F426508

General Info

Members Datasets Scaffolds Average Seq Length
373 179 746 158

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0299299|Ga0501075_0299299_361_840
Length 154
Sequence MTAAVFDRVRAALGGLAEGAGISHGVMVIVVAPGDVLQVVRSLKSAGFDLFLDVTAVDWLGQVPRFEVVWHFYSTTSRVRMRPEQQPEVDSLETLYGSAAFMERECHEMYGIRFRGNHDLRPILLYEGFVGHPLRKDYDKEQEQPLVPYRDGVR

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.02
Rhizosphere 95.17
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_0299299 3300049591 Bacteria 1226
2 Ga0070658_10189698 3300005327 Bacteria 1732
3 Ga0070658_10353119 3300005327 Bacteria 1259
4 Ga0070658_10695162 3300005327 Bacteria 883
5 Ga0070676_10000344 3300005328 Bacteria 21271
6 Ga0070690_100007726 3300005330 Bacteria 6166
7 Ga0070690_100063132 3300005330 Bacteria 2390
8 Ga0070690_100211265 3300005330 Bacteria 1355
9 Ga0070670_100021994 3300005331 Bacteria 5487
10 Ga0070670_100482943 3300005331 Bacteria 1100
11 Ga0070677_10024249 3300005333 Bacteria 2254
12 Ga0070677_10388533 3300005333 Bacteria 732
13 Ga0070677_10450678 3300005333 Bacteria 688
14 Ga0068869_100025679 3300005334 Bacteria 4093
15 Ga0070666_10001973 3300005335 Bacteria 12500
16 Ga0070666_10038648 3300005335 Bacteria 3177
17 Ga0070666_10075803 3300005335 Bacteria 2293
18 Ga0068868_100009593 3300005338 Bacteria 6979
19 Ga0068868_100649909 3300005338 Bacteria 939
20 Ga0070660_100311199 3300005339 Bacteria 1292
21 Ga0070660_100860825 3300005339 Bacteria 763
22 Ga0070689_100023376 3300005340 Bacteria 4627
23 Ga0070689_101292515 3300005340 Bacteria 657
24 Ga0070687_100011994 3300005343 Bacteria 3811
25 Ga0070661_100042476 3300005344 Bacteria 3318
26 Ga0070661_100064618 3300005344 Bacteria 2689
27 Ga0070661_100498378 3300005344 Bacteria 974
28 Ga0070692_10199985 3300005345 Bacteria 1170
29 Ga0070668_100009616 3300005347 Bacteria 7174
30 Ga0070668_100013499 3300005347 Bacteria 6098
31 Ga0070668_100517724 3300005347 Bacteria 1035
32 Ga0070669_100007773 3300005353 Bacteria 7659
33 Ga0070669_100302536 3300005353 Bacteria 1287
34 Ga0070669_100494365 3300005353 Bacteria 1014
35 Ga0070675_100000222 3300005354 Bacteria 36370
36 Ga0070675_100035270 3300005354 Bacteria 4064
37 Ga0070675_100040831 3300005354 Bacteria 3789
38 Ga0070671_100067506 3300005355 Bacteria 2982
39 Ga0070671_100269093 3300005355 Bacteria 1448
40 Ga0070671_100413479 3300005355 Bacteria 1155
41 Ga0070671_100484089 3300005355 Bacteria 1063
42 Ga0070674_100025179 3300005356 Bacteria 3871
43 Ga0070673_100079944 3300005364 Bacteria 2648
44 Ga0070673_100097134 3300005364 Bacteria 2419
45 Ga0070673_100248201 3300005364 Bacteria 1550
46 Ga0070673_100531578 3300005364 Bacteria 1066
47 Ga0070688_100038372 3300005365 Bacteria 2925
48 Ga0070688_100215321 3300005365 Bacteria 1351
49 Ga0070659_101079822 3300005366 Bacteria 707
50 Ga0070667_100000717 3300005367 Bacteria 31904
51 Ga0070667_100035139 3300005367 Bacteria 4197
52 Ga0070667_100130056 3300005367 Bacteria 2196
53 Ga0070667_100144580 3300005367 Bacteria 2085
54 Ga0070701_10017392 3300005438 Bacteria 3359
55 Ga0070700_100876993 3300005441 Bacteria 729
56 Ga0070663_100075352 3300005455 Bacteria 2466
57 Ga0070663_100129686 3300005455 Bacteria 1913
58 Ga0070663_100178917 3300005455 Bacteria 1644
59 Ga0070663_100439051 3300005455 Bacteria 1074
60 Ga0070663_100781255 3300005455 Bacteria 817
61 Ga0070678_100000448 3300005456 Bacteria 19555
62 Ga0070678_100090806 3300005456 Bacteria 2342
63 Ga0070662_100349169 3300005457 Bacteria 1212
64 Ga0070662_100369170 3300005457 Bacteria 1179
65 Ga0068867_100006159 3300005459 Bacteria 8493
66 Ga0068853_101202417 3300005539 Bacteria 732
67 Ga0070672_100006399 3300005543 Bacteria 7914
68 Ga0070672_100015909 3300005543 Bacteria 5373
69 Ga0070672_100028103 3300005543 Bacteria 4204
70 Ga0070672_100262984 3300005543 Bacteria 1455
71 Ga0070672_100317677 3300005543 Bacteria 1323
72 Ga0070672_100591798 3300005543 Bacteria 965
73 Ga0070672_100660019 3300005543 Bacteria 914
74 Ga0070665_100012487 3300005548 Bacteria 8561
75 Ga0070665_101018879 3300005548 Bacteria 840
76 Ga0070664_100039474 3300005564 Bacteria 3978
77 Ga0070664_100448049 3300005564 Bacteria 1185
78 Ga0070664_100512459 3300005564 Bacteria 1106
79 Ga0070664_100539777 3300005564 Bacteria 1078
80 Ga0068856_101410995 3300005614 Bacteria 711
81 Ga0070702_100569901 3300005615 Bacteria 844
82 Ga0068852_100787595 3300005616 Bacteria 964
83 Ga0068852_101365550 3300005616 Bacteria 730
84 Ga0068859_100022265 3300005617 Bacteria 6355
85 Ga0068859_100873801 3300005617 Bacteria 985
86 Ga0068859_101792727 3300005617 Bacteria 678
87 Ga0068864_100004956 3300005618 Bacteria 10912
88 Ga0068864_100065413 3300005618 Bacteria 3154
89 Ga0068866_10922272 3300005718 Bacteria 616
90 Ga0068861_100077438 3300005719 Bacteria 2594
91 Ga0068861_100238833 3300005719 Bacteria 1545
92 Ga0068861_101000710 3300005719 Bacteria 798
93 Ga0068851_10165425 3300005834 Bacteria 1217
94 Ga0068870_10263160 3300005840 Bacteria 1074
95 Ga0068863_100014500 3300005841 Bacteria 7590
96 Ga0068863_100338047 3300005841 Bacteria 1464
97 Ga0068863_101190792 3300005841 Bacteria 768
98 Ga0068858_100003570 3300005842 Bacteria 15391
99 Ga0068858_100015457 3300005842 Bacteria 7178
100 Ga0068858_100219647 3300005842 Bacteria 1800
101 Ga0068858_100811730 3300005842 Bacteria 913
102 Ga0068858_100890967 3300005842 Bacteria 870
103 Ga0068860_100004964 3300005843 Bacteria 13559
104 Ga0068860_100069765 3300005843 Bacteria 3341
105 Ga0068860_100141672 3300005843 Bacteria 2311
106 Ga0068860_100436155 3300005843 Bacteria 1301
107 Ga0068862_100132214 3300005844 Bacteria 2208
108 Ga0068862_100141205 3300005844 Bacteria 2138
109 Ga0081455_10215644 3300005937 Bacteria 1427
110 Ga0075432_10141586 3300006058 Bacteria 918
111 Ga0097621_100020220 3300006237 Bacteria 5128
112 Ga0097621_100338586 3300006237 Bacteria 1336
113 Ga0097621_100511875 3300006237 Bacteria 1088
114 Ga0097621_101089644 3300006237 Bacteria 749
115 Ga0068871_100000813 3300006358 Bacteria 20955
116 Ga0068871_100503933 3300006358 Bacteria 1091
117 Ga0068871_101208994 3300006358 Bacteria 709
118 Ga0068865_100001369 3300006881 Bacteria 14179
119 Ga0068865_100058101 3300006881 Bacteria 2701
120 Ga0068865_100394819 3300006881 Bacteria 1132
121 Ga0097620_100022265 3300006931 Bacteria 6355
122 Ga0097620_100873808 3300006931 Bacteria 985
123 Ga0097620_101791830 3300006931 Bacteria 678
124 Ga0111539_10518025 3300009094 Bacteria 1389
125 Ga0111539_10955284 3300009094 Bacteria 997
126 Ga0105247_10092607 3300009101 Bacteria 1920
127 Ga0105243_10095797 3300009148 Bacteria 2454
128 Ga0105248_10088897 3300009177 Bacteria 3477
129 Ga0105248_10404925 3300009177 Bacteria 1536
130 Ga0105248_10635938 3300009177 Bacteria 1204
131 Ga0105248_10838489 3300009177 Bacteria 1038
132 Ga0105248_10910263 3300009177 Bacteria 993
133 Ga0105248_11065793 3300009177 Bacteria 913
134 Ga0105248_11074930 3300009177 Bacteria 909
135 Ga0105249_10063691 3300009553 Bacteria 3388
136 Ga0105246_10388736 3300011119 Bacteria 1155
137 Ga0105246_10785595 3300011119 Bacteria 843
138 Ga0157327_1002729 3300012512 Bacteria 1244
139 Ga0157369_10501751 3300013105 Bacteria 1255
140 Ga0157374_10013081 3300013296 Bacteria 7238
141 Ga0157374_10091023 3300013296 Bacteria 2908
142 Ga0157374_10351312 3300013296 Bacteria 1465
143 Ga0157378_10072172 3300013297 Bacteria 3102
144 Ga0157378_10525167 3300013297 Bacteria 1186
145 Ga0157378_10978474 3300013297 Bacteria 880
146 Ga0163162_10037039 3300013306 Bacteria 4865
147 Ga0163162_11620727 3300013306 Bacteria 738
148 Ga0163162_11917509 3300013306 Bacteria 678
149 Ga0157372_10390598 3300013307 Bacteria 1621
150 Ga0157375_10006101 3300013308 Bacteria 10506
151 Ga0157375_10094362 3300013308 Bacteria 3061
152 Ga0157380_10021681 3300014326 Bacteria 4823
153 Ga0157380_10135907 3300014326 Bacteria 2104
154 Ga0157377_10583674 3300014745 Bacteria 795
155 Ga0157379_10041294 3300014968 Bacteria 4118
156 Ga0157379_10125190 3300014968 Bacteria 2313
157 Ga0157379_10388840 3300014968 Bacteria 1281
158 Ga0157376_10005091 3300014969 Bacteria 9158
159 Ga0157376_10796312 3300014969 Bacteria 957
160 Ga0157376_10917287 3300014969 Bacteria 895
161 Ga0163161_10025575 3300017792 Bacteria 4179
162 Ga0163161_10146648 3300017792 Bacteria 1791
163 Ga0163161_10239679 3300017792 Bacteria 1410
164 Ga0163161_10566408 3300017792 Bacteria 933
165 Ga0207697_10004410 3300025315 Bacteria 6728
166 Ga0207656_10044507 3300025321 Bacteria 1896
167 Ga0207682_10039832 3300025893 Bacteria 1912
168 Ga0207682_10254304 3300025893 Bacteria 818
169 Ga0207688_10025787 3300025901 Bacteria 3230
170 Ga0207688_10028322 3300025901 Bacteria 3082
171 Ga0207680_10017650 3300025903 Bacteria 3773
172 Ga0207680_10118790 3300025903 Bacteria 1726
173 Ga0207680_10137766 3300025903 Bacteria 1615
174 Ga0207645_10000286 3300025907 Bacteria 42134
175 Ga0207645_10039516 3300025907 Bacteria 3024
176 Ga0207645_10252317 3300025907 Bacteria 1167
177 Ga0207645_10506834 3300025907 Bacteria 817
178 Ga0207643_10022132 3300025908 Bacteria 3498
179 Ga0207643_10260146 3300025908 Bacteria 1071
180 Ga0207705_10290700 3300025909 Bacteria 1252
181 Ga0207662_10028898 3300025918 Bacteria 3209
182 Ga0207657_10314698 3300025919 Bacteria 1238
183 Ga0207657_10938433 3300025919 Bacteria 666
184 Ga0207649_10022991 3300025920 Bacteria 3606
185 Ga0207649_10279053 3300025920 Bacteria 1214
186 Ga0207681_10004963 3300025923 Bacteria 8174
187 Ga0207681_10261503 3300025923 Bacteria 1355
188 Ga0207681_10459981 3300025923 Bacteria 1036
189 Ga0207681_10521167 3300025923 Bacteria 975
190 Ga0207650_10064907 3300025925 Bacteria 2734
191 Ga0207650_10139760 3300025925 Bacteria 1903
192 Ga0207650_10323096 3300025925 Bacteria 1264
193 Ga0207659_10000564 3300025926 Bacteria 22269
194 Ga0207659_10033259 3300025926 Bacteria 3547
195 Ga0207659_10050305 3300025926 Bacteria 2960
196 Ga0207659_10442348 3300025926 Bacteria 1094
197 Ga0207644_10007367 3300025931 Bacteria 7166
198 Ga0207644_10242958 3300025931 Bacteria 1434
199 Ga0207644_10436837 3300025931 Bacteria 1074
200 Ga0207644_10517869 3300025931 Bacteria 985
201 Ga0207644_10911495 3300025931 Unclassified 737
202 Ga0207706_10017710 3300025933 Bacteria 6417
203 Ga0207706_10035025 3300025933 Bacteria 4466
204 Ga0207709_10025665 3300025935 Bacteria 3375
205 Ga0207670_10063348 3300025936 Bacteria 2530
206 Ga0207670_10900321 3300025936 Bacteria 741
207 Ga0207669_10021886 3300025937 Bacteria 3385
208 Ga0207669_10240873 3300025937 Bacteria 1341
209 Ga0207704_10001991 3300025938 Bacteria 9158
210 Ga0207704_10355960 3300025938 Bacteria 1141
211 Ga0207704_10453871 3300025938 Bacteria 1023
212 Ga0207704_11205665 3300025938 Bacteria 645
213 Ga0207691_10002154 3300025940 Bacteria 19269
214 Ga0207691_10006869 3300025940 Bacteria 10982
215 Ga0207691_10014823 3300025940 Bacteria 7428
216 Ga0207691_10062707 3300025940 Bacteria 3372
217 Ga0207691_10097689 3300025940 Bacteria 2624
218 Ga0207691_10773651 3300025940 Bacteria 808
219 Ga0207691_10976508 3300025940 Bacteria 707
220 Ga0207711_10170493 3300025941 Bacteria 1975
221 Ga0207711_10258752 3300025941 Bacteria 1599
222 Ga0207711_10524044 3300025941 Bacteria 1105
223 Ga0207711_10536116 3300025941 Bacteria 1092
224 Ga0207689_10029515 3300025942 Bacteria 4579
225 Ga0207679_10498101 3300025945 Bacteria 1087
226 Ga0207679_10563810 3300025945 Bacteria 1023
227 Ga0207679_10764653 3300025945 Bacteria 879
228 Ga0207651_10209920 3300025960 Bacteria 1566
229 Ga0207651_10728978 3300025960 Bacteria 875
230 Ga0207712_10037668 3300025961 Bacteria 3301
231 Ga0207712_11282717 3300025961 Bacteria 654
232 Ga0207668_10005485 3300025972 Bacteria 7473
233 Ga0207668_10049199 3300025972 Bacteria 2896
234 Ga0207640_10273749 3300025981 Bacteria 1322
235 Ga0207658_10004386 3300025986 Bacteria 9811
236 Ga0207658_10010727 3300025986 Bacteria 6229
237 Ga0207658_10082777 3300025986 Bacteria 2465
238 Ga0207658_10090266 3300025986 Bacteria 2374
239 Ga0207677_10008026 3300026023 Bacteria 5875
240 Ga0207677_10664732 3300026023 Bacteria 921
241 Ga0207703_10004196 3300026035 Bacteria 11883
242 Ga0207703_10032948 3300026035 Bacteria 4104
243 Ga0207703_10284753 3300026035 Bacteria 1502
244 Ga0207703_10585942 3300026035 Bacteria 1054
245 Ga0207639_10050782 3300026041 Bacteria 3151
246 Ga0207678_10230048 3300026067 Bacteria 1587
247 Ga0207678_10461491 3300026067 Bacteria 1105
248 Ga0207678_10768047 3300026067 Bacteria 850
249 Ga0207678_11196165 3300026067 Bacteria 673
250 Ga0207702_10992541 3300026078 Bacteria 833
251 Ga0207641_10019913 3300026088 Bacteria 5507
252 Ga0207641_10042170 3300026088 Bacteria 3827
253 Ga0207641_10997408 3300026088 Bacteria 834
254 Ga0207641_11342979 3300026088 Bacteria 716
255 Ga0207648_10009351 3300026089 Bacteria 9392
256 Ga0207676_10009320 3300026095 Bacteria 6985
257 Ga0207676_10519049 3300026095 Bacteria 1134
258 Ga0207676_11803116 3300026095 Bacteria 610
259 Ga0207675_100045108 3300026118 Bacteria 4119
260 Ga0207675_100096559 3300026118 Bacteria 2782
261 Ga0207675_100138310 3300026118 Bacteria 2312
262 Ga0207675_100204130 3300026118 Bacteria 1899
263 Ga0207683_10002147 3300026121 Bacteria 17329
264 Ga0207683_10274157 3300026121 Bacteria 1541
265 Ga0207683_10859747 3300026121 Bacteria 842
266 Ga0207698_10393453 3300026142 Bacteria 1322
267 Ga0207698_10806225 3300026142 Bacteria 941
268 Ga0268266_10014928 3300028379 Bacteria 6669
269 Ga0268266_10138380 3300028379 Bacteria 2183
270 Ga0268265_10066677 3300028380 Bacteria 2783
271 Ga0268265_10110598 3300028380 Bacteria 2242
272 Ga0268265_10577338 3300028380 Bacteria 1071
273 Ga0268264_10032441 3300028381 Bacteria 4286
274 Ga0268264_10106257 3300028381 Bacteria 2450
275 Ga0268264_10365369 3300028381 Bacteria 1378
276 Ga0268264_10598858 3300028381 Bacteria 1086
277 Ga0268264_11183209 3300028381 Bacteria 774
278 Ga0265332_10000449 3300031238 Bacteria 28929
279 Ga0265325_10113049 3300031241 Bacteria 1317
280 Ga0265329_10022823 3300031242 Bacteria 2089
281 Ga0265339_10073778 3300031249 Bacteria 1814
282 Ga0265331_10000571 3300031250 Bacteria 33044
283 Ga0265327_10017824 3300031251 Bacteria 4430
284 Ga0307408_100003207 3300031548 Bacteria 11256
285 Ga0265313_10353413 3300031595 Unclassified 582
286 Ga0265342_10055014 3300031712 Bacteria 2364
287 Ga0316576_10083687 3300031727 Bacteria 2370
288 Ga0316578_10000412 3300031728 Bacteria 13969
289 Ga0316578_10208687 3300031728 Bacteria 1175
290 Ga0307405_10000672 3300031731 Bacteria 13210
291 Ga0316577_10118872 3300031733 Bacteria 1485
292 Ga0307413_10007236 3300031824 Bacteria 5136
293 Ga0307410_10002882 3300031852 Bacteria 8467
294 Ga0307406_10001819 3300031901 Bacteria 11634
295 Ga0307407_10011401 3300031903 Bacteria 4229
296 Ga0307412_10058524 3300031911 Bacteria 2578
297 Ga0307409_100000163 3300031995 Bacteria 25750
298 Ga0307416_100007775 3300032002 Bacteria 6853
299 Ga0307414_10067312 3300032004 Bacteria 2565
300 Ga0307414_10712127 3300032004 Bacteria 910
301 Ga0307411_10004813 3300032005 Bacteria 6543
302 Ga0307415_100000252 3300032126 Bacteria 23099
303 Ga0316580_10000473 3300032139 Bacteria 9284
304 Ga0373960_0172292 3300035121 Bacteria 751
305 Ga0316574_0000327 3300035398 Bacteria 18235
306 Ga0316574_0005355 3300035398 Bacteria 6835
307 Ga0316574_0016700 3300035398 Bacteria 4282
308 Ga0316574_0120577 3300035398 Bacteria 1684
309 Ga0373935_0306323 3300035692 Bacteria 1124
310 Ga0373933_0226298 3300035724 Bacteria 1201
311 Ga0373937_0139456 3300036401 Bacteria 2268
312 Ga0373937_0341170 3300036401 Bacteria 1419
313 Ga0316582_0442908 3300036647 Bacteria 895
314 Ga0316584_0033527 3300036712 Bacteria 3805
315 Ga0316584_0164430 3300036712 Bacteria 1648
316 Ga0451787_846531 3300041441 Bacteria 758
317 Ga0451802_1563161 3300041460 Unclassified 620
318 Ga0451807_0520537 3300041486 Bacteria 591
319 Ga0451833_0090030 3300041491 Bacteria 948
320 Ga0451853_3885150 3300041512 Bacteria 826
321 Ga0451853_4050336 3300041512 Bacteria 943
322 Ga0439464_0014317 3300042439 Bacteria 2131
323 Ga0439460_0010105 3300042461 Bacteria 2407
324 Ga0451577_0003942 3300042876 Bacteria 16015
325 Ga0451577_0021319 3300042876 Bacteria 5931
326 Ga0451577_0082677 3300042876 Bacteria 2864
327 Ga0451577_0100362 3300042876 Bacteria 2585
328 Ga0451577_0106436 3300042876 Bacteria 2507
329 Ga0451577_0150288 3300042876 Bacteria 2095
330 Ga0453683_0000571 3300044673 Bacteria 40713
331 Ga0453683_0529830 3300044673 Bacteria 766
332 Ga0453684_0053532 3300044712 Bacteria 5267
333 Ga0453684_0613189 3300044712 Bacteria 1191
334 Ga0453684_0806952 3300044712 Bacteria 1012
335 Ga0453684_1777288 3300044712 Bacteria 627
336 Ga0451576_0043566 3300045051 Bacteria 4735
337 Ga0451576_0144933 3300045051 Bacteria 2476
338 Ga0451576_0278027 3300045051 Bacteria 1751
339 Ga0451576_1021942 3300045051 Bacteria 866
340 Ga0451576_2321360 3300045051 Bacteria 550
341 Ga0495621_0034695 3300046539 Bacteria 1744
342 Ga0495658_0252594 3300046683 Bacteria 1109
343 Ga0495658_0682788 3300046683 Bacteria 658
344 Ga0495680_0567177 3300047322 Bacteria 763
345 Ga0496104_0253975 3300048907 Bacteria 1671
346 Ga0496104_0466042 3300048907 Bacteria 1175
347 Ga0496106_0353146 3300048909 Bacteria 1181
348 Ga0496106_0889404 3300048909 Bacteria 704
349 Ga0496109_0071381 3300048912 Bacteria 3188
350 Ga0496109_0939534 3300048912 Bacteria 803
351 Ga0496110_0024801 3300048913 Bacteria 5117
352 Ga0496110_0311993 3300048913 Bacteria 1432
353 Ga0496110_0873451 3300048913 Bacteria 805
354 Ga0496111_0076372 3300048914 Bacteria 2442
355 Ga0496114_0465820 3300048917 Bacteria 1118
356 Ga0496114_1084909 3300048917 Bacteria 685
357 Ga0501036_0255656 3300049572 Bacteria 1468
358 Ga0501038_0194698 3300049574 Bacteria 1630
359 Ga0501039_1042267 3300049575 Unclassified 635
360 Ga0501041_0263393 3300049577 Bacteria 1084
361 Ga0501048_0113507 3300049582 Bacteria 1914
362 Ga0501072_0244598 3300049588 Bacteria 1429
363 Ga0501075_0143297 3300049591 Bacteria 1821
364 Ga0501076_0277313 3300049592 Bacteria 1373
365 Ga0501079_0096956 3300049741 Bacteria 2286
366 Ga0501080_0278449 3300049742 Bacteria 1521
367 Ga0501081_0248866 3300049743 Bacteria 1297
368 Ga0501045_0090724 3300049824 Bacteria 2258
369 Ga0501045_0577144 3300049824 Bacteria 833
370 Ga0495612_0143215 3300053078 Bacteria 1038
371 Ga0495595_0021691 3300053084 Bacteria 2809
372 Ga0495619_0531196 3300053085 Bacteria 808
373 Ga0501082_0201587 3300060353 Bacteria 1731
374 Ga0501075_0299299
375 Ga0070658_10189698
376 Ga0070658_10353119
377 Ga0070658_10695162
378 Ga0070676_10000344
379 Ga0070690_100007726
380 Ga0070690_100063132
381 Ga0070690_100211265
382 Ga0070670_100021994
383 Ga0070670_100482943
384 Ga0070677_10024249
385 Ga0070677_10388533
386 Ga0070677_10450678
387 Ga0068869_100025679
388 Ga0070666_10001973
389 Ga0070666_10038648
390 Ga0070666_10075803
391 Ga0068868_100009593
392 Ga0068868_100649909
393 Ga0070660_100311199
394 Ga0070660_100860825
395 Ga0070689_100023376
396 Ga0070689_101292515
397 Ga0070687_100011994
398 Ga0070661_100042476
399 Ga0070661_100064618
400 Ga0070661_100498378
401 Ga0070692_10199985
402 Ga0070668_100009616
403 Ga0070668_100013499
404 Ga0070668_100517724
405 Ga0070669_100007773
406 Ga0070669_100302536
407 Ga0070669_100494365
408 Ga0070675_100000222
409 Ga0070675_100035270
410 Ga0070675_100040831
411 Ga0070671_100067506
412 Ga0070671_100269093
413 Ga0070671_100413479
414 Ga0070671_100484089
415 Ga0070674_100025179
416 Ga0070673_100079944
417 Ga0070673_100097134
418 Ga0070673_100248201
419 Ga0070673_100531578
420 Ga0070688_100038372
421 Ga0070688_100215321
422 Ga0070659_101079822
423 Ga0070667_100000717
424 Ga0070667_100035139
425 Ga0070667_100130056
426 Ga0070667_100144580
427 Ga0070701_10017392
428 Ga0070700_100876993
429 Ga0070663_100075352
430 Ga0070663_100129686
431 Ga0070663_100178917
432 Ga0070663_100439051
433 Ga0070663_100781255
434 Ga0070678_100000448
435 Ga0070678_100090806
436 Ga0070662_100349169
437 Ga0070662_100369170
438 Ga0068867_100006159
439 Ga0068853_101202417
440 Ga0070672_100006399
441 Ga0070672_100015909
442 Ga0070672_100028103
443 Ga0070672_100262984
444 Ga0070672_100317677
445 Ga0070672_100591798
446 Ga0070672_100660019
447 Ga0070665_100012487
448 Ga0070665_101018879
449 Ga0070664_100039474
450 Ga0070664_100448049
451 Ga0070664_100512459
452 Ga0070664_100539777
453 Ga0068856_101410995
454 Ga0070702_100569901
455 Ga0068852_100787595
456 Ga0068852_101365550
457 Ga0068859_100022265
458 Ga0068859_100873801
459 Ga0068859_101792727
460 Ga0068864_100004956
461 Ga0068864_100065413
462 Ga0068866_10922272
463 Ga0068861_100077438
464 Ga0068861_100238833
465 Ga0068861_101000710
466 Ga0068851_10165425
467 Ga0068870_10263160
468 Ga0068863_100014500
469 Ga0068863_100338047
470 Ga0068863_101190792
471 Ga0068858_100003570
472 Ga0068858_100015457
473 Ga0068858_100219647
474 Ga0068858_100811730
475 Ga0068858_100890967
476 Ga0068860_100004964
477 Ga0068860_100069765
478 Ga0068860_100141672
479 Ga0068860_100436155
480 Ga0068862_100132214
481 Ga0068862_100141205
482 Ga0081455_10215644
483 Ga0075432_10141586
484 Ga0097621_100020220
485 Ga0097621_100338586
486 Ga0097621_100511875
487 Ga0097621_101089644
488 Ga0068871_100000813
489 Ga0068871_100503933
490 Ga0068871_101208994
491 Ga0068865_100001369
492 Ga0068865_100058101
493 Ga0068865_100394819
494 Ga0097620_100022265
495 Ga0097620_100873808
496 Ga0097620_101791830
497 Ga0111539_10518025
498 Ga0111539_10955284
499 Ga0105247_10092607
500 Ga0105243_10095797
501 Ga0105248_10088897
502 Ga0105248_10404925
503 Ga0105248_10635938
504 Ga0105248_10838489
505 Ga0105248_10910263
506 Ga0105248_11065793
507 Ga0105248_11074930
508 Ga0105249_10063691
509 Ga0105246_10388736
510 Ga0105246_10785595
511 Ga0157327_1002729
512 Ga0157369_10501751
513 Ga0157374_10013081
514 Ga0157374_10091023
515 Ga0157374_10351312
516 Ga0157378_10072172
517 Ga0157378_10525167
518 Ga0157378_10978474
519 Ga0163162_10037039
520 Ga0163162_11620727
521 Ga0163162_11917509
522 Ga0157372_10390598
523 Ga0157375_10006101
524 Ga0157375_10094362
525 Ga0157380_10021681
526 Ga0157380_10135907
527 Ga0157377_10583674
528 Ga0157379_10041294
529 Ga0157379_10125190
530 Ga0157379_10388840
531 Ga0157376_10005091
532 Ga0157376_10796312
533 Ga0157376_10917287
534 Ga0163161_10025575
535 Ga0163161_10146648
536 Ga0163161_10239679
537 Ga0163161_10566408
538 Ga0207697_10004410
539 Ga0207656_10044507
540 Ga0207682_10039832
541 Ga0207682_10254304
542 Ga0207688_10025787
543 Ga0207688_10028322
544 Ga0207680_10017650
545 Ga0207680_10118790
546 Ga0207680_10137766
547 Ga0207645_10000286
548 Ga0207645_10039516
549 Ga0207645_10252317
550 Ga0207645_10506834
551 Ga0207643_10022132
552 Ga0207643_10260146
553 Ga0207705_10290700
554 Ga0207662_10028898
555 Ga0207657_10314698
556 Ga0207657_10938433
557 Ga0207649_10022991
558 Ga0207649_10279053
559 Ga0207681_10004963
560 Ga0207681_10261503
561 Ga0207681_10459981
562 Ga0207681_10521167
563 Ga0207650_10064907
564 Ga0207650_10139760
565 Ga0207650_10323096
566 Ga0207659_10000564
567 Ga0207659_10033259
568 Ga0207659_10050305
569 Ga0207659_10442348
570 Ga0207644_10007367
571 Ga0207644_10242958
572 Ga0207644_10436837
573 Ga0207644_10517869
574 Ga0207644_10911495
575 Ga0207706_10017710
576 Ga0207706_10035025
577 Ga0207709_10025665
578 Ga0207670_10063348
579 Ga0207670_10900321
580 Ga0207669_10021886
581 Ga0207669_10240873
582 Ga0207704_10001991
583 Ga0207704_10355960
584 Ga0207704_10453871
585 Ga0207704_11205665
586 Ga0207691_10002154
587 Ga0207691_10006869
588 Ga0207691_10014823
589 Ga0207691_10062707
590 Ga0207691_10097689
591 Ga0207691_10773651
592 Ga0207691_10976508
593 Ga0207711_10170493
594 Ga0207711_10258752
595 Ga0207711_10524044
596 Ga0207711_10536116
597 Ga0207689_10029515
598 Ga0207679_10498101
599 Ga0207679_10563810
600 Ga0207679_10764653
601 Ga0207651_10209920
602 Ga0207651_10728978
603 Ga0207712_10037668
604 Ga0207712_11282717
605 Ga0207668_10005485
606 Ga0207668_10049199
607 Ga0207640_10273749
608 Ga0207658_10004386
609 Ga0207658_10010727
610 Ga0207658_10082777
611 Ga0207658_10090266
612 Ga0207677_10008026
613 Ga0207677_10664732
614 Ga0207703_10004196
615 Ga0207703_10032948
616 Ga0207703_10284753
617 Ga0207703_10585942
618 Ga0207639_10050782
619 Ga0207678_10230048
620 Ga0207678_10461491
621 Ga0207678_10768047
622 Ga0207678_11196165
623 Ga0207702_10992541
624 Ga0207641_10019913
625 Ga0207641_10042170
626 Ga0207641_10997408
627 Ga0207641_11342979
628 Ga0207648_10009351
629 Ga0207676_10009320
630 Ga0207676_10519049
631 Ga0207676_11803116
632 Ga0207675_100045108
633 Ga0207675_100096559
634 Ga0207675_100138310
635 Ga0207675_100204130
636 Ga0207683_10002147
637 Ga0207683_10274157
638 Ga0207683_10859747
639 Ga0207698_10393453
640 Ga0207698_10806225
641 Ga0268266_10014928
642 Ga0268266_10138380
643 Ga0268265_10066677
644 Ga0268265_10110598
645 Ga0268265_10577338
646 Ga0268264_10032441
647 Ga0268264_10106257
648 Ga0268264_10365369
649 Ga0268264_10598858
650 Ga0268264_11183209
651 Ga0265332_10000449
652 Ga0265325_10113049
653 Ga0265329_10022823
654 Ga0265339_10073778
655 Ga0265331_10000571
656 Ga0265327_10017824
657 Ga0307408_100003207
658 Ga0265313_10353413
659 Ga0265342_10055014
660 Ga0316576_10083687
661 Ga0316578_10000412
662 Ga0316578_10208687
663 Ga0307405_10000672
664 Ga0316577_10118872
665 Ga0307413_10007236
666 Ga0307410_10002882
667 Ga0307406_10001819
668 Ga0307407_10011401
669 Ga0307412_10058524
670 Ga0307409_100000163
671 Ga0307416_100007775
672 Ga0307414_10067312
673 Ga0307414_10712127
674 Ga0307411_10004813
675 Ga0307415_100000252
676 Ga0316580_10000473
677 Ga0373960_0172292
678 Ga0316574_0000327
679 Ga0316574_0005355
680 Ga0316574_0016700
681 Ga0316574_0120577
682 Ga0373935_0306323
683 Ga0373933_0226298
684 Ga0373937_0139456
685 Ga0373937_0341170
686 Ga0316582_0442908
687 Ga0316584_0033527
688 Ga0316584_0164430
689 Ga0451787_846531
690 Ga0451802_1563161
691 Ga0451807_0520537
692 Ga0451833_0090030
693 Ga0451853_3885150
694 Ga0451853_4050336
695 Ga0439464_0014317
696 Ga0439460_0010105
697 Ga0451577_0003942
698 Ga0451577_0021319
699 Ga0451577_0082677
700 Ga0451577_0100362
701 Ga0451577_0106436
702 Ga0451577_0150288
703 Ga0453683_0000571
704 Ga0453683_0529830
705 Ga0453684_0053532
706 Ga0453684_0613189
707 Ga0453684_0806952
708 Ga0453684_1777288
709 Ga0451576_0043566
710 Ga0451576_0144933
711 Ga0451576_0278027
712 Ga0451576_1021942
713 Ga0451576_2321360
714 Ga0495621_0034695
715 Ga0495658_0252594
716 Ga0495658_0682788
717 Ga0495680_0567177
718 Ga0496104_0253975
719 Ga0496104_0466042
720 Ga0496106_0353146
721 Ga0496106_0889404
722 Ga0496109_0071381
723 Ga0496109_0939534
724 Ga0496110_0024801
725 Ga0496110_0311993
726 Ga0496110_0873451
727 Ga0496111_0076372
728 Ga0496114_0465820
729 Ga0496114_1084909
730 Ga0501036_0255656
731 Ga0501038_0194698
732 Ga0501039_1042267
733 Ga0501041_0263393
734 Ga0501048_0113507
735 Ga0501072_0244598
736 Ga0501075_0143297
737 Ga0501076_0277313
738 Ga0501079_0096956
739 Ga0501080_0278449
740 Ga0501081_0248866
741 Ga0501045_0090724
742 Ga0501045_0577144
743 Ga0495612_0143215
744 Ga0495595_0021691
745 Ga0495619_0531196
746 Ga0501082_0201587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

29

144

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u8y-assembly1.cif.gz_k structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex 0.8696 8 131
5b3q-assembly1.cif.gz_A nqo5 of the trypsin-resistant fragment (1-134) in p63 form 0.8493 6 127
3mcr-assembly1.cif.gz_A crystal structure of nadh dehydrogenase subunit c (tfu_2693) from thermobifida fusca yx-er1 at 2.65 a resolution 0.8425 5 124
8e9i-assembly1.cif.gz_C mycobacterial respiratory complex i, semi-inserted quinone 0.8121 8 146
6rfq-assembly1.cif.gz_G cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.8007 4 146
ID Description Score Start End Superfamily
af_Q9VZU4_36_188_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8875 2 128 3.30.460.80
af_Q10884_4_103_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8871 27 128 3.30.460.80
af_A0A1D8PJ73_47_194_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8866 2 128 3.30.460.80
af_Q10884_4_103_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.855 27 128 3.30.460.80
5b3qA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8493 6 127 3.30.460.80
ID Description Score Start End GO Terms
AF-A0A2P7P3D1-F1-model_v4 deleted 0.952 23 115
AF-A0A2P7P3D1-F1-model_v4 deleted 0.9422 23 115
AF-A0A2V9HHC5-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.929 22 109 GO:0008137
AF-A0A7Y4YY92-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.925 8 118 GO:0008137
AF-A0A537Y8Q0-F1-model_v4 NADH-quinone oxidoreductase subunit D (EC 7.1.1.-) (NADH dehydrogenase I subunit D) (NDH-1 subunit D) 0.9165 6 127 GO:0005886
GO:0008137
GO:0048038
GO:0050136
GO:0051287

Map