318 Ga0496102_0471948 3300048905 Bacteria 1176
319 Ga0496104_0447099 3300048907 Bacteria 1204
320 Ga0496106_0138702 3300048909 Bacteria 1912
321 Ga0496106_0176146 3300048909 Bacteria 1697
322 Ga0496108_0008297 3300048911 Bacteria 8425
323 Ga0496108_0077036 3300048911 Bacteria 2820
324 Ga0496108_0302912 3300048911 Bacteria 1392
325 Ga0496108_0348574 3300048911 Bacteria 1292
326 Ga0496108_0393677 3300048911 Bacteria 1210
327 Ga0496109_0009570 3300048912 Bacteria 8265
328 Ga0496111_0379732 3300048914 Bacteria 1045
329 Ga0496112_0029843 3300048915 Bacteria 5275
330 Ga0496112_0052215 3300048915 Bacteria 4012
331 Ga0496112_0938078 3300048915 Bacteria 787
332 Ga0496113_0023598 3300048916 Bacteria 4362
333 Ga0496113_0289947 3300048916 Bacteria 1309
334 Ga0496113_0440290 3300048916 Bacteria 1047
335 Ga0496114_0030639 3300048917 Bacteria 4427
336 Ga0496114_0098416 3300048917 Bacteria 2494
337 Ga0501032_0245106 3300049569 Bacteria 1164
338 Ga0501034_0021349 3300049571 Bacteria 6602
339 Ga0501043_0175587 3300049579 Bacteria 1670
340 Ga0501047_0026203 3300049581 Bacteria 5608
341 Ga0501047_0484229 3300049581 Unclassified 1065
342 Ga0501073_0292781 3300049589 Bacteria 1123
343 Ga0501080_0451106 3300049742 Bacteria 1153
344 Ga0501044_0005934 3300049823 Bacteria 13533
345 nmdc:mga05p37_12505_c1 3300050507 Bacteria 10134
346 nmdc:mga05p37_20106_c1 3300050507 Bacteria 8080
347 nmdc:mga05p37_22150_c1 3300050507 Bacteria 7702
348 nmdc:mga05p37_232364_c1 3300050507 Bacteria 2221
349 nmdc:mga05p37_3329_c1 3300050507 Bacteria 18756
350 nmdc:mga0qj67_257248_c1 3300050509 Bacteria 1416
351 nmdc:mga08y16_574602_c1 3300050511 Unclassified 1139
352 nmdc:mga08y16_691851_c1 3300050511 Bacteria 1020
353 nmdc:mga08y16_90609_c1 3300050511 Bacteria 3188
354 nmdc:mga0n895_157840_c1 3300050512 Bacteria 2300
355 nmdc:mga0n895_466219_c1 3300050512 Bacteria 1274
356 nmdc:mga0n895_636953_c1 3300050512 Bacteria 1066
357 nmdc:mga0n895_70619_c1 3300050512 Bacteria 3461
358 nmdc:mga0n895_852070_c1 3300050512 Unclassified 899
359 nmdc:mga0n895_9924_c1 3300050512 Bacteria 8376
360 nmdc:mga0rr50_313933_c1 3300050513 Bacteria 1313
361 nmdc:mga0rr50_49535_c1 3300050513 Bacteria 3110
362 nmdc:mga0rr50_5119_c1 3300050513 Bacteria 7784
363 nmdc:mga0rr50_5590_c1 3300050513 Bacteria 7519
364 nmdc:mga0rr50_85100_c1 3300050513 Bacteria 2450
365 nmdc:mga08x19_12216_c1 3300050514 Bacteria 5169
366 nmdc:mga08x19_14958_c1 3300050514 Bacteria 4713
367 nmdc:mga08x19_24087_c1 3300050514 Bacteria 3780
368 nmdc:mga0a205_3272_c1 3300050515 Bacteria 14414
369 nmdc:mga0a205_5587_c1 3300050515 Bacteria 11327
370 nmdc:mga0a205_84914_c1 3300050515 Bacteria 3058
371 Ga0495601_0049523 3300053077 Bacteria 2649
372 Ga0495601_0090817 3300053077 Bacteria 1966
373 Ga0495601_0198552 3300053077 Unclassified 1311
374 Ga0495619_0027285 3300053085 Bacteria 3677
375 nmdc:mga0rr50_99279_c1
376 Ga0065712_10103885
377 Ga0065712_10111265
378 Ga0065715_10012559
379 Ga0065715_10018859
380 Ga0065707_10119810
381 Ga0070658_10127751
382 Ga0070676_10385656
383 Ga0070683_100079540
384 Ga0070683_100271202
385 Ga0070690_100005537
386 Ga0070670_100091779
387 Ga0070670_100267719
388 Ga0070666_10027677
389 Ga0070666_10253697
390 Ga0070680_100105521
391 Ga0070680_100162977
392 Ga0070682_100127002
393 Ga0070660_100044564
394 Ga0070660_100195356
395 Ga0070689_100093463
396 Ga0070687_100113273
397 Ga0070687_100387501
398 Ga0070668_100199071
399 Ga0070669_100053664
400 Ga0070675_100269159
401 Ga0070671_100071263
402 Ga0070671_100399615
403 Ga0070674_100261472
404 Ga0070674_100712108
405 Ga0070673_100043698
406 Ga0070673_100048755
407 Ga0070673_100236047
408 Ga0070688_100036414
409 Ga0070688_100045990
410 Ga0070667_100002479
411 Ga0070667_100287471
412 Ga0070709_10125148
413 Ga0070711_100150616
414 Ga0070694_100134006
415 Ga0070662_100476169
416 Ga0070681_10008917
417 Ga0070681_10114470
418 Ga0068867_100240055
419 Ga0070685_10156799
420 Ga0070685_10483471
421 Ga0070706_100178833
422 Ga0070706_100605476
423 Ga0070707_100172757
424 Ga0070707_100728066
425 Ga0070707_100764246
426 Ga0070698_100016579
427 Ga0070679_100007795
428 Ga0070679_100174502
429 Ga0070684_100119464
430 Ga0070697_100082539
431 Ga0070697_100128755
432 Ga0070672_100031746
433 Ga0070672_100276085
434 Ga0070672_100460635
435 Ga0070686_100001816
436 Ga0070686_100057250
437 Ga0070686_100210923
438 Ga0070686_100842812
439 Ga0070695_100106570
440 Ga0070696_100342578
441 Ga0070693_100577563
442 Ga0070665_100011043
443 Ga0068855_100137443
444 Ga0070664_100733254
445 Ga0068857_100230410
446 Ga0068857_100367165
447 Ga0068854_100084106
448 Ga0068856_100003319
449 Ga0068856_100642383
450 Ga0070702_100522233
451 Ga0068852_100232749
452 Ga0068852_100277300
453 Ga0068852_100913586
454 Ga0068859_100086035
455 Ga0068859_100152941
456 Ga0068859_100666843
457 Ga0068859_101481252
458 Ga0068864_100021087
459 Ga0068864_100211100
460 Ga0068863_100006880
461 Ga0068863_100131404
462 Ga0068863_100734799
463 Ga0068858_100001614
464 Ga0068858_100020317
465 Ga0068858_100064707
466 Ga0068858_100290664
467 Ga0068860_100066926
468 Ga0068860_100396932
469 Ga0068860_100510034
470 Ga0068860_100587322
471 Ga0068860_100692587
472 Ga0081455_10007087
473 Ga0081539_10007638
474 Ga0097621_100007098
475 Ga0097621_100680541
476 Ga0068871_100006445
477 Ga0068871_100373095
478 Ga0075428_100037202
479 Ga0075428_100101692
480 Ga0075433_10127211
481 Ga0075433_10261365
482 Ga0075434_100044042
483 Ga0075434_100178589
484 Ga0075434_100303942
485 Ga0075434_100731175
486 Ga0068865_100001011
487 Ga0075436_100016858
488 Ga0075436_100020174
489 Ga0075436_100023750
490 Ga0075436_100180750
491 Ga0097620_100086033
492 Ga0097620_100152947
493 Ga0097620_100666788
494 Ga0097620_101481165
495 Ga0075435_100002285
496 Ga0075435_100005079
497 Ga0075435_100130247
498 Ga0075435_100520323
499 Ga0075435_100735530
500 Ga0099794_10112539
501 Ga0111539_10004791
502 Ga0111539_10032428
503 Ga0111539_10380770
504 Ga0111539_10510501
505 Ga0111539_11185497
506 Ga0105245_10182982
507 Ga0105245_10322451
508 Ga0105245_10685375
509 Ga0105247_10011306
510 Ga0105247_10126179
511 Ga0114129_10003915
512 Ga0114129_10053595
513 Ga0114129_10383972
514 Ga0114129_10904482
515 Ga0105243_10479490
516 Ga0105241_10085812
517 Ga0105241_10470725
518 Ga0105242_10014902
519 Ga0105242_10782350
520 Ga0105248_10008605
521 Ga0105248_10079354
522 Ga0105248_10166771
523 Ga0105248_10184300
524 Ga0105248_10270586
525 Ga0105248_10273035
526 Ga0105248_11641875
527 Ga0105237_10311843
528 Ga0105238_10124201
529 Ga0105238_10506134
530 Ga0105249_10268836
531 Ga0105249_10814320
532 Ga0105239_10629421
533 Ga0105239_11465120
534 Ga0157374_10307511
535 Ga0157378_10100541
536 Ga0163162_10068989
537 Ga0163162_10224063
538 Ga0163162_10249932
539 Ga0157375_10106872
540 Ga0157375_11025487
541 Ga0163163_10035782
542 Ga0163163_10580421
543 Ga0157379_10016843
544 Ga0157379_10034175
545 Ga0157376_10212623
546 Ga0157376_10627946
547 Ga0182005_1026839
548 Ga0163161_10170247
549 Ga0207697_10087721
550 Ga0207682_10069652
551 Ga0207642_10087509
552 Ga0207642_10443290
553 Ga0207710_10022403
554 Ga0207710_10064374
555 Ga0207680_10260365
556 Ga0207699_10044816
557 Ga0207699_10296084
558 Ga0207645_10147705
559 Ga0207684_10362295
560 Ga0207654_10126593
561 Ga0207707_10020165
562 Ga0207707_10163218
563 Ga0207671_10287575
564 Ga0207660_10050542
565 Ga0207660_10614110
566 Ga0207662_10010794
567 Ga0207662_10044432
568 Ga0207662_10167351
569 Ga0207649_10038785
570 Ga0207649_10235265
571 Ga0207652_10030913
572 Ga0207646_10195437
573 Ga0207646_10278012
574 Ga0207646_10368229
575 Ga0207681_10035744
576 Ga0207650_10089862
577 Ga0207659_10234670
578 Ga0207659_10287243
579 Ga0207687_10058627
580 Ga0207687_10458867
581 Ga0207644_10098133
582 Ga0207644_10460232
583 Ga0207644_10556042
584 Ga0207706_10283404
585 Ga0207686_10006736
586 Ga0207686_10222404
587 Ga0207686_10239556
588 Ga0207670_10093494
589 Ga0207670_10390820
590 Ga0207669_10168615
591 Ga0207669_10325776
592 Ga0207669_10365792
593 Ga0207704_10006224
594 Ga0207704_10617446
595 Ga0207691_10199859
596 Ga0207711_10005018
597 Ga0207711_10027736
598 Ga0207711_10338963
599 Ga0207711_10420531
600 Ga0207711_10735572
601 Ga0207689_10150784
602 Ga0207661_10241583
603 Ga0207661_10370439
604 Ga0207679_10157433
605 Ga0207679_10442568
606 Ga0207667_10374311
607 Ga0207651_10033770
608 Ga0207651_10093329
609 Ga0207651_10430308
610 Ga0207712_10241232
611 Ga0207712_10361195
612 Ga0207668_10282502
613 Ga0207640_10257206
614 Ga0207658_10211858
615 Ga0207658_10363218
616 Ga0207703_10036748
617 Ga0207703_10046537
618 Ga0207703_10057384
619 Ga0207703_10069397
620 Ga0207703_10127096
621 Ga0207708_10304327
622 Ga0207708_10533670
623 Ga0207702_10356751
624 Ga0207641_10022823
625 Ga0207641_10425852
626 Ga0207641_10990067
627 Ga0207648_10048993
628 Ga0207648_10298948
629 Ga0207676_10008987
630 Ga0207676_10029139
631 Ga0207676_10326551
632 Ga0207674_10265641
633 Ga0207674_10269646
634 Ga0207674_10751238
635 Ga0207675_100029250
636 Ga0207675_100356529
637 Ga0207675_100705440
638 Ga0207683_10008190
639 Ga0207683_10106262
640 Ga0207698_10203286
641 Ga0207698_10899902
642 Ga0207428_10010058
643 Ga0207428_10318969
644 Ga0207428_10576314
645 Ga0268266_10002943
646 Ga0268264_10161050
647 Ga0268264_10373685
648 Ga0268264_11520170
649 Ga0265314_10010668
650 Ga0373930_0000848
651 Ga0373938_0000376
652 Ga0373928_0002505
653 Ga0373928_0021317
654 Ga0373929_0000771
655 Ga0373949_0000714
656 Ga0373951_0000744
657 Ga0373952_0000291
658 Ga0373939_0000129
659 Ga0373941_0022755
660 Ga0373957_0222184
661 Ga0373960_0000442
662 Ga0373943_0033494
663 Ga0373946_0021206
664 Ga0373942_0000050
665 Ga0373961_0000288
666 Ga0373962_0000450
667 Ga0373931_0030229
668 Ga0373931_0049313
669 Ga0373931_0248986
670 Ga0373935_0106313
671 Ga0373927_0078888
672 Ga0373947_0076572
673 Ga0373937_0510195
674 Ga0373937_1098084
675 Ga0395901_1035084
676 Ga0466963_0034798
677 Ga0466963_0337521
678 Ga0451576_0025686
679 Ga0451576_0283528
680 Ga0451576_1151737
681 Ga0466967_0277865
682 Ga0495592_0361568
683 Ga0495629_0315085
684 Ga0495618_0317686
685 Ga0495663_0191126
686 Ga0495645_0005970
687 Ga0495667_0223975
688 Ga0495604_0113972
689 Ga0495684_0106621
690 Ga0496102_0017720
691 Ga0496102_0324324
692 Ga0496102_0471948
693 Ga0496104_0447099
694 Ga0496106_0138702
695 Ga0496106_0176146
696 Ga0496108_0008297
697 Ga0496108_0077036
698 Ga0496108_0302912
699 Ga0496108_0348574
700 Ga0496108_0393677
701 Ga0496109_0009570
702 Ga0496111_0379732
703 Ga0496112_0029843
704 Ga0496112_0052215
705 Ga0496112_0938078
706 Ga0496113_0023598
707 Ga0496113_0289947
708 Ga0496113_0440290
709 Ga0496114_0030639
710 Ga0496114_0098416
711 Ga0501032_0245106
712 Ga0501034_0021349
713 Ga0501043_0175587
714 Ga0501047_0026203
715 Ga0501047_0484229
716 Ga0501073_0292781
717 Ga0501080_0451106
718 Ga0501044_0005934
719 nmdc:mga05p37_12505_c1
720 nmdc:mga05p37_20106_c1
721 nmdc:mga05p37_22150_c1
722 nmdc:mga05p37_232364_c1
723 nmdc:mga05p37_3329_c1
724 nmdc:mga0qj67_257248_c1
725 nmdc:mga08y16_574602_c1
726 nmdc:mga08y16_691851_c1
727 nmdc:mga08y16_90609_c1
728 nmdc:mga0n895_157840_c1
729 nmdc:mga0n895_466219_c1
730 nmdc:mga0n895_636953_c1
731 nmdc:mga0n895_70619_c1
732 nmdc:mga0n895_852070_c1
733 nmdc:mga0n895_9924_c1
734 nmdc:mga0rr50_313933_c1
735 nmdc:mga0rr50_49535_c1
736 nmdc:mga0rr50_5119_c1
737 nmdc:mga0rr50_5590_c1
738 nmdc:mga0rr50_85100_c1
739 nmdc:mga08x19_12216_c1
740 nmdc:mga08x19_14958_c1
741 nmdc:mga08x19_24087_c1
742 nmdc:mga0a205_3272_c1
743 nmdc:mga0a205_5587_c1
744 nmdc:mga0a205_84914_c1
745 Ga0495601_0049523
746 Ga0495601_0090817
747 Ga0495601_0198552
748 Ga0495619_0027285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

4

150

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4co9-assembly2.cif.gz_A crystal structure of kynurenine formamidase from bacillus anthracis 0.934 2 208
4cog-assembly2.cif.gz_D crystal structure of kynurenine formamidase from burkholderia cenocepacia 0.9322 2 208
4cog-assembly2.cif.gz_D crystal structure of kynurenine formamidase from burkholderia cenocepacia 0.9236 2 208
4co9-assembly2.cif.gz_A crystal structure of kynurenine formamidase from bacillus anthracis 0.9212 2 208
4cob-assembly1.cif.gz_B crystal structure kynurenine formamidase from pseudomonas aeruginosa 0.9164 2 208
ID Description Score Start End Superfamily
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9306 1 208 3.50.30.50
4co9B00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9221 1 208 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9164 2 208 3.50.30.50
af_C4JAI3_56_274_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9099 1 206 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9079 2 208 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A1Q8AY32-F1-model_v4 Cyclase 0.9853 1 208 GO:0004061
GO:0019441
AF-A0A2V7VNQ0-F1-model_v4 Cyclase 0.9832 2 208 GO:0004061
GO:0019441
AF-A0A3D1YYR9-F1-model_v4 Cyclase 0.9819 2 207 GO:0004061
GO:0019441
AF-A0A523X5L1-F1-model_v4 Cyclase family protein 0.9815 87 208 GO:0004061
GO:0019441
AF-A0A6L4ZP84-F1-model_v4 Arylformamidase 0.9813 1 207 GO:0004061
GO:0019441

Map