F426593

General Info

Members Datasets Scaffolds Average Seq Length
374 186 374 155

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10003561|Ga0070676_100035611
Length 174
Sequence MHNGQELLNWPAFSVIHYLRMPKLSAGILVYRVKNKEIEVFLCHPGGPFYKNKDNGVWTIPKGEFDENEEAFAAAKREFKEETGQEIRGDFIPMRPIRYKDGKKIVYAWAVNGNIDATNIKSNTFPLEWPPKSGKFMEVPEVDRGGWFNIEVAKQKILPSLSLLLEDLVENVSR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
181 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 1.07
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10385838 3300005293 Unclassified 901
2 Ga0065707_10112682 3300005295 Bacteria 2352
3 Ga0070676_10003561 3300005328 Bacteria 8146
4 Ga0070676_10007326 3300005328 Bacteria 5919
5 Ga0070683_100000327 3300005329 Bacteria 32861
6 Ga0070683_100047705 3300005329 Bacteria 3958
7 Ga0070683_100065898 3300005329 Bacteria 3373
8 Ga0070683_100506244 3300005329 Bacteria 1154
9 Ga0070683_101048606 3300005329 Bacteria 783
10 Ga0070683_101099796 3300005329 Bacteria 763
11 Ga0070690_100256042 3300005330 Unclassified 1240
12 Ga0070670_100031189 3300005331 Bacteria 4590
13 Ga0070670_100170772 3300005331 Bacteria 1886
14 Ga0068869_100004762 3300005334 Bacteria 8468
15 Ga0068869_100079023 3300005334 Bacteria 2451
16 Ga0068869_100082645 3300005334 Bacteria 2401
17 Ga0068869_100089639 3300005334 Bacteria 2310
18 Ga0070666_10060519 3300005335 Unclassified 2563
19 Ga0070666_10239028 3300005335 Bacteria 1284
20 Ga0070666_10553267 3300005335 Bacteria 837
21 Ga0070682_100062927 3300005337 Bacteria 2351
22 Ga0070682_100265603 3300005337 Archaea 1244
23 Ga0068868_100001123 3300005338 Bacteria 18309
24 Ga0068868_100133722 3300005338 Bacteria 2031
25 Ga0070689_100039628 3300005340 Bacteria 3609
26 Ga0070689_100042612 3300005340 Bacteria 3485
27 Ga0070689_100322178 3300005340 Bacteria 1291
28 Ga0070689_100458379 3300005340 Bacteria 1086
29 Ga0070689_101261280 3300005340 Bacteria 665
30 Ga0070687_100004644 3300005343 Bacteria 5489
31 Ga0070661_100001196 3300005344 Bacteria 18334
32 Ga0070661_100006373 3300005344 Bacteria 8139
33 Ga0070661_100253416 3300005344 Bacteria 1359
34 Ga0070668_100044928 3300005347 Bacteria 3389
35 Ga0070669_100877253 3300005353 Unclassified 765
36 Ga0070675_100048368 3300005354 Bacteria 3487
37 Ga0070675_100085838 3300005354 Bacteria 2630
38 Ga0070675_100352563 3300005354 Bacteria 1305
39 Ga0070671_100065215 3300005355 Bacteria 3033
40 Ga0070671_100250193 3300005355 Unclassified 1505
41 Ga0070671_100475885 3300005355 Bacteria 1073
42 Ga0070671_100513676 3300005355 Bacteria 1031
43 Ga0070671_100631503 3300005355 Bacteria 927
44 Ga0070674_101081394 3300005356 Bacteria 707
45 Ga0070673_100041208 3300005364 Bacteria 3549
46 Ga0070673_100123089 3300005364 Bacteria 2167
47 Ga0070673_100264352 3300005364 Bacteria 1504
48 Ga0070688_100030527 3300005365 Bacteria 3236
49 Ga0070688_100035603 3300005365 Bacteria 3025
50 Ga0070688_100075619 3300005365 Bacteria 2165
51 Ga0070688_100512537 3300005365 Bacteria 906
52 Ga0070659_100002952 3300005366 Bacteria 12126
53 Ga0070667_100024615 3300005367 Bacteria 5001
54 Ga0070667_100260148 3300005367 Bacteria 1554
55 Ga0070667_100917018 3300005367 Bacteria 816
56 Ga0070709_10744550 3300005434 Bacteria 765
57 Ga0070701_10276808 3300005438 Bacteria 1023
58 Ga0070701_10342461 3300005438 Bacteria 931
59 Ga0070708_100111088 3300005445 Bacteria 2519
60 Ga0070663_100059505 3300005455 Bacteria 2745
61 Ga0070678_100067398 3300005456 Bacteria 2664
62 Ga0070662_100018489 3300005457 Bacteria 4715
63 Ga0070662_100088366 3300005457 Bacteria 2322
64 Ga0070662_100716941 3300005457 Bacteria 847
65 Ga0068867_100055040 3300005459 Bacteria 2940
66 Ga0070685_10054358 3300005466 Bacteria 2323
67 Ga0070685_10217511 3300005466 Bacteria 1250
68 Ga0070706_100195567 3300005467 Unclassified 1889
69 Ga0070706_100596539 3300005467 Bacteria 1026
70 Ga0070707_100067112 3300005468 Unclassified 3450
71 Ga0070707_100089011 3300005468 Unclassified 2987
72 Ga0070679_100095496 3300005530 Bacteria 2960
73 Ga0070684_100000290 3300005535 Bacteria 34902
74 Ga0070684_100014260 3300005535 Bacteria 6432
75 Ga0070684_100069315 3300005535 Unclassified 3102
76 Ga0070684_102022711 3300005535 Bacteria 544
77 Ga0070697_100044119 3300005536 Bacteria 3611
78 Ga0068853_100000837 3300005539 Bacteria 21517
79 Ga0068853_100139992 3300005539 Unclassified 2172
80 Ga0068853_100165057 3300005539 Bacteria 2001
81 Ga0068853_101065200 3300005539 Bacteria 779
82 Ga0068853_101380764 3300005539 Bacteria 681
83 Ga0070672_100708401 3300005543 Bacteria 882
84 Ga0070686_100042877 3300005544 Bacteria 2836
85 Ga0070686_100166374 3300005544 Bacteria 1556
86 Ga0070686_100345842 3300005544 Bacteria 1116
87 Ga0070693_100758166 3300005547 Bacteria 716
88 Ga0070665_100308500 3300005548 Bacteria 1586
89 Ga0070665_100998826 3300005548 Bacteria 849
90 Ga0070704_100178262 3300005549 Unclassified 1697
91 Ga0068855_100115577 3300005563 Bacteria 3076
92 Ga0070664_100000509 3300005564 Bacteria 29514
93 Ga0070664_100005422 3300005564 Bacteria 10239
94 Ga0070664_100091591 3300005564 Bacteria 2632
95 Ga0070664_100196571 3300005564 Bacteria 1798
96 Ga0070664_100304353 3300005564 Bacteria 1441
97 Ga0070664_100360707 3300005564 Bacteria 1323
98 Ga0070664_100369247 3300005564 Bacteria 1308
99 Ga0070664_100509413 3300005564 Bacteria 1110
100 Ga0068857_100000579 3300005577 Bacteria 26747
101 Ga0068857_100146913 3300005577 Bacteria 2133
102 Ga0068857_100182538 3300005577 Bacteria 1910
103 Ga0068854_100129860 3300005578 Bacteria 1923
104 Ga0070702_100892435 3300005615 Bacteria 695
105 Ga0068852_100069417 3300005616 Bacteria 3089
106 Ga0068852_101610522 3300005616 Bacteria 672
107 Ga0068859_100072558 3300005617 Bacteria 3479
108 Ga0068859_100106689 3300005617 Bacteria 2860
109 Ga0068859_100158012 3300005617 Bacteria 2345
110 Ga0068864_100038625 3300005618 Bacteria 4078
111 Ga0068864_100608992 3300005618 Bacteria 1061
112 Ga0068864_100634530 3300005618 Unclassified 1039
113 Ga0068866_10102031 3300005718 Bacteria 1585
114 Ga0068866_10165857 3300005718 Bacteria 1292
115 Ga0068861_100742765 3300005719 Bacteria 916
116 Ga0068861_101476661 3300005719 Unclassified 666
117 Ga0068851_10048940 3300005834 Bacteria 2143
118 Ga0068851_10080304 3300005834 Bacteria 1702
119 Ga0068870_10211699 3300005840 Bacteria 1181
120 Ga0068870_10892456 3300005840 Bacteria 627
121 Ga0068863_100093742 3300005841 Unclassified 2849
122 Ga0068863_100273900 3300005841 Bacteria 1634
123 Ga0068863_100309637 3300005841 Bacteria 1533
124 Ga0068858_100041342 3300005842 Bacteria 4275
125 Ga0068858_100157878 3300005842 Bacteria 2134
126 Ga0068858_100240604 3300005842 Bacteria 1717
127 Ga0068858_100673120 3300005842 Bacteria 1006
128 Ga0068862_101589032 3300005844 Bacteria 661
129 Ga0081539_10331905 3300005985 Bacteria 644
130 Ga0070717_10053471 3300006028 Unclassified 3329
131 Ga0070717_10314762 3300006028 Unclassified 1394
132 Ga0070717_10567857 3300006028 Unclassified 1028
133 Ga0070716_100923013 3300006173 Unclassified 685
134 Ga0068871_100156174 3300006358 Unclassified 1948
135 Ga0068871_100350147 3300006358 Bacteria 1306
136 Ga0068871_100531484 3300006358 Bacteria 1063
137 Ga0075434_101501839 3300006871 Bacteria 683
138 Ga0068865_100089857 3300006881 Bacteria 2226
139 Ga0068865_100343040 3300006881 Unclassified 1208
140 Ga0068865_100671716 3300006881 Bacteria 882
141 Ga0068865_100960987 3300006881 Bacteria 746
142 Ga0075436_100047892 3300006914 Bacteria 2949
143 Ga0075436_100711448 3300006914 Unclassified 744
144 Ga0097620_100072554 3300006931 Bacteria 3479
145 Ga0097620_100106695 3300006931 Bacteria 2860
146 Ga0097620_100158004 3300006931 Bacteria 2345
147 Ga0075435_100291670 3300007076 Bacteria 1394
148 Ga0075435_100885883 3300007076 Unclassified 778
149 Ga0105251_10056345 3300009011 Bacteria 1860
150 Ga0105240_10000011 3300009093 Bacteria 523646
151 Ga0105247_10174303 3300009101 Bacteria 1432
152 Ga0105241_10649052 3300009174 Bacteria 958
153 Ga0105242_10025593 3300009176 Bacteria 4671
154 Ga0105242_10068152 3300009176 Bacteria 2943
155 Ga0105242_10212518 3300009176 Bacteria 1725
156 Ga0105242_10851847 3300009176 Bacteria 907
157 Ga0105248_10451312 3300009177 Bacteria 1449
158 Ga0105248_12447371 3300009177 Bacteria 595
159 Ga0105237_10634780 3300009545 Bacteria 1075
160 Ga0105237_11434094 3300009545 Bacteria 697
161 Ga0105249_10017160 3300009553 Bacteria 6426
162 Ga0105249_10219339 3300009553 Unclassified 1871
163 Ga0105249_10371616 3300009553 Bacteria 1454
164 Ga0105239_10001802 3300010375 Bacteria 28139
165 Ga0105239_10249609 3300010375 Bacteria 1993
166 Ga0157373_10285514 3300013100 Bacteria 1170
167 Ga0157373_10646606 3300013100 Bacteria 772
168 Ga0157373_11552118 3300013100 Bacteria 506
169 Ga0157371_10257474 3300013102 Unclassified 1258
170 Ga0157371_10337058 3300013102 Bacteria 1096
171 Ga0157371_10542135 3300013102 Bacteria 862
172 Ga0157374_10000587 3300013296 Bacteria 32144
173 Ga0157374_10004126 3300013296 Bacteria 12197
174 Ga0157374_10062741 3300013296 Bacteria 3484
175 Ga0157374_10070413 3300013296 Bacteria 3296
176 Ga0157378_10353826 3300013297 Bacteria 1435
177 Ga0157378_11062115 3300013297 Bacteria 846
178 Ga0157378_11288325 3300013297 Bacteria 772
179 Ga0163162_10002830 3300013306 Bacteria 16503
180 Ga0163162_10003298 3300013306 Bacteria 15443
181 Ga0163162_10027155 3300013306 Bacteria 5660
182 Ga0163162_10043940 3300013306 Bacteria 4474
183 Ga0163162_10131290 3300013306 Bacteria 2613
184 Ga0163162_11131298 3300013306 Unclassified 888
185 Ga0163162_11466740 3300013306 Bacteria 777
186 Ga0163162_11747971 3300013306 Bacteria 711
187 Ga0157372_10097611 3300013307 Bacteria 3351
188 Ga0157372_10459151 3300013307 Bacteria 1484
189 Ga0157372_10692648 3300013307 Bacteria 1186
190 Ga0157372_11976203 3300013307 Unclassified 670
191 Ga0157375_10034885 3300013308 Bacteria 4796
192 Ga0157375_10114623 3300013308 Bacteria 2797
193 Ga0157375_10496552 3300013308 Bacteria 1385
194 Ga0157375_10877765 3300013308 Bacteria 1042
195 Ga0157375_11834858 3300013308 Unclassified 719
196 Ga0157375_11981290 3300013308 Bacteria 692
197 Ga0163163_10000867 3300014325 Bacteria 25795
198 Ga0163163_10094907 3300014325 Bacteria 3001
199 Ga0163163_10567556 3300014325 Bacteria 1198
200 Ga0157380_10197014 3300014326 Unclassified 1784
201 Ga0157380_10696399 3300014326 Bacteria 1020
202 Ga0157380_10944007 3300014326 Bacteria 892
203 Ga0157377_10014776 3300014745 Bacteria 3979
204 Ga0157377_10119169 3300014745 Bacteria 1597
205 Ga0157379_10011401 3300014968 Bacteria 7756
206 Ga0157379_10036734 3300014968 Bacteria 4368
207 Ga0157376_10025221 3300014969 Bacteria 4680
208 Ga0157376_10332882 3300014969 Bacteria 1447
209 Ga0157376_10881317 3300014969 Bacteria 912
210 Ga0157376_13042198 3300014969 Bacteria 508
211 Ga0163161_10008580 3300017792 Bacteria 7066
212 Ga0163161_10137801 3300017792 Bacteria 1846
213 Ga0213876_10001314 3300021384 Bacteria 15620
214 Ga0207666_1051246 3300025271 Bacteria 655
215 Ga0207697_10007958 3300025315 Bacteria 4683
216 Ga0207656_10672946 3300025321 Archaea 529
217 Ga0207642_10097931 3300025899 Bacteria 1465
218 Ga0207642_10116889 3300025899 Bacteria 1368
219 Ga0207710_10380953 3300025900 Bacteria 722
220 Ga0207680_10170480 3300025903 Bacteria 1465
221 Ga0207680_10278395 3300025903 Bacteria 1162
222 Ga0207647_10012261 3300025904 Bacteria 5972
223 Ga0207699_10650094 3300025906 Bacteria 770
224 Ga0207645_10008204 3300025907 Bacteria 7307
225 Ga0207645_10008964 3300025907 Bacteria 6946
226 Ga0207643_10113308 3300025908 Bacteria 1599
227 Ga0207643_10723957 3300025908 Unclassified 643
228 Ga0207684_10021687 3300025910 Bacteria 5484
229 Ga0207684_10583957 3300025910 Unclassified 955
230 Ga0207654_10186899 3300025911 Bacteria 1355
231 Ga0207654_10205078 3300025911 Bacteria 1300
232 Ga0207654_10297204 3300025911 Bacteria 1097
233 Ga0207695_10000010 3300025913 Bacteria 981919
234 Ga0207660_10579762 3300025917 Bacteria 913
235 Ga0207662_10007911 3300025918 Bacteria 5789
236 Ga0207649_10000567 3300025920 Bacteria 25427
237 Ga0207649_10331189 3300025920 Bacteria 1122
238 Ga0207646_10000774 3300025922 Bacteria 41404
239 Ga0207646_10103704 3300025922 Bacteria 2551
240 Ga0207646_10244230 3300025922 Bacteria 1622
241 Ga0207681_10021587 3300025923 Bacteria 4095
242 Ga0207681_10404340 3300025923 Bacteria 1103
243 Ga0207694_10193747 3300025924 Bacteria 1652
244 Ga0207650_10079354 3300025925 Bacteria 2486
245 Ga0207650_10359377 3300025925 Bacteria 1199
246 Ga0207650_11742529 3300025925 Bacteria 528
247 Ga0207659_10316065 3300025926 Bacteria 1287
248 Ga0207659_10443776 3300025926 Bacteria 1092
249 Ga0207659_11169903 3300025926 Bacteria 661
250 Ga0207644_10157071 3300025931 Bacteria 1765
251 Ga0207690_10013908 3300025932 Bacteria 4849
252 Ga0207706_10009149 3300025933 Bacteria 9107
253 Ga0207706_10029711 3300025933 Bacteria 4878
254 Ga0207706_10091896 3300025933 Bacteria 2668
255 Ga0207686_10243897 3300025934 Bacteria 1309
256 Ga0207686_10583442 3300025934 Unclassified 878
257 Ga0207670_10003217 3300025936 Bacteria 8652
258 Ga0207670_10044886 3300025936 Bacteria 2927
259 Ga0207670_10140926 3300025936 Bacteria 1778
260 Ga0207669_10452472 3300025937 Bacteria 1018
261 Ga0207704_10049579 3300025938 Bacteria 2527
262 Ga0207704_10051540 3300025938 Bacteria 2490
263 Ga0207691_10112719 3300025940 Bacteria 2417
264 Ga0207711_11688061 3300025941 Bacteria 577
265 Ga0207689_10000843 3300025942 Bacteria 29516
266 Ga0207689_10007973 3300025942 Bacteria 9252
267 Ga0207689_10009455 3300025942 Bacteria 8416
268 Ga0207689_10131332 3300025942 Bacteria 2061
269 Ga0207689_10246954 3300025942 Bacteria 1476
270 Ga0207661_10000411 3300025944 Bacteria 27626
271 Ga0207661_10120973 3300025944 Bacteria 2229
272 Ga0207661_10155435 3300025944 Bacteria 1981
273 Ga0207661_10177820 3300025944 Bacteria 1856
274 Ga0207661_10446394 3300025944 Bacteria 1178
275 Ga0207679_10000297 3300025945 Bacteria 37427
276 Ga0207679_10000800 3300025945 Bacteria 20460
277 Ga0207679_10109681 3300025945 Bacteria 2175
278 Ga0207679_10237035 3300025945 Bacteria 1544
279 Ga0207679_10931633 3300025945 Bacteria 795
280 Ga0207651_10028687 3300025960 Bacteria 3515
281 Ga0207651_10089465 3300025960 Bacteria 2248
282 Ga0207651_10559144 3300025960 Bacteria 996
283 Ga0207712_10143922 3300025961 Unclassified 1833
284 Ga0207712_10497871 3300025961 Unclassified 1041
285 Ga0207640_10485773 3300025981 Archaea 1025
286 Ga0207658_10037350 3300025986 Unclassified 3489
287 Ga0207658_10183560 3300025986 Bacteria 1733
288 Ga0207658_10575852 3300025986 Bacteria 1009
289 Ga0207677_10002901 3300026023 Bacteria 9057
290 Ga0207677_10008754 3300026023 Bacteria 5668
291 Ga0207677_10033038 3300026023 Bacteria 3332
292 Ga0207677_10070895 3300026023 Unclassified 2458
293 Ga0207703_10188681 3300026035 Bacteria 1824
294 Ga0207703_10416311 3300026035 Bacteria 1249
295 Ga0207639_10001395 3300026041 Bacteria 16309
296 Ga0207639_10209388 3300026041 Bacteria 1677
297 Ga0207641_10264841 3300026088 Bacteria 1611
298 Ga0207641_11094351 3300026088 Unclassified 795
299 Ga0207648_10026203 3300026089 Bacteria 5183
300 Ga0207648_10074982 3300026089 Bacteria 2949
301 Ga0207648_11846848 3300026089 Unclassified 566
302 Ga0207676_10133172 3300026095 Bacteria 2117
303 Ga0207676_10140978 3300026095 Bacteria 2063
304 Ga0207676_10279549 3300026095 Unclassified 1515
305 Ga0207674_10003152 3300026116 Bacteria 20329
306 Ga0207674_10014623 3300026116 Bacteria 8656
307 Ga0207674_10118087 3300026116 Bacteria 2622
308 Ga0207675_100145933 3300026118 Bacteria 2250
309 Ga0207675_101158104 3300026118 Bacteria 793
310 Ga0207675_101324823 3300026118 Unclassified 741
311 Ga0207683_10004211 3300026121 Bacteria 12434
312 Ga0207698_10102643 3300026142 Bacteria 2375
313 Ga0207698_10111380 3300026142 Bacteria 2295
314 Ga0207698_10154933 3300026142 Bacteria 1994
315 Ga0207698_10485448 3300026142 Bacteria 1199
316 Ga0268266_10407136 3300028379 Bacteria 1287
317 Ga0268266_10916950 3300028379 Bacteria 847
318 Ga0268264_10171320 3300028381 Bacteria 1963
319 Ga0373934_0127365 3300035086 Unclassified 1037
320 Ga0373923_0105922 3300035111 Unclassified 1244
321 Ga0373943_0161632 3300035170 Bacteria 1220
322 Ga0373943_0355460 3300035170 Bacteria 840
323 Ga0373955_0201221 3300035172 Bacteria 1186
324 Ga0316574_0173559 3300035398 Bacteria 1388
325 Ga0373933_0008063 3300035724 Bacteria 5748
326 Ga0373937_0006966 3300036401 Bacteria 9758
327 Ga0436365_0473715 3300039437 Bacteria 54513
328 Ga0451839_1229875 3300041496 Bacteria 724
329 Ga0451853_0167776 3300041512 Unclassified 703
330 Ga0451577_0428084 3300042876 Bacteria 1202
331 Ga0495592_0268853 3300046454 Unclassified 1119
332 Ga0495650_0000003 3300046471 Bacteria 900730
333 Ga0495607_0175945 3300046501 Bacteria 1077
334 Ga0495583_0023465 3300046506 Bacteria 3121
335 Ga0495606_0000116 3300046507 Bacteria 134901
336 Ga0495610_0005913 3300046512 Bacteria 8571
337 Ga0495616_0001938 3300046513 Bacteria 13915
338 Ga0495616_0010108 3300046513 Bacteria 5475
339 Ga0495628_0011209 3300046516 Bacteria 7585
340 Ga0495630_0087961 3300046517 Unclassified 2346
341 Ga0495652_0068780 3300046529 Bacteria 2966
342 Ga0495640_0288501 3300046533 Unclassified 1021
343 Ga0495586_0330697 3300046535 Unclassified 874
344 Ga0495587_0163730 3300046536 Unclassified 1265
345 Ga0495609_0122500 3300046538 Bacteria 1117
346 Ga0495633_0005012 3300046558 Bacteria 8257
347 Ga0495667_0645141 3300046559 Unclassified 658
348 Ga0495667_0779356 3300046559 Unclassified 590
349 Ga0495634_0045414 3300046642 Unclassified 2970
350 Ga0495625_0000219 3300046660 Bacteria 90690
351 Ga0495625_0202177 3300046660 Bacteria 1310
352 Ga0495661_0001592 3300046665 Bacteria 18700
353 Ga0495599_0285575 3300046678 Unclassified 998
354 Ga0495613_0466080 3300046689 Unclassified 854
355 Ga0495671_0172201 3300046692 Bacteria 1052
356 Ga0495649_0000037 3300046694 Bacteria 133848
357 Ga0495600_0106597 3300046809 Unclassified 1826
358 Ga0495674_0172722 3300047319 Unclassified 1803
359 Ga0495687_002471 3300047443 Bacteria 14756
360 Ga0495684_0094128 3300047471 Unclassified 2269
361 Ga0496105_1224369 3300048908 Bacteria 552
362 Ga0496108_1132470 3300048911 Unclassified 664
363 Ga0496110_0278434 3300048913 Bacteria 1523
364 Ga0496110_1030924 3300048913 Unclassified 730
365 Ga0495678_050327 3300049459 Bacteria 1615
366 Ga0501292_027912 3300049515 Bacteria 938
367 Ga0501208_060747 3300049655 Bacteria 740
368 nmdc:mga09592_539349_c1 3300050508 Bacteria 1002
369 nmdc:mga0n895_1269332_c1 3300050512 Bacteria 708
370 nmdc:mga08x19_22733_c1 3300050514 Unclassified 3884
371 nmdc:mga08x19_687859_c1 3300050514 Unclassified 726
372 Ga0495619_0546967 3300053085 Unclassified 794
373 Ga0495619_0775462 3300053085 Bacteria 649
374 Ga0500618_006621 3300053125 Bacteria 3383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_100512537 Ga0070688_1005125371 130
2 3300025936 Ga0207670_10140926 Ga0207670_101409262 133
3 3300049655 Ga0501208_060747 Ga0501208_060747_143_577 133
4 3300041496 Ga0451839_1229875 Ga0451839_1229875_69_533 134
5 3300006028 Ga0070717_10567857 Ga0070717_105678571 136
6 3300046513 Ga0495616_0010108 Ga0495616_0010108_2333_2785 141
7 3300046660 Ga0495625_0202177 Ga0495625_0202177_548_1000 141
8 3300046692 Ga0495671_0172201 Ga0495671_0172201_570_1022 141
9 3300049459 Ga0495678_050327 Ga0495678_050327_516_968 141
10 3300005985 Ga0081539_10331905 Ga0081539_103319051 142
11 3300006881 Ga0068865_100960987 Ga0068865_1009609872 142
12 3300009176 Ga0105242_10212518 Ga0105242_102125182 142
13 3300013102 Ga0157371_10257474 Ga0157371_102574742 142
14 3300005295 Ga0065707_10112682 Ga0065707_101126823 143
15 3300005328 Ga0070676_10003561 Ga0070676_100035611 143
16 3300005329 Ga0070683_100000327 Ga0070683_10000032718 143
17 3300005329 Ga0070683_100047705 Ga0070683_1000477052 143
18 3300005329 Ga0070683_100065898 Ga0070683_1000658982 143
19 3300005329 Ga0070683_100506244 Ga0070683_1005062441 143
20 3300005329 Ga0070683_101048606 Ga0070683_1010486061 143
21 3300005329 Ga0070683_101099796 Ga0070683_1010997961 143
22 3300005330 Ga0070690_100256042 Ga0070690_1002560422 143
23 3300005331 Ga0070670_100031189 Ga0070670_1000311894 143
24 3300005331 Ga0070670_100170772 Ga0070670_1001707722 143
25 3300005334 Ga0068869_100004762 Ga0068869_1000047629 143
26 3300005334 Ga0068869_100079023 Ga0068869_1000790232 143
27 3300005334 Ga0068869_100082645 Ga0068869_1000826453 143
28 3300005334 Ga0068869_100089639 Ga0068869_1000896392 143
29 3300005335 Ga0070666_10060519 Ga0070666_100605193 143
30 3300005335 Ga0070666_10239028 Ga0070666_102390282 143
31 3300005335 Ga0070666_10553267 Ga0070666_105532671 143
32 3300005337 Ga0070682_100062927 Ga0070682_1000629272 143
33 3300005337 Ga0070682_100265603 Ga0070682_1002656032 143
34 3300005338 Ga0068868_100001123 Ga0068868_10000112313 143
35 3300005338 Ga0068868_100133722 Ga0068868_1001337222 143
36 3300005340 Ga0070689_100039628 Ga0070689_1000396283 143
37 3300005340 Ga0070689_100042612 Ga0070689_1000426122 143
38 3300005340 Ga0070689_100322178 Ga0070689_1003221782 143
39 3300005340 Ga0070689_100458379 Ga0070689_1004583792 143
40 3300005344 Ga0070661_100001196 Ga0070661_1000011962 143
41 3300005344 Ga0070661_100006373 Ga0070661_1000063735 143
42 3300005344 Ga0070661_100253416 Ga0070661_1002534162 143
43 3300005354 Ga0070675_100048368 Ga0070675_1000483684 143
44 3300005354 Ga0070675_100085838 Ga0070675_1000858383 143
45 3300005354 Ga0070675_100352563 Ga0070675_1003525632 143
46 3300005355 Ga0070671_100065215 Ga0070671_1000652153 143
47 3300005355 Ga0070671_100250193 Ga0070671_1002501931 143
48 3300005355 Ga0070671_100475885 Ga0070671_1004758852 143
49 3300005355 Ga0070671_100513676 Ga0070671_1005136762 143
50 3300005355 Ga0070671_100631503 Ga0070671_1006315031 143
51 3300005356 Ga0070674_101081394 Ga0070674_1010813941 143
52 3300005364 Ga0070673_100041208 Ga0070673_1000412083 143
53 3300005364 Ga0070673_100123089 Ga0070673_1001230892 143
54 3300005364 Ga0070673_100264352 Ga0070673_1002643521 143
55 3300005365 Ga0070688_100030527 Ga0070688_1000305272 143
56 3300005365 Ga0070688_100035603 Ga0070688_1000356034 143
57 3300005365 Ga0070688_100075619 Ga0070688_1000756192 143
58 3300005366 Ga0070659_100002952 Ga0070659_1000029524 143
59 3300005367 Ga0070667_100260148 Ga0070667_1002601482 143
60 3300005367 Ga0070667_100917018 Ga0070667_1009170182 143
61 3300005434 Ga0070709_10744550 Ga0070709_107445501 143
62 3300005438 Ga0070701_10276808 Ga0070701_102768082 143
63 3300005438 Ga0070701_10342461 Ga0070701_103424611 143
64 3300005455 Ga0070663_100059505 Ga0070663_1000595053 143
65 3300005456 Ga0070678_100067398 Ga0070678_1000673982 143
66 3300005457 Ga0070662_100018489 Ga0070662_1000184894 143
67 3300005457 Ga0070662_100088366 Ga0070662_1000883662 143
68 3300005457 Ga0070662_100716941 Ga0070662_1007169411 143
69 3300005459 Ga0068867_100055040 Ga0068867_1000550402 143
70 3300005466 Ga0070685_10054358 Ga0070685_100543583 143
71 3300005466 Ga0070685_10217511 Ga0070685_102175111 143
72 3300005468 Ga0070707_100067112 Ga0070707_1000671122 143
73 3300005530 Ga0070679_100095496 Ga0070679_1000954964 143
74 3300005535 Ga0070684_100000290 Ga0070684_10000029015 143
75 3300005535 Ga0070684_100014260 Ga0070684_1000142604 143
76 3300005535 Ga0070684_100069315 Ga0070684_1000693153 143
77 3300005535 Ga0070684_102022711 Ga0070684_1020227111 143
78 3300005539 Ga0068853_100000837 Ga0068853_10000083710 143
79 3300005539 Ga0068853_100139992 Ga0068853_1001399923 143
80 3300005539 Ga0068853_100165057 Ga0068853_1001650572 143
81 3300005539 Ga0068853_101065200 Ga0068853_1010652002 143
82 3300005539 Ga0068853_101380764 Ga0068853_1013807641 143
83 3300005543 Ga0070672_100708401 Ga0070672_1007084012 143
84 3300005544 Ga0070686_100042877 Ga0070686_1000428773 143
85 3300005544 Ga0070686_100345842 Ga0070686_1003458421 143
86 3300005547 Ga0070693_100758166 Ga0070693_1007581661 143
87 3300005548 Ga0070665_100308500 Ga0070665_1003085001 143
88 3300005548 Ga0070665_100998826 Ga0070665_1009988262 143
89 3300005563 Ga0068855_100115577 Ga0068855_1001155774 143
90 3300005564 Ga0070664_100000509 Ga0070664_10000050916 143
91 3300005564 Ga0070664_100005422 Ga0070664_1000054222 143
92 3300005564 Ga0070664_100091591 Ga0070664_1000915913 143
93 3300005564 Ga0070664_100196571 Ga0070664_1001965712 143
94 3300005564 Ga0070664_100304353 Ga0070664_1003043532 143
95 3300005564 Ga0070664_100360707 Ga0070664_1003607072 143
96 3300005564 Ga0070664_100369247 Ga0070664_1003692471 143
97 3300005564 Ga0070664_100509413 Ga0070664_1005094132 143
98 3300005577 Ga0068857_100000579 Ga0068857_10000057912 143
99 3300005577 Ga0068857_100146913 Ga0068857_1001469132 143
100 3300005577 Ga0068857_100182538 Ga0068857_1001825382 143
101 3300005578 Ga0068854_100129860 Ga0068854_1001298603 143
102 3300005615 Ga0070702_100892435 Ga0070702_1008924352 143
103 3300005616 Ga0068852_100069417 Ga0068852_1000694172 143
104 3300005616 Ga0068852_101610522 Ga0068852_1016105221 143
105 3300005617 Ga0068859_100072558 Ga0068859_1000725585 143
106 3300005617 Ga0068859_100106689 Ga0068859_1001066893 143
107 3300005617 Ga0068859_100158012 Ga0068859_1001580123 143
108 3300005618 Ga0068864_100038625 Ga0068864_1000386254 143
109 3300005618 Ga0068864_100608992 Ga0068864_1006089922 143
110 3300005618 Ga0068864_100634530 Ga0068864_1006345302 143
111 3300005718 Ga0068866_10102031 Ga0068866_101020312 143
112 3300005718 Ga0068866_10165857 Ga0068866_101658572 143
113 3300005719 Ga0068861_100742765 Ga0068861_1007427652 143
114 3300005719 Ga0068861_101476661 Ga0068861_1014766611 143
115 3300005834 Ga0068851_10048940 Ga0068851_100489402 143
116 3300005834 Ga0068851_10080304 Ga0068851_100803042 143
117 3300005840 Ga0068870_10211699 Ga0068870_102116992 143
118 3300005840 Ga0068870_10892456 Ga0068870_108924562 143
119 3300005841 Ga0068863_100093742 Ga0068863_1000937422 143
120 3300005841 Ga0068863_100273900 Ga0068863_1002739002 143
121 3300005841 Ga0068863_100309637 Ga0068863_1003096372 143
122 3300005842 Ga0068858_100041342 Ga0068858_1000413426 143
123 3300005842 Ga0068858_100157878 Ga0068858_1001578782 143
124 3300005842 Ga0068858_100240604 Ga0068858_1002406042 143
125 3300005842 Ga0068858_100673120 Ga0068858_1006731202 143
126 3300006028 Ga0070717_10053471 Ga0070717_100534712 143
127 3300006173 Ga0070716_100923013 Ga0070716_1009230132 143
128 3300006358 Ga0068871_100156174 Ga0068871_1001561744 143
129 3300006358 Ga0068871_100350147 Ga0068871_1003501472 143
130 3300006358 Ga0068871_100531484 Ga0068871_1005314842 143
131 3300006871 Ga0075434_101501839 Ga0075434_1015018391 143
132 3300006881 Ga0068865_100089857 Ga0068865_1000898572 143
133 3300006881 Ga0068865_100343040 Ga0068865_1003430402 143
134 3300006881 Ga0068865_100671716 Ga0068865_1006717161 143
135 3300006914 Ga0075436_100711448 Ga0075436_1007114481 143
136 3300006931 Ga0097620_100072554 Ga0097620_1000725542 143
137 3300006931 Ga0097620_100106695 Ga0097620_1001066953 143
138 3300006931 Ga0097620_100158004 Ga0097620_1001580043 143
139 3300007076 Ga0075435_100291670 Ga0075435_1002916702 143
140 3300009011 Ga0105251_10056345 Ga0105251_100563452 143
141 3300009093 Ga0105240_10000011 Ga0105240_10000011321 143
142 3300009101 Ga0105247_10174303 Ga0105247_101743032 143
143 3300009174 Ga0105241_10649052 Ga0105241_106490521 143
144 3300009176 Ga0105242_10025593 Ga0105242_100255933 143
145 3300009176 Ga0105242_10068152 Ga0105242_100681524 143
146 3300009177 Ga0105248_10451312 Ga0105248_104513122 143
147 3300009177 Ga0105248_12447371 Ga0105248_124473711 143
148 3300009545 Ga0105237_10634780 Ga0105237_106347801 143
149 3300009545 Ga0105237_11434094 Ga0105237_114340941 143
150 3300009553 Ga0105249_10017160 Ga0105249_100171606 143
151 3300009553 Ga0105249_10219339 Ga0105249_102193392 143
152 3300009553 Ga0105249_10371616 Ga0105249_103716162 143
153 3300010375 Ga0105239_10001802 Ga0105239_1000180214 143
154 3300013100 Ga0157373_10285514 Ga0157373_102855142 143
155 3300013100 Ga0157373_10646606 Ga0157373_106466062 143
156 3300013100 Ga0157373_11552118 Ga0157373_115521181 143
157 3300013102 Ga0157371_10337058 Ga0157371_103370582 143
158 3300013102 Ga0157371_10542135 Ga0157371_105421352 143
159 3300013296 Ga0157374_10000587 Ga0157374_1000058715 143
160 3300013296 Ga0157374_10004126 Ga0157374_1000412611 143
161 3300013296 Ga0157374_10062741 Ga0157374_100627412 143
162 3300013296 Ga0157374_10070413 Ga0157374_100704132 143
163 3300013297 Ga0157378_10353826 Ga0157378_103538262 143
164 3300013297 Ga0157378_11062115 Ga0157378_110621151 143
165 3300013297 Ga0157378_11288325 Ga0157378_112883252 143
166 3300013306 Ga0163162_10002830 Ga0163162_1000283016 143
167 3300013306 Ga0163162_10003298 Ga0163162_100032989 143
168 3300013306 Ga0163162_10027155 Ga0163162_100271552 143
169 3300013306 Ga0163162_10131290 Ga0163162_101312902 143
170 3300013306 Ga0163162_11131298 Ga0163162_111312981 143
171 3300013306 Ga0163162_11466740 Ga0163162_114667402 143
172 3300013306 Ga0163162_11747971 Ga0163162_117479712 143
173 3300013307 Ga0157372_10097611 Ga0157372_100976112 143
174 3300013307 Ga0157372_10459151 Ga0157372_104591512 143
175 3300013307 Ga0157372_10692648 Ga0157372_106926482 143
176 3300013307 Ga0157372_11976203 Ga0157372_119762032 143
177 3300013308 Ga0157375_10034885 Ga0157375_100348852 143
178 3300013308 Ga0157375_10114623 Ga0157375_101146232 143
179 3300013308 Ga0157375_10496552 Ga0157375_104965522 143
180 3300013308 Ga0157375_10877765 Ga0157375_108777652 143
181 3300013308 Ga0157375_11834858 Ga0157375_118348581 143
182 3300013308 Ga0157375_11981290 Ga0157375_119812901 143
183 3300014325 Ga0163163_10000867 Ga0163163_1000086713 143
184 3300014325 Ga0163163_10094907 Ga0163163_100949073 143
185 3300014325 Ga0163163_10567556 Ga0163163_105675562 143
186 3300014326 Ga0157380_10197014 Ga0157380_101970142 143
187 3300014326 Ga0157380_10696399 Ga0157380_106963992 143
188 3300014326 Ga0157380_10944007 Ga0157380_109440072 143
189 3300014745 Ga0157377_10014776 Ga0157377_100147766 143
190 3300014745 Ga0157377_10119169 Ga0157377_101191692 143
191 3300014968 Ga0157379_10011401 Ga0157379_100114014 143
192 3300014968 Ga0157379_10036734 Ga0157379_100367342 143
193 3300014969 Ga0157376_10025221 Ga0157376_100252212 143
194 3300014969 Ga0157376_10332882 Ga0157376_103328822 143
195 3300014969 Ga0157376_10881317 Ga0157376_108813171 143
196 3300014969 Ga0157376_13042198 Ga0157376_130421981 143
197 3300017792 Ga0163161_10008580 Ga0163161_100085805 143
198 3300017792 Ga0163161_10137801 Ga0163161_101378012 143
199 3300021384 Ga0213876_10001314 Ga0213876_1000131410 143
200 3300025321 Ga0207656_10672946 Ga0207656_106729461 143
201 3300025899 Ga0207642_10097931 Ga0207642_100979312 143
202 3300025899 Ga0207642_10116889 Ga0207642_101168892 143
203 3300025900 Ga0207710_10380953 Ga0207710_103809532 143
204 3300025903 Ga0207680_10170480 Ga0207680_101704801 143
205 3300025903 Ga0207680_10278395 Ga0207680_102783952 143
206 3300025904 Ga0207647_10012261 Ga0207647_100122613 143
207 3300025906 Ga0207699_10650094 Ga0207699_106500942 143
208 3300025907 Ga0207645_10008204 Ga0207645_100082044 143
209 3300025908 Ga0207643_10113308 Ga0207643_101133082 143
210 3300025908 Ga0207643_10723957 Ga0207643_107239571 143
211 3300025911 Ga0207654_10186899 Ga0207654_101868992 143
212 3300025911 Ga0207654_10205078 Ga0207654_102050782 143
213 3300025911 Ga0207654_10297204 Ga0207654_102972042 143
214 3300025913 Ga0207695_10000010 Ga0207695_10000010711 143
215 3300025917 Ga0207660_10579762 Ga0207660_105797622 143
216 3300025920 Ga0207649_10000567 Ga0207649_1000056710 143
217 3300025920 Ga0207649_10331189 Ga0207649_103311892 143
218 3300025922 Ga0207646_10244230 Ga0207646_102442302 143
219 3300025923 Ga0207681_10404340 Ga0207681_104043402 143
220 3300025924 Ga0207694_10193747 Ga0207694_101937473 143
221 3300025925 Ga0207650_10079354 Ga0207650_100793542 143
222 3300025925 Ga0207650_10359377 Ga0207650_103593772 143
223 3300025925 Ga0207650_11742529 Ga0207650_117425291 143
224 3300025926 Ga0207659_10316065 Ga0207659_103160652 143
225 3300025926 Ga0207659_10443776 Ga0207659_104437762 143
226 3300025926 Ga0207659_11169903 Ga0207659_111699031 143
227 3300025931 Ga0207644_10157071 Ga0207644_101570712 143
228 3300025932 Ga0207690_10013908 Ga0207690_100139082 143
229 3300025933 Ga0207706_10009149 Ga0207706_100091496 143
230 3300025933 Ga0207706_10029711 Ga0207706_100297114 143
231 3300025933 Ga0207706_10091896 Ga0207706_100918963 143
232 3300025934 Ga0207686_10243897 Ga0207686_102438972 143
233 3300025936 Ga0207670_10003217 Ga0207670_100032177 143
234 3300025936 Ga0207670_10044886 Ga0207670_100448863 143
235 3300025937 Ga0207669_10452472 Ga0207669_104524722 143
236 3300025938 Ga0207704_10049579 Ga0207704_100495793 143
237 3300025938 Ga0207704_10051540 Ga0207704_100515403 143
238 3300025940 Ga0207691_10112719 Ga0207691_101127192 143
239 3300025941 Ga0207711_11688061 Ga0207711_116880611 143
240 3300025942 Ga0207689_10000843 Ga0207689_100008434 143
241 3300025942 Ga0207689_10007973 Ga0207689_100079735 143
242 3300025942 Ga0207689_10009455 Ga0207689_1000945510 143
243 3300025942 Ga0207689_10131332 Ga0207689_101313322 143
244 3300025944 Ga0207661_10000411 Ga0207661_1000041117 143
245 3300025944 Ga0207661_10120973 Ga0207661_101209732 143
246 3300025944 Ga0207661_10155435 Ga0207661_101554352 143
247 3300025944 Ga0207661_10177820 Ga0207661_101778202 143
248 3300025944 Ga0207661_10446394 Ga0207661_104463942 143
249 3300025945 Ga0207679_10000297 Ga0207679_1000029723 143
250 3300025945 Ga0207679_10000800 Ga0207679_100008005 143
251 3300025945 Ga0207679_10109681 Ga0207679_101096813 143
252 3300025945 Ga0207679_10237035 Ga0207679_102370352 143
253 3300025945 Ga0207679_10931633 Ga0207679_109316332 143
254 3300025960 Ga0207651_10028687 Ga0207651_100286872 143
255 3300025960 Ga0207651_10089465 Ga0207651_100894651 143
256 3300025960 Ga0207651_10559144 Ga0207651_105591442 143
257 3300025961 Ga0207712_10497871 Ga0207712_104978712 143
258 3300025981 Ga0207640_10485773 Ga0207640_104857732 143
259 3300025986 Ga0207658_10183560 Ga0207658_101835602 143
260 3300025986 Ga0207658_10575852 Ga0207658_105758522 143
261 3300026023 Ga0207677_10002901 Ga0207677_1000290110 143
262 3300026023 Ga0207677_10008754 Ga0207677_100087543 143
263 3300026023 Ga0207677_10033038 Ga0207677_100330382 143
264 3300026023 Ga0207677_10070895 Ga0207677_100708952 143
265 3300026035 Ga0207703_10188681 Ga0207703_101886813 143
266 3300026035 Ga0207703_10416311 Ga0207703_104163112 143
267 3300026041 Ga0207639_10001395 Ga0207639_1000139515 143
268 3300026041 Ga0207639_10209388 Ga0207639_102093882 143
269 3300026088 Ga0207641_10264841 Ga0207641_102648412 143
270 3300026088 Ga0207641_11094351 Ga0207641_110943511 143
271 3300026089 Ga0207648_10026203 Ga0207648_100262034 143
272 3300026089 Ga0207648_10074982 Ga0207648_100749822 143
273 3300026089 Ga0207648_11846848 Ga0207648_118468481 143
274 3300026095 Ga0207676_10133172 Ga0207676_101331722 143
275 3300026095 Ga0207676_10140978 Ga0207676_101409782 143
276 3300026095 Ga0207676_10279549 Ga0207676_102795491 143
277 3300026116 Ga0207674_10003152 Ga0207674_100031524 143
278 3300026116 Ga0207674_10014623 Ga0207674_100146238 143
279 3300026116 Ga0207674_10118087 Ga0207674_101180872 143
280 3300026118 Ga0207675_100145933 Ga0207675_1001459332 143
281 3300026118 Ga0207675_101158104 Ga0207675_1011581041 143
282 3300026118 Ga0207675_101324823 Ga0207675_1013248232 143
283 3300026121 Ga0207683_10004211 Ga0207683_1000421114 143
284 3300026142 Ga0207698_10102643 Ga0207698_101026433 143
285 3300026142 Ga0207698_10111380 Ga0207698_101113802 143
286 3300026142 Ga0207698_10154933 Ga0207698_101549332 143
287 3300026142 Ga0207698_10485448 Ga0207698_104854482 143
288 3300028379 Ga0268266_10407136 Ga0268266_104071362 143
289 3300028379 Ga0268266_10916950 Ga0268266_109169501 143
290 3300028381 Ga0268264_10171320 Ga0268264_101713202 143
291 3300035086 Ga0373934_0127365 Ga0373934_0127365_132_596 143
292 3300035111 Ga0373923_0105922 Ga0373923_0105922_387_851 143
293 3300035170 Ga0373943_0161632 Ga0373943_0161632_371_835 143
294 3300035170 Ga0373943_0355460 Ga0373943_0355460_363_830 143
295 3300035172 Ga0373955_0201221 Ga0373955_0201221_31_495 143
296 3300035398 Ga0316574_0173559 Ga0316574_0173559_878_1342 143
297 3300035724 Ga0373933_0008063 Ga0373933_0008063_251_715 143
298 3300036401 Ga0373937_0006966 Ga0373937_0006966_5488_5952 143
299 3300039437 Ga0436365_0473715 Ga0436365_0473715_35637_36107 143
300 3300042876 Ga0451577_0428084 Ga0451577_0428084_545_1009 143
301 3300046454 Ga0495592_0268853 Ga0495592_0268853_154_618 143
302 3300046471 Ga0495650_0000003 Ga0495650_0000003_802341_802802 143
303 3300046501 Ga0495607_0175945 Ga0495607_0175945_45_506 143
304 3300046506 Ga0495583_0023465 Ga0495583_0023465_1057_1518 143
305 3300046507 Ga0495606_0000116 Ga0495606_0000116_48757_49218 143
306 3300046512 Ga0495610_0005913 Ga0495610_0005913_7581_8042 143
307 3300046513 Ga0495616_0001938 Ga0495616_0001938_2069_2530 143
308 3300046516 Ga0495628_0011209 Ga0495628_0011209_6334_6798 143
309 3300046517 Ga0495630_0087961 Ga0495630_0087961_45_509 143
310 3300046529 Ga0495652_0068780 Ga0495652_0068780_2059_2523 143
311 3300046533 Ga0495640_0288501 Ga0495640_0288501_50_514 143
312 3300046535 Ga0495586_0330697 Ga0495586_0330697_209_673 143
313 3300046536 Ga0495587_0163730 Ga0495587_0163730_481_945 143
314 3300046538 Ga0495609_0122500 Ga0495609_0122500_306_767 143
315 3300046558 Ga0495633_0005012 Ga0495633_0005012_1375_1836 143
316 3300046559 Ga0495667_0645141 Ga0495667_0645141_165_629 143
317 3300046559 Ga0495667_0779356 Ga0495667_0779356_101_565 143
318 3300046642 Ga0495634_0045414 Ga0495634_0045414_287_751 143
319 3300046660 Ga0495625_0000219 Ga0495625_0000219_37964_38425 143
320 3300046665 Ga0495661_0001592 Ga0495661_0001592_11329_11790 143
321 3300046678 Ga0495599_0285575 Ga0495599_0285575_121_585 143
322 3300046689 Ga0495613_0466080 Ga0495613_0466080_205_669 143
323 3300046694 Ga0495649_0000037 Ga0495649_0000037_37764_38225 143
324 3300046809 Ga0495600_0106597 Ga0495600_0106597_629_1093 143
325 3300047319 Ga0495674_0172722 Ga0495674_0172722_1013_1477 143
326 3300047443 Ga0495687_002471 Ga0495687_002471_13726_14187 143
327 3300047471 Ga0495684_0094128 Ga0495684_0094128_1347_1811 143
328 3300048908 Ga0496105_1224369 Ga0496105_1224369_44_508 143
329 3300048911 Ga0496108_1132470 Ga0496108_1132470_137_601 143
330 3300048913 Ga0496110_0278434 Ga0496110_0278434_876_1355 143
331 3300048913 Ga0496110_1030924 Ga0496110_1030924_176_640 143
332 3300049515 Ga0501292_027912 Ga0501292_027912_371_835 143
333 3300050512 nmdc:mga0n895_1269332_c1 nmdc:mga0n895_1269332_c1_176_640 143
334 3300050514 nmdc:mga08x19_687859_c1 nmdc:mga08x19_687859_c1_121_594 143
335 3300053085 Ga0495619_0546967 Ga0495619_0546967_124_588 143
336 3300053085 Ga0495619_0775462 Ga0495619_0775462_119_583 143
337 3300053125 Ga0500618_006621 Ga0500618_006621_1180_1641 143
338 3300005293 Ga0065715_10385838 Ga0065715_103858381 144
339 3300005328 Ga0070676_10007326 Ga0070676_100073263 144
340 3300005340 Ga0070689_101261280 Ga0070689_1012612801 144
341 3300005343 Ga0070687_100004644 Ga0070687_1000046446 144
342 3300005347 Ga0070668_100044928 Ga0070668_1000449284 144
343 3300005353 Ga0070669_100877253 Ga0070669_1008772531 144
344 3300005367 Ga0070667_100024615 Ga0070667_1000246156 144
345 3300005445 Ga0070708_100111088 Ga0070708_1001110882 144
346 3300005467 Ga0070706_100195567 Ga0070706_1001955671 144
347 3300005467 Ga0070706_100596539 Ga0070706_1005965392 144
348 3300005468 Ga0070707_100089011 Ga0070707_1000890113 144
349 3300005536 Ga0070697_100044119 Ga0070697_1000441192 144
350 3300005544 Ga0070686_100166374 Ga0070686_1001663741 144
351 3300005549 Ga0070704_100178262 Ga0070704_1001782622 144
352 3300005844 Ga0068862_101589032 Ga0068862_1015890321 144
353 3300006028 Ga0070717_10314762 Ga0070717_103147622 144
354 3300006914 Ga0075436_100047892 Ga0075436_1000478922 144
355 3300007076 Ga0075435_100885883 Ga0075435_1008858832 144
356 3300009176 Ga0105242_10851847 Ga0105242_108518471 144
357 3300010375 Ga0105239_10249609 Ga0105239_102496091 144
358 3300013306 Ga0163162_10043940 Ga0163162_100439407 144
359 3300025271 Ga0207666_1051246 Ga0207666_10512461 144
360 3300025315 Ga0207697_10007958 Ga0207697_100079587 144
361 3300025907 Ga0207645_10008964 Ga0207645_100089642 144
362 3300025910 Ga0207684_10021687 Ga0207684_100216876 144
363 3300025910 Ga0207684_10583957 Ga0207684_105839572 144
364 3300025918 Ga0207662_10007911 Ga0207662_100079117 144
365 3300025922 Ga0207646_10000774 Ga0207646_100007747 144
366 3300025922 Ga0207646_10103704 Ga0207646_101037044 144
367 3300025923 Ga0207681_10021587 Ga0207681_100215877 144
368 3300025934 Ga0207686_10583442 Ga0207686_105834421 144
369 3300025942 Ga0207689_10246954 Ga0207689_102469541 144
370 3300025961 Ga0207712_10143922 Ga0207712_101439221 144
371 3300025986 Ga0207658_10037350 Ga0207658_100373501 144
372 3300041512 Ga0451853_0167776 Ga0451853_0167776_134_592 144
373 3300050508 nmdc:mga09592_539349_c1 nmdc:mga09592_539349_c1_73_549 144
374 3300050514 nmdc:mga08x19_22733_c1 nmdc:mga08x19_22733_c1_2594_3085 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

21

164

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.784 2 143
5xd4-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with atp (ii) 0.7525 2 139
6m6y-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp 0.7497 2 139
3gz8-assembly2.cif.gz_D cocrystal structure of nudix domain of shewanella oneidensis nrtr complexed with adp ribose 0.7486 2 144
1ktg-assembly1.cif.gz_A crystal structure of a c. elegans ap4a hydrolase binary complex 0.7396 2 143
ID Description Score Start End Superfamily
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9574 2 139 3.90.79.10
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9123 2 139 3.90.79.10
af_Q54XI6_2_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.75 2 54 3.90.79.10
af_Q4V6M1_1_140_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7453 2 143 3.90.79.10
1ktgA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7396 2 143 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A2V6MFH1-F1-model_v4 Nudix hydrolase domain-containing protein 0.9943 1 143 GO:0004081
GO:0006167
GO:0006754
AF-A0A2V6CBL5-F1-model_v4 NUDIX hydrolase 0.9882 1 143 GO:0004081
GO:0006167
GO:0006754
AF-A0A2V5Q5D4-F1-model_v4 Nudix hydrolase domain-containing protein 0.9809 1 143 GO:0004081
GO:0006167
GO:0006754
AF-A0A2V6MFH1-F1-model_v4 Nudix hydrolase domain-containing protein 0.9807 1 143 GO:0004081
GO:0006167
GO:0006754
AF-A0A520IGE4-F1-model_v4 NUDIX domain-containing protein 0.9762 2 144 GO:0004081
GO:0006167
GO:0006754

Feature Viewer

pLDDT pTM Quality
96 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map