F426762

General Info

Members Datasets Scaffolds Average Seq Length
374 197 748 425

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10002159|Ga0265316_100021593
Length 478
Sequence MRTVKSAGHSCIGAVKARGASIGHYRRVDSRRAAVYRKSPVKILVIGSGGREHALVWRLKQSPEVEKVWCAPGNGGIAEDVECVAVSADDVDGLVALAQQLKPDLTVVGPEVPLVAGIRNKFEFHGLRLVGPSQRDARLEGSKVYSKEFMTRYGIPTACLYGAFESPSEAMLALDAVDWPVVVKADGLCAGKGVLVAEDRAEAEAFIRRLMVRHELGAGGSRVLLEKGLKGEELSFIVLTDGRSFLPMAPSRDHKRIFDGDRGPNTGGMGAYTTDGMISAELESFIADKIVCPTIAGLSQEGIPYTGFLYFGLMLTADGPMVLEYNCRLGDPETQPLMMRMDFDLAAALDAAASRTLHTFKPVWKPGASVCVVMASGGYPGSFNTGKRIEGLAEAKALPEVAVFHAGTKIDHRSIVTSGGRVLGVTATGASLDQAIQKAYQAVGKIKFEGAHCRTDIGAKGTIKSHAFGNASGNTACA

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 2.41
Rhizosphere 96.79
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10002159 3300031344 Bacteria 20675
2 rootL2_10015838 3300003322 Bacteria 5946
3 Ga0070658_10000948 3300005327 Bacteria 24807
4 Ga0070676_10018080 3300005328 Bacteria 3903
5 Ga0070683_100210886 3300005329 Bacteria 1845
6 Ga0070690_100007135 3300005330 Bacteria 6387
7 Ga0070670_100080217 3300005331 Bacteria 2804
8 Ga0070682_100111897 3300005337 Bacteria 1821
9 Ga0068868_100066219 3300005338 Bacteria 2871
10 Ga0068868_100214629 3300005338 Bacteria 1609
11 Ga0070689_100000002 3300005340 Bacteria 695141
12 Ga0070689_100006466 3300005340 Bacteria 8111
13 Ga0070687_100011373 3300005343 Bacteria 3892
14 Ga0070661_100234772 3300005344 Bacteria 1410
15 Ga0070692_10009465 3300005345 Bacteria 4395
16 Ga0070668_100056438 3300005347 Bacteria 3033
17 Ga0070671_100116503 3300005355 Bacteria 2246
18 Ga0070674_100030495 3300005356 Bacteria 3564
19 Ga0070659_100050121 3300005366 Bacteria 3284
20 Ga0070709_10000833 3300005434 Bacteria 17256
21 Ga0070709_10037134 3300005434 Bacteria 2973
22 Ga0070709_10076728 3300005434 Bacteria 2171
23 Ga0070714_100013058 3300005435 Bacteria 6647
24 Ga0070714_100107778 3300005435 Bacteria 2463
25 Ga0070713_100008999 3300005436 Bacteria 7118
26 Ga0070713_100018983 3300005436 Bacteria 5236
27 Ga0070713_100026137 3300005436 Bacteria 4578
28 Ga0070701_10032430 3300005438 Bacteria 2601
29 Ga0070711_100017690 3300005439 Bacteria 4541
30 Ga0070711_100031083 3300005439 Bacteria 3541
31 Ga0070700_100021717 3300005441 Bacteria 3734
32 Ga0070708_100000233 3300005445 Bacteria 41575
33 Ga0070708_100004051 3300005445 Bacteria 11517
34 Ga0070708_100158148 3300005445 Bacteria 2110
35 Ga0070681_10000134 3300005458 Bacteria 56209
36 Ga0070681_10016516 3300005458 Bacteria 7372
37 Ga0068867_100003987 3300005459 Bacteria 10386
38 Ga0068867_100095155 3300005459 Bacteria 2266
39 Ga0070706_100004545 3300005467 Bacteria 13348
40 Ga0070706_100052551 3300005467 Bacteria 3760
41 Ga0070707_100001178 3300005468 Bacteria 25716
42 Ga0070707_100105820 3300005468 Bacteria 2728
43 Ga0070698_100008031 3300005471 Bacteria 11414
44 Ga0070698_100030775 3300005471 Bacteria 5565
45 Ga0070699_100000726 3300005518 Bacteria 30560
46 Ga0070699_100243094 3300005518 Bacteria 1607
47 Ga0070679_100089432 3300005530 Bacteria 3066
48 Ga0070684_100049967 3300005535 Bacteria 3631
49 Ga0070684_100135263 3300005535 Bacteria 2226
50 Ga0070697_100000417 3300005536 Bacteria 32884
51 Ga0068853_100000433 3300005539 Bacteria 28599
52 Ga0068853_100096323 3300005539 Bacteria 2611
53 Ga0070672_100007254 3300005543 Bacteria 7510
54 Ga0070665_100039776 3300005548 Bacteria 4726
55 Ga0070665_100122675 3300005548 Bacteria 2600
56 Ga0068855_100009417 3300005563 Bacteria 11796
57 Ga0068855_100016272 3300005563 Bacteria 8944
58 Ga0068855_100026814 3300005563 Bacteria 6893
59 Ga0068855_100032922 3300005563 Bacteria 6188
60 Ga0068855_100159605 3300005563 Bacteria 2560
61 Ga0070664_100000499 3300005564 Bacteria 29728
62 Ga0070664_100017530 3300005564 Bacteria 5882
63 Ga0068857_100000884 3300005577 Bacteria 22647
64 Ga0068857_100004174 3300005577 Bacteria 12166
65 Ga0068854_100040400 3300005578 Bacteria 3292
66 Ga0068854_100132904 3300005578 Bacteria 1902
67 Ga0068854_100168612 3300005578 Bacteria 1702
68 Ga0068856_100001233 3300005614 Bacteria 26823
69 Ga0068856_100002050 3300005614 Bacteria 20895
70 Ga0068856_100013903 3300005614 Bacteria 7785
71 Ga0068856_100124665 3300005614 Bacteria 2579
72 Ga0068856_100286518 3300005614 Bacteria 1664
73 Ga0068852_100135273 3300005616 Bacteria 2275
74 Ga0068859_100007294 3300005617 Bacteria 11215
75 Ga0068864_100009009 3300005618 Bacteria 8229
76 Ga0068864_100013377 3300005618 Bacteria 6801
77 Ga0068861_100023298 3300005719 Bacteria 4465
78 Ga0068851_10010643 3300005834 Bacteria 4295
79 Ga0068858_100035686 3300005842 Bacteria 4611
80 Ga0068858_100098163 3300005842 Bacteria 2731
81 Ga0068858_100132397 3300005842 Bacteria 2339
82 Ga0068860_100107676 3300005843 Bacteria 2664
83 Ga0068862_100097520 3300005844 Bacteria 2566
84 Ga0070717_10004967 3300006028 Bacteria 9676
85 Ga0070717_10009014 3300006028 Bacteria 7487
86 Ga0070716_100002484 3300006173 Bacteria 8517
87 Ga0070716_100010345 3300006173 Bacteria 4674
88 Ga0070716_100096377 3300006173 Bacteria 1803
89 Ga0070712_100029845 3300006175 Bacteria 3658
90 Ga0097621_100000429 3300006237 Bacteria 29289
91 Ga0097621_100004346 3300006237 Bacteria 9853
92 Ga0068871_100000253 3300006358 Bacteria 37196
93 Ga0068871_100010235 3300006358 Bacteria 6832
94 Ga0068865_100002271 3300006881 Bacteria 11314
95 Ga0075436_100001427 3300006914 Bacteria 16237
96 Ga0097620_100007294 3300006931 Bacteria 11215
97 Ga0075435_100005470 3300007076 Bacteria 8874
98 Ga0099794_10004194 3300007265 Bacteria 5621
99 Ga0099794_10037616 3300007265 Bacteria 2292
100 Ga0099794_10081309 3300007265 Bacteria 1598
101 Ga0105240_10001249 3300009093 Bacteria 44152
102 Ga0105240_10002191 3300009093 Bacteria 31894
103 Ga0105240_10017361 3300009093 Bacteria 9702
104 Ga0105240_10030768 3300009093 Bacteria 6972
105 Ga0105240_10054248 3300009093 Bacteria 5024
106 Ga0105240_10130646 3300009093 Bacteria 3013
107 Ga0105240_10465476 3300009093 Bacteria 1412
108 Ga0105245_10092463 3300009098 Bacteria 2786
109 Ga0105241_10014702 3300009174 Bacteria 5729
110 Ga0105241_10074417 3300009174 Bacteria 2645
111 Ga0105248_10009328 3300009177 Bacteria 10807
112 Ga0105248_10057713 3300009177 Bacteria 4357
113 Ga0105237_10000252 3300009545 Bacteria 76162
114 Ga0105237_10101617 3300009545 Bacteria 2867
115 Ga0105237_10132366 3300009545 Bacteria 2488
116 Ga0105238_10009746 3300009551 Bacteria 9619
117 Ga0105238_10010053 3300009551 Bacteria 9493
118 Ga0105238_10072700 3300009551 Bacteria 3434
119 Ga0105238_10153050 3300009551 Bacteria 2281
120 Ga0105238_10239982 3300009551 Bacteria 1790
121 Ga0105238_10242587 3300009551 Bacteria 1780
122 Ga0105249_10091013 3300009553 Bacteria 2853
123 Ga0105239_10193177 3300010375 Bacteria 2279
124 Ga0105246_10078582 3300011119 Bacteria 2344
125 Ga0157373_10046092 3300013100 Bacteria 3111
126 Ga0157370_10026400 3300013104 Bacteria 5736
127 Ga0157369_10000497 3300013105 Bacteria 52025
128 Ga0157369_10102132 3300013105 Bacteria 3056
129 Ga0157369_10188184 3300013105 Bacteria 2170
130 Ga0157374_10000735 3300013296 Bacteria 28588
131 Ga0157374_10000866 3300013296 Bacteria 26455
132 Ga0157374_10006927 3300013296 Bacteria 9639
133 Ga0157374_10017931 3300013296 Bacteria 6239
134 Ga0157374_10093687 3300013296 Bacteria 2868
135 Ga0157374_10173468 3300013296 Unclassified 2104
136 Ga0157378_10000055 3300013297 Bacteria 97875
137 Ga0157378_10000397 3300013297 Bacteria 42878
138 Ga0157378_10000698 3300013297 Bacteria 31469
139 Ga0163162_10130685 3300013306 Bacteria 2619
140 Ga0157372_10000390 3300013307 Bacteria 48665
141 Ga0157372_10003595 3300013307 Bacteria 16685
142 Ga0157372_10008818 3300013307 Bacteria 10712
143 Ga0157372_10010189 3300013307 Bacteria 9981
144 Ga0157372_10010811 3300013307 Bacteria 9717
145 Ga0157372_10019657 3300013307 Bacteria 7278
146 Ga0157372_10020472 3300013307 Bacteria 7138
147 Ga0163163_10247279 3300014325 Bacteria 1834
148 Ga0182007_10003047 3300015262 Bacteria 8080
149 Ga0207656_10009041 3300025321 Bacteria 3692
150 Ga0207647_10029906 3300025904 Bacteria 3519
151 Ga0207699_10000612 3300025906 Bacteria 17423
152 Ga0207699_10018100 3300025906 Bacteria 3727
153 Ga0207645_10025862 3300025907 Bacteria 3796
154 Ga0207684_10000642 3300025910 Bacteria 41399
155 Ga0207654_10022597 3300025911 Bacteria 3357
156 Ga0207654_10052715 3300025911 Bacteria 2345
157 Ga0207707_10000009 3300025912 Bacteria 300141
158 Ga0207707_10000010 3300025912 Bacteria 295156
159 Ga0207707_10197489 3300025912 Bacteria 1754
160 Ga0207695_10000849 3300025913 Bacteria 56144
161 Ga0207695_10006627 3300025913 Bacteria 14956
162 Ga0207695_10023518 3300025913 Bacteria 6958
163 Ga0207671_10000303 3300025914 Bacteria 72722
164 Ga0207671_10098998 3300025914 Bacteria 2206
165 Ga0207693_10008870 3300025915 Bacteria 8215
166 Ga0207693_10100718 3300025915 Bacteria 2265
167 Ga0207657_10002596 3300025919 Bacteria 19553
168 Ga0207657_10053720 3300025919 Bacteria 3489
169 Ga0207652_10011732 3300025921 Bacteria 7072
170 Ga0207652_10032011 3300025921 Bacteria 4418
171 Ga0207652_10056490 3300025921 Bacteria 3379
172 Ga0207652_10191532 3300025921 Bacteria 1839
173 Ga0207646_10001331 3300025922 Bacteria 30697
174 Ga0207646_10002434 3300025922 Bacteria 21951
175 Ga0207646_10043507 3300025922 Unclassified 4033
176 Ga0207694_10003438 3300025924 Bacteria 12590
177 Ga0207694_10005268 3300025924 Bacteria 9960
178 Ga0207694_10005870 3300025924 Bacteria 9411
179 Ga0207694_10051350 3300025924 Bacteria 3196
180 Ga0207700_10034301 3300025928 Bacteria 3642
181 Ga0207700_10043498 3300025928 Bacteria 3299
182 Ga0207664_10032749 3300025929 Bacteria 3987
183 Ga0207644_10074365 3300025931 Bacteria 2494
184 Ga0207690_10024004 3300025932 Bacteria 3814
185 Ga0207709_10065498 3300025935 Bacteria 2285
186 Ga0207670_10000001 3300025936 Bacteria 949312
187 Ga0207669_10002600 3300025937 Bacteria 7721
188 Ga0207704_10001864 3300025938 Bacteria 9440
189 Ga0207704_10011782 3300025938 Bacteria 4320
190 Ga0207665_10014932 3300025939 Bacteria 5102
191 Ga0207665_10017048 3300025939 Bacteria 4770
192 Ga0207691_10018667 3300025940 Bacteria 6569
193 Ga0207711_10026299 3300025941 Bacteria 4882
194 Ga0207711_10034854 3300025941 Bacteria 4263
195 Ga0207661_10164765 3300025944 Bacteria 1925
196 Ga0207667_10001128 3300025949 Bacteria 33691
197 Ga0207667_10005322 3300025949 Bacteria 15684
198 Ga0207667_10017244 3300025949 Bacteria 8134
199 Ga0207667_10059943 3300025949 Bacteria 3984
200 Ga0207667_10069750 3300025949 Bacteria 3659
201 Ga0207667_10335135 3300025949 Bacteria 1544
202 Ga0207712_10055914 3300025961 Bacteria 2778
203 Ga0207640_10092867 3300025981 Bacteria 2095
204 Ga0207677_10061336 3300026023 Bacteria 2604
205 Ga0207677_10124247 3300026023 Bacteria 1947
206 Ga0207639_10005819 3300026041 Bacteria 8354
207 Ga0207708_10016475 3300026075 Bacteria 5558
208 Ga0207702_10000660 3300026078 Bacteria 37577
209 Ga0207702_10003801 3300026078 Bacteria 13632
210 Ga0207702_10004480 3300026078 Bacteria 12400
211 Ga0207702_10123786 3300026078 Bacteria 2318
212 Ga0207648_10042370 3300026089 Bacteria 3996
213 Ga0207648_10043330 3300026089 Bacteria 3950
214 Ga0207676_10030151 3300026095 Bacteria 4069
215 Ga0207674_10006072 3300026116 Bacteria 14279
216 Ga0207674_10012608 3300026116 Bacteria 9447
217 Ga0207675_100016189 3300026118 Bacteria 6963
218 Ga0268266_10001799 3300028379 Bacteria 24284
219 Ga0268264_10062222 3300028381 Bacteria 3133
220 Ga0265318_10000208 3300028577 Bacteria 50714
221 Ga0265338_10086131 3300028800 Bacteria 2616
222 Ga0265338_10116391 3300028800 Bacteria 2141
223 Ga0265338_10163870 3300028800 Bacteria 1714
224 Ga0265324_10000836 3300029957 Bacteria 19978
225 Ga0265330_10000047 3300031235 Bacteria 106440
226 Ga0265330_10011948 3300031235 Bacteria 4064
227 Ga0265330_10017341 3300031235 Bacteria 3317
228 Ga0265330_10031580 3300031235 Bacteria 2374
229 Ga0265332_10000219 3300031238 Bacteria 45764
230 Ga0265328_10004274 3300031239 Bacteria 6213
231 Ga0265320_10000289 3300031240 Bacteria 40869
232 Ga0265320_10001947 3300031240 Bacteria 14572
233 Ga0265320_10018638 3300031240 Bacteria 3815
234 Ga0265325_10001207 3300031241 Bacteria 18383
235 Ga0265329_10000920 3300031242 Bacteria 14799
236 Ga0265329_10000949 3300031242 Bacteria 14584
237 Ga0265329_10003296 3300031242 Bacteria 7067
238 Ga0265340_10000930 3300031247 Bacteria 16632
239 Ga0265340_10024545 3300031247 Bacteria 3061
240 Ga0265339_10000020 3300031249 Bacteria 175703
241 Ga0265339_10010473 3300031249 Bacteria 5759
242 Ga0265339_10020481 3300031249 Bacteria 3863
243 Ga0265339_10021833 3300031249 Bacteria 3716
244 Ga0265339_10022002 3300031249 Bacteria 3699
245 Ga0265331_10000043 3300031250 Bacteria 189515
246 Ga0265331_10001914 3300031250 Bacteria 14585
247 Ga0265331_10002839 3300031250 Bacteria 11481
248 Ga0265316_10002540 3300031344 Bacteria 18856
249 Ga0265316_10015710 3300031344 Bacteria 6606
250 Ga0265316_10015852 3300031344 Bacteria 6562
251 Ga0265316_10100444 3300031344 Bacteria 2199
252 Ga0265313_10000037 3300031595 Bacteria 124084
253 Ga0265313_10007248 3300031595 Bacteria 7627
254 Ga0265313_10013051 3300031595 Bacteria 5021
255 Ga0265313_10021298 3300031595 Bacteria 3549
256 Ga0265313_10031701 3300031595 Bacteria 2706
257 Ga0265314_10000010 3300031711 Bacteria 445594
258 Ga0265314_10000244 3300031711 Bacteria 79807
259 Ga0265314_10010500 3300031711 Bacteria 7722
260 Ga0265342_10000250 3300031712 Bacteria 60252
261 Ga0265342_10000605 3300031712 Bacteria 37942
262 Ga0265342_10002448 3300031712 Bacteria 16005
263 Ga0265342_10006879 3300031712 Bacteria 8404
264 Ga0265342_10054289 3300031712 Bacteria 2381
265 Ga0307415_100099093 3300032126 Bacteria 2132
266 Ga0316593_10006938 3300032168 Bacteria 3084
267 Ga0316593_10016547 3300032168 Bacteria 2236
268 Ga0373934_0048157 3300035086 Bacteria 1687
269 Ga0373954_0021785 3300035118 Bacteria 2903
270 Ga0373956_0012904 3300035119 Bacteria 3470
271 Ga0373957_0000509 3300035120 Bacteria 9756
272 Ga0373943_0004750 3300035170 Bacteria 6143
273 Ga0373955_0000666 3300035172 Bacteria 14641
274 Ga0373924_0026449 3300035410 Bacteria 2302
275 Ga0373927_0005475 3300035695 Bacteria 8748
276 Ga0373933_0000734 3300035724 Bacteria 20121
277 Ga0373947_0001027 3300035725 Bacteria 17087
278 Ga0373937_0000526 3300036401 Bacteria 34215
279 Ga0373937_0062388 3300036401 Bacteria 3427
280 Ga0373925_0001378 3300037068 Bacteria 21148
281 Ga0373925_0001935 3300037068 Bacteria 17135
282 Ga0373925_0128464 3300037068 Bacteria 1974
283 Ga0453683_0005053 3300044673 Bacteria 9262
284 Ga0453683_0008640 3300044673 Bacteria 6831
285 Ga0453684_0000470 3300044712 Bacteria 160002
286 Ga0453684_0004135 3300044712 Bacteria 31425
287 Ga0453684_0069863 3300044712 Bacteria 4452
288 Ga0453684_0121331 3300044712 Bacteria 3155
289 Ga0451576_0399063 3300045051 Bacteria 1442
290 Ga0466967_0141530 3300045976 Bacteria 2241
291 Ga0495651_0000576 3300046462 Bacteria 28460
292 Ga0495651_0012156 3300046462 Bacteria 6628
293 Ga0495651_0017404 3300046462 Bacteria 5566
294 Ga0495651_0023143 3300046462 Bacteria 4832
295 Ga0495651_0035945 3300046462 Bacteria 3856
296 Ga0495653_0007147 3300046463 Bacteria 9148
297 Ga0495653_0017409 3300046463 Bacteria 5845
298 Ga0495653_0105823 3300046463 Bacteria 2030
299 Ga0495650_0000006 3300046471 Bacteria 721347
300 Ga0495580_0004244 3300046472 Bacteria 12062
301 Ga0495580_0025019 3300046472 Bacteria 4365
302 Ga0495582_0000341 3300046473 Bacteria 25620
303 Ga0495664_0015727 3300046477 Bacteria 4306
304 Ga0495664_0038129 3300046477 Bacteria 2837
305 Ga0495608_0032586 3300046511 Bacteria 3522
306 Ga0495608_0071515 3300046511 Bacteria 2263
307 Ga0495618_0072712 3300046514 Bacteria 2188
308 Ga0495628_0002946 3300046516 Bacteria 15270
309 Ga0495630_0003116 3300046517 Bacteria 11495
310 Ga0495666_0010695 3300046526 Bacteria 4576
311 Ga0495666_0026368 3300046526 Bacteria 2865
312 Ga0495652_0029060 3300046529 Bacteria 4857
313 Ga0495652_0150277 3300046529 Bacteria 1821
314 Ga0495665_0002210 3300046531 Bacteria 10543
315 Ga0495665_0004962 3300046531 Bacteria 7170
316 Ga0495640_0044314 3300046533 Bacteria 3094
317 Ga0495586_0003216 3300046535 Bacteria 8776
318 Ga0495587_0006129 3300046536 Bacteria 7847
319 Ga0495587_0041295 3300046536 Bacteria 2753
320 Ga0495645_0060729 3300046543 Bacteria 2740
321 Ga0495645_0069272 3300046543 Bacteria 2546
322 Ga0495667_0001179 3300046559 Bacteria 17083
323 Ga0495667_0006590 3300046559 Bacteria 7882
324 Ga0495634_0051182 3300046642 Bacteria 2772
325 Ga0495625_0003275 3300046660 Bacteria 16368
326 Ga0495625_0038536 3300046660 Bacteria 3498
327 Ga0495635_0030355 3300046663 Bacteria 3756
328 Ga0495657_0022780 3300046675 Bacteria 4482
329 Ga0495657_0058949 3300046675 Bacteria 2547
330 Ga0495657_0081238 3300046675 Bacteria 2096
331 Ga0495657_0087600 3300046675 Bacteria 2003
332 Ga0495599_0064312 3300046678 Bacteria 2292
333 Ga0495623_0003589 3300046679 Bacteria 10258
334 Ga0495623_0033504 3300046679 Bacteria 3296
335 Ga0495646_0032558 3300046680 Bacteria 3245
336 Ga0495600_0001156 3300046809 Bacteria 14402
337 Ga0495600_0068844 3300046809 Bacteria 2313
338 Ga0495604_0000234 3300047317 Bacteria 49895
339 Ga0495604_0003374 3300047317 Bacteria 12736
340 Ga0495674_0031462 3300047319 Bacteria 4820
341 Ga0495674_0055138 3300047319 Bacteria 3487
342 Ga0495674_0101420 3300047319 Bacteria 2448
343 Ga0495674_0163965 3300047319 Bacteria 1858
344 Ga0495672_0001406 3300047320 Bacteria 23700
345 Ga0495680_0001207 3300047322 Bacteria 28312
346 Ga0495680_0008170 3300047322 Bacteria 9541
347 Ga0495680_0119560 3300047322 Bacteria 1946
348 Ga0495675_0000035 3300047444 Bacteria 95152
349 Ga0495675_0003726 3300047444 Bacteria 9216
350 Ga0495675_0074741 3300047444 Unclassified 2135
351 Ga0495675_0089209 3300047444 Bacteria 1936
352 Ga0495675_0118630 3300047444 Bacteria 1648
353 Ga0495684_0000874 3300047471 Bacteria 24500
354 Ga0495684_0027766 3300047471 Bacteria 4346
355 Ga0495684_0028692 3300047471 Bacteria 4272
356 Ga0495684_0227595 3300047471 Bacteria 1365
357 Ga0495593_0019392 3300047673 Bacteria 3813
358 Ga0495602_0092652 3300048088 Bacteria 2502
359 Ga0495614_0044217 3300048089 Bacteria 1910
360 Ga0496101_0211445 3300048904 Bacteria 1503
361 Ga0496102_0120979 3300048905 Bacteria 2445
362 Ga0496107_0044988 3300048910 Bacteria 3175
363 Ga0496111_0092789 3300048914 Bacteria 2213
364 Ga0496112_0101739 3300048915 Bacteria 2843
365 Ga0496112_0175698 3300048915 Bacteria 2107
366 Ga0496112_0326543 3300048915 Bacteria 1478
367 Ga0496113_0156052 3300048916 Bacteria 1802
368 Ga0496114_0176326 3300048917 Bacteria 1865
369 Ga0496126_0000018 3300048929 Bacteria 581170
370 Ga0501067_0121101 3300049583 Bacteria 1456
371 nmdc:mga0rr50_1813_c1 3300050513 Bacteria 11811
372 nmdc:mga08x19_3169_c1 3300050514 Bacteria 9869
373 Ga0495612_0003197 3300053078 Bacteria 6788
374 Ga0500651_0000039 3300053093 Bacteria 96498
375 Ga0265316_10002159
376 rootL2_10015838
377 Ga0070658_10000948
378 Ga0070676_10018080
379 Ga0070683_100210886
380 Ga0070690_100007135
381 Ga0070670_100080217
382 Ga0070682_100111897
383 Ga0068868_100066219
384 Ga0068868_100214629
385 Ga0070689_100000002
386 Ga0070689_100006466
387 Ga0070687_100011373
388 Ga0070661_100234772
389 Ga0070692_10009465
390 Ga0070668_100056438
391 Ga0070671_100116503
392 Ga0070674_100030495
393 Ga0070659_100050121
394 Ga0070709_10000833
395 Ga0070709_10037134
396 Ga0070709_10076728
397 Ga0070714_100013058
398 Ga0070714_100107778
399 Ga0070713_100008999
400 Ga0070713_100018983
401 Ga0070713_100026137
402 Ga0070701_10032430
403 Ga0070711_100017690
404 Ga0070711_100031083
405 Ga0070700_100021717
406 Ga0070708_100000233
407 Ga0070708_100004051
408 Ga0070708_100158148
409 Ga0070681_10000134
410 Ga0070681_10016516
411 Ga0068867_100003987
412 Ga0068867_100095155
413 Ga0070706_100004545
414 Ga0070706_100052551
415 Ga0070707_100001178
416 Ga0070707_100105820
417 Ga0070698_100008031
418 Ga0070698_100030775
419 Ga0070699_100000726
420 Ga0070699_100243094
421 Ga0070679_100089432
422 Ga0070684_100049967
423 Ga0070684_100135263
424 Ga0070697_100000417
425 Ga0068853_100000433
426 Ga0068853_100096323
427 Ga0070672_100007254
428 Ga0070665_100039776
429 Ga0070665_100122675
430 Ga0068855_100009417
431 Ga0068855_100016272
432 Ga0068855_100026814
433 Ga0068855_100032922
434 Ga0068855_100159605
435 Ga0070664_100000499
436 Ga0070664_100017530
437 Ga0068857_100000884
438 Ga0068857_100004174
439 Ga0068854_100040400
440 Ga0068854_100132904
441 Ga0068854_100168612
442 Ga0068856_100001233
443 Ga0068856_100002050
444 Ga0068856_100013903
445 Ga0068856_100124665
446 Ga0068856_100286518
447 Ga0068852_100135273
448 Ga0068859_100007294
449 Ga0068864_100009009
450 Ga0068864_100013377
451 Ga0068861_100023298
452 Ga0068851_10010643
453 Ga0068858_100035686
454 Ga0068858_100098163
455 Ga0068858_100132397
456 Ga0068860_100107676
457 Ga0068862_100097520
458 Ga0070717_10004967
459 Ga0070717_10009014
460 Ga0070716_100002484
461 Ga0070716_100010345
462 Ga0070716_100096377
463 Ga0070712_100029845
464 Ga0097621_100000429
465 Ga0097621_100004346
466 Ga0068871_100000253
467 Ga0068871_100010235
468 Ga0068865_100002271
469 Ga0075436_100001427
470 Ga0097620_100007294
471 Ga0075435_100005470
472 Ga0099794_10004194
473 Ga0099794_10037616
474 Ga0099794_10081309
475 Ga0105240_10001249
476 Ga0105240_10002191
477 Ga0105240_10017361
478 Ga0105240_10030768
479 Ga0105240_10054248
480 Ga0105240_10130646
481 Ga0105240_10465476
482 Ga0105245_10092463
483 Ga0105241_10014702
484 Ga0105241_10074417
485 Ga0105248_10009328
486 Ga0105248_10057713
487 Ga0105237_10000252
488 Ga0105237_10101617
489 Ga0105237_10132366
490 Ga0105238_10009746
491 Ga0105238_10010053
492 Ga0105238_10072700
493 Ga0105238_10153050
494 Ga0105238_10239982
495 Ga0105238_10242587
496 Ga0105249_10091013
497 Ga0105239_10193177
498 Ga0105246_10078582
499 Ga0157373_10046092
500 Ga0157370_10026400
501 Ga0157369_10000497
502 Ga0157369_10102132
503 Ga0157369_10188184
504 Ga0157374_10000735
505 Ga0157374_10000866
506 Ga0157374_10006927
507 Ga0157374_10017931
508 Ga0157374_10093687
509 Ga0157374_10173468
510 Ga0157378_10000055
511 Ga0157378_10000397
512 Ga0157378_10000698
513 Ga0163162_10130685
514 Ga0157372_10000390
515 Ga0157372_10003595
516 Ga0157372_10008818
517 Ga0157372_10010189
518 Ga0157372_10010811
519 Ga0157372_10019657
520 Ga0157372_10020472
521 Ga0163163_10247279
522 Ga0182007_10003047
523 Ga0207656_10009041
524 Ga0207647_10029906
525 Ga0207699_10000612
526 Ga0207699_10018100
527 Ga0207645_10025862
528 Ga0207684_10000642
529 Ga0207654_10022597
530 Ga0207654_10052715
531 Ga0207707_10000009
532 Ga0207707_10000010
533 Ga0207707_10197489
534 Ga0207695_10000849
535 Ga0207695_10006627
536 Ga0207695_10023518
537 Ga0207671_10000303
538 Ga0207671_10098998
539 Ga0207693_10008870
540 Ga0207693_10100718
541 Ga0207657_10002596
542 Ga0207657_10053720
543 Ga0207652_10011732
544 Ga0207652_10032011
545 Ga0207652_10056490
546 Ga0207652_10191532
547 Ga0207646_10001331
548 Ga0207646_10002434
549 Ga0207646_10043507
550 Ga0207694_10003438
551 Ga0207694_10005268
552 Ga0207694_10005870
553 Ga0207694_10051350
554 Ga0207700_10034301
555 Ga0207700_10043498
556 Ga0207664_10032749
557 Ga0207644_10074365
558 Ga0207690_10024004
559 Ga0207709_10065498
560 Ga0207670_10000001
561 Ga0207669_10002600
562 Ga0207704_10001864
563 Ga0207704_10011782
564 Ga0207665_10014932
565 Ga0207665_10017048
566 Ga0207691_10018667
567 Ga0207711_10026299
568 Ga0207711_10034854
569 Ga0207661_10164765
570 Ga0207667_10001128
571 Ga0207667_10005322
572 Ga0207667_10017244
573 Ga0207667_10059943
574 Ga0207667_10069750
575 Ga0207667_10335135
576 Ga0207712_10055914
577 Ga0207640_10092867
578 Ga0207677_10061336
579 Ga0207677_10124247
580 Ga0207639_10005819
581 Ga0207708_10016475
582 Ga0207702_10000660
583 Ga0207702_10003801
584 Ga0207702_10004480
585 Ga0207702_10123786
586 Ga0207648_10042370
587 Ga0207648_10043330
588 Ga0207676_10030151
589 Ga0207674_10006072
590 Ga0207674_10012608
591 Ga0207675_100016189
592 Ga0268266_10001799
593 Ga0268264_10062222
594 Ga0265318_10000208
595 Ga0265338_10086131
596 Ga0265338_10116391
597 Ga0265338_10163870
598 Ga0265324_10000836
599 Ga0265330_10000047
600 Ga0265330_10011948
601 Ga0265330_10017341
602 Ga0265330_10031580
603 Ga0265332_10000219
604 Ga0265328_10004274
605 Ga0265320_10000289
606 Ga0265320_10001947
607 Ga0265320_10018638
608 Ga0265325_10001207
609 Ga0265329_10000920
610 Ga0265329_10000949
611 Ga0265329_10003296
612 Ga0265340_10000930
613 Ga0265340_10024545
614 Ga0265339_10000020
615 Ga0265339_10010473
616 Ga0265339_10020481
617 Ga0265339_10021833
618 Ga0265339_10022002
619 Ga0265331_10000043
620 Ga0265331_10001914
621 Ga0265331_10002839
622 Ga0265316_10002540
623 Ga0265316_10015710
624 Ga0265316_10015852
625 Ga0265316_10100444
626 Ga0265313_10000037
627 Ga0265313_10007248
628 Ga0265313_10013051
629 Ga0265313_10021298
630 Ga0265313_10031701
631 Ga0265314_10000010
632 Ga0265314_10000244
633 Ga0265314_10010500
634 Ga0265342_10000250
635 Ga0265342_10000605
636 Ga0265342_10002448
637 Ga0265342_10006879
638 Ga0265342_10054289
639 Ga0307415_100099093
640 Ga0316593_10006938
641 Ga0316593_10016547
642 Ga0373934_0048157
643 Ga0373954_0021785
644 Ga0373956_0012904
645 Ga0373957_0000509
646 Ga0373943_0004750
647 Ga0373955_0000666
648 Ga0373924_0026449
649 Ga0373927_0005475
650 Ga0373933_0000734
651 Ga0373947_0001027
652 Ga0373937_0000526
653 Ga0373937_0062388
654 Ga0373925_0001378
655 Ga0373925_0001935
656 Ga0373925_0128464
657 Ga0453683_0005053
658 Ga0453683_0008640
659 Ga0453684_0000470
660 Ga0453684_0004135
661 Ga0453684_0069863
662 Ga0453684_0121331
663 Ga0451576_0399063
664 Ga0466967_0141530
665 Ga0495651_0000576
666 Ga0495651_0012156
667 Ga0495651_0017404
668 Ga0495651_0023143
669 Ga0495651_0035945
670 Ga0495653_0007147
671 Ga0495653_0017409
672 Ga0495653_0105823
673 Ga0495650_0000006
674 Ga0495580_0004244
675 Ga0495580_0025019
676 Ga0495582_0000341
677 Ga0495664_0015727
678 Ga0495664_0038129
679 Ga0495608_0032586
680 Ga0495608_0071515
681 Ga0495618_0072712
682 Ga0495628_0002946
683 Ga0495630_0003116
684 Ga0495666_0010695
685 Ga0495666_0026368
686 Ga0495652_0029060
687 Ga0495652_0150277
688 Ga0495665_0002210
689 Ga0495665_0004962
690 Ga0495640_0044314
691 Ga0495586_0003216
692 Ga0495587_0006129
693 Ga0495587_0041295
694 Ga0495645_0060729
695 Ga0495645_0069272
696 Ga0495667_0001179
697 Ga0495667_0006590
698 Ga0495634_0051182
699 Ga0495625_0003275
700 Ga0495625_0038536
701 Ga0495635_0030355
702 Ga0495657_0022780
703 Ga0495657_0058949
704 Ga0495657_0081238
705 Ga0495657_0087600
706 Ga0495599_0064312
707 Ga0495623_0003589
708 Ga0495623_0033504
709 Ga0495646_0032558
710 Ga0495600_0001156
711 Ga0495600_0068844
712 Ga0495604_0000234
713 Ga0495604_0003374
714 Ga0495674_0031462
715 Ga0495674_0055138
716 Ga0495674_0101420
717 Ga0495674_0163965
718 Ga0495672_0001406
719 Ga0495680_0001207
720 Ga0495680_0008170
721 Ga0495680_0119560
722 Ga0495675_0000035
723 Ga0495675_0003726
724 Ga0495675_0074741
725 Ga0495675_0089209
726 Ga0495675_0118630
727 Ga0495684_0000874
728 Ga0495684_0027766
729 Ga0495684_0028692
730 Ga0495684_0227595
731 Ga0495593_0019392
732 Ga0495602_0092652
733 Ga0495614_0044217
734 Ga0496101_0211445
735 Ga0496102_0120979
736 Ga0496107_0044988
737 Ga0496111_0092789
738 Ga0496112_0101739
739 Ga0496112_0175698
740 Ga0496112_0326543
741 Ga0496113_0156052
742 Ga0496114_0176326
743 Ga0496126_0000018
744 Ga0501067_0121101
745 nmdc:mga0rr50_1813_c1
746 nmdc:mga08x19_3169_c1
747 Ga0495612_0003197
748 Ga0500651_0000039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01071

GARS_A

Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain

141

334

0.99

PF02844

GARS_N

Phosphoribosylglycinamide synthetase, N domain

41

140

0.99

PF02843

GARS_C

Phosphoribosylglycinamide synthetase, C domain

369

460

0.96

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

142

246

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yw2-assembly1.cif.gz_A crystal structure of gar synthetase from aquifex aeolicus in complex with atp 0.9615 9 435
2xd4-assembly1.cif.gz_A nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase 0.9593 9 441
2xd4-assembly1.cif.gz_A nucleotide-bound structures of bacillus subtilis glycinamide ribonucleotide synthetase 0.9549 9 441
2qk4-assembly1.cif.gz_A human glycinamide ribonucleotide synthetase 0.9492 6 433
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.9476 8 433
ID Description Score Start End Superfamily
af_A0A1D8PE67_198_337_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9813 203 340 3.30.470.20
af_P22102_333_434_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9667 344 438 3.90.600.10
af_A0A1D8PE67_198_337_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9607 203 340 3.30.470.20
2ip4B03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9601 203 338 3.30.470.20
af_Q20143_326_420_3.90.600.10 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9592 344 433 3.90.600.10
ID Description Score Start End GO Terms
AF-A0A3B9F6K8-F1-model_v4 Glycinamide ribonucleotide synthetase (Phosphoribosylglycinamide synthetase) 0.9874 344 436 GO:0000166
GO:0004637
GO:0009113
AF-A0A3D1IFL2-F1-model_v4 Glycinamide ribonucleotide synthetase (Phosphoribosylglycinamide synthetase) 0.9862 344 436 GO:0000166
GO:0004637
GO:0009113
AF-A0A352WHB3-F1-model_v4 Phosphoribosylamine--glycine ligase 0.9808 68 307 GO:0004637
GO:0005524
GO:0009113
GO:0046872
AF-V9GJ44-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9804 77 432 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A7J5JA13-F1-model_v4 Glycinamide ribonucleotide synthetase (Phosphoribosylglycinamide synthetase) 0.9795 226 433 GO:0000166
GO:0004637
GO:0006164
GO:0009113

Map