F426476

General Info

Members Datasets Scaffolds Average Seq Length
373 204 746 126

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0575455|Ga0496104_0575455_401_814
Length 137
Sequence MSSPEQTTAGGSFRTWNGRTPHEIFDGVRLHAIGGEQVLLCRVVYEPGKKVEWHSHEHTEQVMFILDGSVEVTVEEETQTMGPGDVAVINRGVPHALYSEGGVTFMEALAPVPLDHVPDRDRDLVLGPDGGATHVER

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
157 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 20.38
Rhizosphere 79.09
Stem 0
Stem Tuber 0
Unclassified 7.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0575455 3300048907 Unclassified 1037
2 Ga0070658_10077640 3300005327 Bacteria 2724
3 Ga0070683_100009228 3300005329 Bacteria 8428
4 Ga0070680_100009159 3300005336 Bacteria 7592
5 Ga0070680_100730876 3300005336 Bacteria 852
6 Ga0070682_100037179 3300005337 Bacteria 2979
7 Ga0070682_100272745 3300005337 Bacteria 1230
8 Ga0070682_100530084 3300005337 Bacteria 918
9 Ga0070682_100950630 3300005337 Bacteria 710
10 Ga0070660_100115079 3300005339 Bacteria 2143
11 Ga0070660_100334311 3300005339 Bacteria 1246
12 Ga0070691_10531485 3300005341 Bacteria 684
13 Ga0070691_10763008 3300005341 Bacteria 586
14 Ga0070687_100010995 3300005343 Bacteria 3942
15 Ga0070687_100370455 3300005343 Bacteria 930
16 Ga0070668_101511115 3300005347 Bacteria 614
17 Ga0070675_101893936 3300005354 Bacteria 550
18 Ga0070671_101126033 3300005355 Bacteria 690
19 Ga0070674_100254007 3300005356 Bacteria 1382
20 Ga0070688_100824190 3300005365 Unclassified 727
21 Ga0070659_101316863 3300005366 Bacteria 641
22 Ga0070667_100034981 3300005367 Archaea 4207
23 Ga0070709_10208707 3300005434 Bacteria 1387
24 Ga0070714_100038306 3300005435 Bacteria 4031
25 Ga0070713_100130004 3300005436 Bacteria 2220
26 Ga0070710_10025923 3300005437 Bacteria 3109
27 Ga0070701_10464282 3300005438 Bacteria 815
28 Ga0070705_100020933 3300005440 Archaea 3471
29 Ga0070705_100154220 3300005440 Bacteria 1527
30 Ga0070694_100235718 3300005444 Bacteria 1378
31 Ga0070708_100143977 3300005445 Bacteria 2212
32 Ga0070708_100220096 3300005445 Bacteria 1780
33 Ga0070708_101360089 3300005445 Bacteria 663
34 Ga0070663_100016095 3300005455 Archaea 4844
35 Ga0070663_100776559 3300005455 Bacteria 820
36 Ga0070678_100001086 3300005456 Bacteria 14240
37 Ga0070662_100786542 3300005457 Bacteria 808
38 Ga0070662_100850443 3300005457 Bacteria 777
39 Ga0070681_10040018 3300005458 Bacteria 4700
40 Ga0068867_100386441 3300005459 Bacteria 1177
41 Ga0068867_100517807 3300005459 Bacteria 1028
42 Ga0070685_10934141 3300005466 Bacteria 647
43 Ga0070706_100047150 3300005467 Bacteria 3976
44 Ga0070706_100120216 3300005467 Bacteria 2448
45 Ga0070706_100177946 3300005467 Bacteria 1986
46 Ga0070707_100003853 3300005468 Bacteria 14130
47 Ga0070707_100867742 3300005468 Bacteria 867
48 Ga0070698_100002289 3300005471 Bacteria 21205
49 Ga0070698_100023735 3300005471 Bacteria 6407
50 Ga0070698_100049381 3300005471 Bacteria 4294
51 Ga0070699_100031636 3300005518 Bacteria 4568
52 Ga0070699_100581224 3300005518 Unclassified 1021
53 Ga0070679_100003293 3300005530 Bacteria 14787
54 Ga0070684_100000507 3300005535 Bacteria 26705
55 Ga0070684_100328665 3300005535 Bacteria 1405
56 Ga0070684_100436382 3300005535 Bacteria 1210
57 Ga0070697_100156894 3300005536 Bacteria 1921
58 Ga0070686_100002363 3300005544 Bacteria 10396
59 Ga0070695_100974325 3300005545 Bacteria 688
60 Ga0070696_100066388 3300005546 Archaea 2530
61 Ga0070696_100279624 3300005546 Bacteria 1272
62 Ga0070693_100101833 3300005547 Bacteria 1751
63 Ga0070693_100485726 3300005547 Bacteria 873
64 Ga0070665_100339924 3300005548 Bacteria 1506
65 Ga0070704_100003576 3300005549 Bacteria 8935
66 Ga0070704_100123548 3300005549 Bacteria 1993
67 Ga0070704_100487746 3300005549 Bacteria 1067
68 Ga0070704_101185897 3300005549 Unclassified 696
69 Ga0068855_101716400 3300005563 Bacteria 640
70 Ga0068855_101883395 3300005563 Bacteria 606
71 Ga0070664_100253466 3300005564 Bacteria 1582
72 Ga0068857_100839189 3300005577 Bacteria 879
73 Ga0068857_102229763 3300005577 Bacteria 538
74 Ga0068856_100065002 3300005614 Bacteria 3604
75 Ga0068856_100084567 3300005614 Bacteria 3151
76 Ga0068856_100093553 3300005614 Bacteria 2991
77 Ga0068856_100552606 3300005614 Bacteria 1172
78 Ga0070702_100010308 3300005615 Archaea 4597
79 Ga0070702_100052175 3300005615 Bacteria 2345
80 Ga0068859_100065584 3300005617 Archaea 3664
81 Ga0068859_101817351 3300005617 Bacteria 673
82 Ga0068864_100644532 3300005618 Bacteria 1031
83 Ga0068866_10060189 3300005718 Archaea 1968
84 Ga0068861_100077697 3300005719 Bacteria 2590
85 Ga0068861_100611238 3300005719 Bacteria 1002
86 Ga0068861_102431184 3300005719 Bacteria 527
87 Ga0068870_10632845 3300005840 Bacteria 731
88 Ga0068863_100965249 3300005841 Bacteria 854
89 Ga0068858_100027991 3300005842 Archaea 5237
90 Ga0068860_100070810 3300005843 Archaea 3315
91 Ga0068860_102449523 3300005843 Bacteria 542
92 Ga0081455_10035932 3300005937 Bacteria 4418
93 Ga0081538_10047004 3300005981 Bacteria 2653
94 Ga0081538_10077658 3300005981 Bacteria 1787
95 Ga0081539_10008097 3300005985 Bacteria 9293
96 Ga0081539_10008144 3300005985 Bacteria 9253
97 Ga0070717_10060377 3300006028 Bacteria 3140
98 Ga0070717_10082290 3300006028 Bacteria 2705
99 Ga0070715_10004249 3300006163 Archaea 4674
100 Ga0070715_10125644 3300006163 Bacteria 1228
101 Ga0070716_100037362 3300006173 Bacteria 2683
102 Ga0070716_100431293 3300006173 Unclassified 956
103 Ga0070712_100115931 3300006175 Bacteria 2008
104 Ga0097621_100003029 3300006237 Bacteria 11538
105 Ga0097621_100054967 3300006237 Bacteria 3250
106 Ga0068871_100248442 3300006358 Bacteria 1549
107 Ga0075428_102096639 3300006844 Unclassified 585
108 Ga0075433_10127837 3300006852 Bacteria 2257
109 Ga0075433_10939701 3300006852 Bacteria 754
110 Ga0075434_100747457 3300006871 Bacteria 995
111 Ga0075434_102172532 3300006871 Bacteria 559
112 Ga0068865_100039182 3300006881 Archaea 3213
113 Ga0097620_100065587 3300006931 Archaea 3664
114 Ga0097620_101818108 3300006931 Bacteria 673
115 Ga0075435_100359539 3300007076 Bacteria 1249
116 Ga0075435_100783073 3300007076 Unclassified 830
117 Ga0111539_10491983 3300009094 Archaea 1428
118 Ga0105245_10005404 3300009098 Bacteria 11227
119 Ga0105245_10190218 3300009098 Bacteria 1965
120 Ga0105245_10783094 3300009098 Unclassified 991
121 Ga0105245_10866900 3300009098 Bacteria 943
122 Ga0105245_12849889 3300009098 Bacteria 536
123 Ga0105247_10183703 3300009101 Bacteria 1397
124 Ga0114129_10988790 3300009147 Unclassified 1060
125 Ga0105243_10011107 3300009148 Bacteria 6813
126 Ga0105243_10018195 3300009148 Archaea 5320
127 Ga0105243_10218881 3300009148 Bacteria 1682
128 Ga0105243_10483647 3300009148 Archaea 1169
129 Ga0105241_10036987 3300009174 Archaea 3676
130 Ga0105241_10062475 3300009174 Bacteria 2872
131 Ga0105241_10501070 3300009174 Bacteria 1083
132 Ga0105242_10026340 3300009176 Archaea 4608
133 Ga0105248_10026784 3300009177 Archaea 6412
134 Ga0105248_10750429 3300009177 Archaea 1101
135 Ga0105238_11372132 3300009551 Bacteria 734
136 Ga0105238_11564173 3300009551 Bacteria 689
137 Ga0105249_11370013 3300009553 Bacteria 779
138 Ga0105239_10625264 3300010375 Bacteria 1229
139 Ga0105239_10700370 3300010375 Bacteria 1158
140 Ga0105239_11117055 3300010375 Bacteria 908
141 Ga0105246_10337692 3300011119 Bacteria 1230
142 Ga0157369_11733688 3300013105 Bacteria 635
143 Ga0157369_12071014 3300013105 Unclassified 577
144 Ga0157374_10056334 3300013296 Bacteria 3669
145 Ga0157378_10038099 3300013297 Archaea 4260
146 Ga0157378_10550411 3300013297 Bacteria 1159
147 Ga0163162_10466293 3300013306 Bacteria 1394
148 Ga0157372_10706459 3300013307 Bacteria 1173
149 Ga0157375_11853929 3300013308 Bacteria 715
150 Ga0163163_10381184 3300014325 Bacteria 1468
151 Ga0163163_10851740 3300014325 Unclassified 975
152 Ga0163163_10925427 3300014325 Bacteria 935
153 Ga0163163_10977057 3300014325 Unclassified 910
154 Ga0157380_10038629 3300014326 Archaea 3707
155 Ga0157380_11773601 3300014326 Bacteria 676
156 Ga0182008_10053084 3300014497 Bacteria 2008
157 Ga0157377_10224443 3300014745 Bacteria 1204
158 Ga0157379_10002574 3300014968 Bacteria 15231
159 Ga0157379_11054464 3300014968 Bacteria 777
160 Ga0157376_10052264 3300014969 Archaea 3397
161 Ga0157376_10373309 3300014969 Bacteria 1372
162 Ga0157376_10862888 3300014969 Unclassified 921
163 Ga0182007_10238473 3300015262 Bacteria 648
164 Ga0163161_11226512 3300017792 Bacteria 649
165 Ga0207653_10040060 3300025885 Bacteria 1535
166 Ga0207692_10213564 3300025898 Unclassified 1140
167 Ga0207642_10013326 3300025899 Archaea 2998
168 Ga0207710_10014719 3300025900 Archaea 3302
169 Ga0207688_11042787 3300025901 Bacteria 516
170 Ga0207680_10269954 3300025903 Bacteria 1179
171 Ga0207685_10012908 3300025905 Bacteria 2566
172 Ga0207685_10014747 3300025905 Archaea 2454
173 Ga0207643_10487391 3300025908 Bacteria 787
174 Ga0207643_10611626 3300025908 Bacteria 702
175 Ga0207705_10570881 3300025909 Bacteria 879
176 Ga0207684_10096992 3300025910 Bacteria 2516
177 Ga0207684_10127288 3300025910 Bacteria 2186
178 Ga0207684_10251377 3300025910 Bacteria 1525
179 Ga0207684_10259495 3300025910 Bacteria 1499
180 Ga0207684_11149386 3300025910 Bacteria 645
181 Ga0207654_10044757 3300025911 Bacteria 2515
182 Ga0207654_10143631 3300025911 Archaea 1525
183 Ga0207707_10030346 3300025912 Bacteria 4730
184 Ga0207693_10001920 3300025915 Bacteria 18192
185 Ga0207663_10064225 3300025916 Bacteria 2342
186 Ga0207660_10006359 3300025917 Bacteria 7658
187 Ga0207660_10249247 3300025917 Bacteria 1401
188 Ga0207657_10006534 3300025919 Bacteria 12074
189 Ga0207657_10131683 3300025919 Bacteria 2049
190 Ga0207649_10820731 3300025920 Bacteria 727
191 Ga0207652_10002716 3300025921 Bacteria 14840
192 Ga0207659_11623246 3300025926 Bacteria 552
193 Ga0207687_10008205 3300025927 Bacteria 6833
194 Ga0207687_10040747 3300025927 Bacteria 3185
195 Ga0207687_10568211 3300025927 Bacteria 953
196 Ga0207700_10105747 3300025928 Bacteria 2254
197 Ga0207664_10009046 3300025929 Bacteria 6975
198 Ga0207664_10930699 3300025929 Bacteria 780
199 Ga0207644_10554465 3300025931 Bacteria 952
200 Ga0207644_10790959 3300025931 Bacteria 793
201 Ga0207709_10014889 3300025935 Bacteria 4302
202 Ga0207709_10104444 3300025935 Bacteria 1880
203 Ga0207670_10889003 3300025936 Bacteria 746
204 Ga0207669_10598054 3300025937 Bacteria 896
205 Ga0207704_10410689 3300025938 Bacteria 1071
206 Ga0207665_10123396 3300025939 Bacteria 1831
207 Ga0207691_10192450 3300025940 Bacteria 1778
208 Ga0207711_10065729 3300025941 Archaea 3135
209 Ga0207661_10012681 3300025944 Bacteria 6135
210 Ga0207679_10189968 3300025945 Bacteria 1707
211 Ga0207667_11733232 3300025949 Bacteria 590
212 Ga0207640_10325958 3300025981 Bacteria 1225
213 Ga0207658_10258815 3300025986 Bacteria 1482
214 Ga0207703_10095869 3300026035 Archaea 2503
215 Ga0207703_10724566 3300026035 Archaea 947
216 Ga0207678_10027459 3300026067 Archaea 4966
217 Ga0207708_10297318 3300026075 Bacteria 1312
218 Ga0207708_10399909 3300026075 Unclassified 1136
219 Ga0207708_11288146 3300026075 Bacteria 640
220 Ga0207702_10003255 3300026078 Bacteria 15002
221 Ga0207702_10135113 3300026078 Bacteria 2224
222 Ga0207702_10164199 3300026078 Bacteria 2030
223 Ga0207648_10392321 3300026089 Bacteria 1257
224 Ga0207676_11515000 3300026095 Bacteria 668
225 Ga0207676_11532146 3300026095 Bacteria 664
226 Ga0207675_100109281 3300026118 Bacteria 2609
227 Ga0207675_100959594 3300026118 Bacteria 873
228 Ga0207683_10000047 3300026121 Bacteria 89190
229 Ga0207683_10043195 3300026121 Bacteria 3939
230 Ga0207698_10275208 3300026142 Bacteria 1554
231 Ga0268266_10684672 3300028379 Bacteria 988
232 Ga0268265_10347745 3300028380 Bacteria 1353
233 Ga0268265_11816532 3300028380 Unclassified 616
234 Ga0268264_10368594 3300028381 Bacteria 1372
235 Ga0268264_11264405 3300028381 Unclassified 748
236 Ga0265334_10285715 3300028573 Unclassified 566
237 Ga0265338_10455144 3300028800 Bacteria 906
238 Ga0307405_11413954 3300031731 Bacteria 609
239 Ga0307405_12067137 3300031731 Unclassified 511
240 Ga0307407_10869831 3300031903 Bacteria 690
241 Ga0307409_101668528 3300031995 Bacteria 666
242 Ga0373931_0354928 3300035691 Bacteria 919
243 Ga0373937_0395148 3300036401 Unclassified 1312
244 Ga0395899_0509543 3300037312 Bacteria 779
245 Ga0395900_0038863 3300037418 Bacteria 4905
246 Ga0395900_0409356 3300037418 Bacteria 1319
247 Ga0395900_0613391 3300037418 Bacteria 1027
248 Ga0395900_1288451 3300037418 Bacteria 645
249 Ga0395898_0016989 3300037466 Bacteria 7430
250 Ga0395898_0017941 3300037466 Bacteria 7221
251 Ga0395898_0592949 3300037466 Bacteria 1051
252 Ga0395905_0032942 3300037471 Bacteria 4871
253 Ga0395905_0112917 3300037471 Bacteria 2552
254 Ga0395905_0427750 3300037471 Bacteria 1221
255 Ga0395901_0006001 3300038443 Bacteria 12305
256 Ga0395901_0015926 3300038443 Bacteria 7659
257 Ga0395901_0101858 3300038443 Bacteria 3013
258 Ga0395901_0199210 3300038443 Bacteria 2099
259 Ga0451849_0785311 3300041505 Unclassified 554
260 Ga0451855_0426238 3300041511 Bacteria 519
261 Ga0466965_0586726 3300044683 Bacteria 632
262 Ga0466963_1014438 3300044694 Bacteria 584
263 Ga0451576_1379266 3300045051 Bacteria 734
264 Ga0466967_1544797 3300045976 Unclassified 661
265 Ga0495639_0140494 3300046475 Bacteria 1161
266 Ga0495584_0674538 3300046491 Bacteria 527
267 Ga0495585_0167218 3300046492 Bacteria 1138
268 Ga0495596_0154634 3300046500 Bacteria 891
269 Ga0495656_0065586 3300046615 Bacteria 1597
270 Ga0495659_0093951 3300046664 Bacteria 1155
271 Ga0495661_0450804 3300046665 Bacteria 619
272 Ga0495589_0164914 3300046794 Bacteria 1055
273 Ga0495589_0195566 3300046794 Bacteria 956
274 Ga0495680_0795981 3300047322 Bacteria 618
275 Ga0495677_0345173 3300047445 Bacteria 587
276 Ga0496100_0039686 3300048903 Archaea 2990
277 Ga0496100_0644019 3300048903 Bacteria 825
278 Ga0496101_0001218 3300048904 Bacteria 15404
279 Ga0496101_0105509 3300048904 Bacteria 2115
280 Ga0496101_0107573 3300048904 Archaea 2095
281 Ga0496101_0107873 3300048904 Bacteria 2093
282 Ga0496101_0113046 3300048904 Bacteria 2046
283 Ga0496101_1054275 3300048904 Bacteria 639
284 Ga0496102_0002587 3300048905 Bacteria 15431
285 Ga0496102_0004037 3300048905 Bacteria 12438
286 Ga0496102_0127668 3300048905 Bacteria 2378
287 Ga0496102_0240768 3300048905 Bacteria 1706
288 Ga0496102_0466148 3300048905 Unclassified 1184
289 Ga0496103_0037660 3300048906 Archaea 2964
290 Ga0496103_0105520 3300048906 Bacteria 1786
291 Ga0496103_0349111 3300048906 Unclassified 951
292 Ga0496104_0000151 3300048907 Bacteria 64587
293 Ga0496104_0003850 3300048907 Bacteria 12987
294 Ga0496104_0008392 3300048907 Bacteria 9183
295 Ga0496104_0027434 3300048907 Bacteria 5270
296 Ga0496104_0060974 3300048907 Bacteria 3574
297 Ga0496105_0000049 3300048908 Bacteria 94762
298 Ga0496105_0007141 3300048908 Archaea 8615
299 Ga0496105_0008308 3300048908 Bacteria 8069
300 Ga0496105_0037208 3300048908 Bacteria 4008
301 Ga0496105_0053537 3300048908 Bacteria 3333
302 Ga0496106_0003633 3300048909 Archaea 11502
303 Ga0496106_0030817 3300048909 Bacteria 3998
304 Ga0496106_0119046 3300048909 Bacteria 2063
305 Ga0496107_0028597 3300048910 Bacteria 3962
306 Ga0496107_0047824 3300048910 Archaea 3080
307 Ga0496107_0236877 3300048910 Bacteria 1358
308 Ga0496107_0386426 3300048910 Bacteria 1041
309 Ga0496107_0488475 3300048910 Bacteria 913
310 Ga0496108_0001597 3300048911 Bacteria 17944
311 Ga0496108_0007452 3300048911 Bacteria 8870
312 Ga0496108_0440141 3300048911 Unclassified 1139
313 Ga0496108_0617287 3300048911 Unclassified 944
314 Ga0496109_0000205 3300048912 Bacteria 58240
315 Ga0496109_0000613 3300048912 Bacteria 29798
316 Ga0496109_0004319 3300048912 Bacteria 11870
317 Ga0496109_0051253 3300048912 Bacteria 3759
318 Ga0496109_0052741 3300048912 Bacteria 3708
319 Ga0496109_0685269 3300048912 Bacteria 962
320 Ga0496110_0000227 3300048913 Bacteria 36597
321 Ga0496110_0000363 3300048913 Bacteria 30372
322 Ga0496110_0002454 3300048913 Bacteria 13884
323 Ga0496110_0526678 3300048913 Unclassified 1075
324 Ga0496111_0002721 3300048914 Bacteria 10742
325 Ga0496111_0004118 3300048914 Bacteria 9128
326 Ga0496111_0021233 3300048914 Bacteria 4531
327 Ga0496111_0068896 3300048914 Bacteria 2572
328 Ga0496111_0214585 3300048914 Bacteria 1429
329 Ga0496111_1210774 3300048914 Bacteria 535
330 Ga0496112_0022047 3300048915 Bacteria 6065
331 Ga0496112_0027399 3300048915 Bacteria 5493
332 Ga0496112_0036933 3300048915 Bacteria 4767
333 Ga0496112_0308403 3300048915 Archaea 1528
334 Ga0496112_0800926 3300048915 Bacteria 867
335 Ga0496112_0897550 3300048915 Bacteria 808
336 Ga0496112_0993307 3300048915 Bacteria 759
337 Ga0496112_1278901 3300048915 Bacteria 649
338 Ga0496112_1317214 3300048915 Bacteria 638
339 Ga0496112_1836511 3300048915 Bacteria 518
340 Ga0496113_0013491 3300048916 Bacteria 5540
341 Ga0496113_0047175 3300048916 Bacteria 3201
342 Ga0496113_0183925 3300048916 Bacteria 1657
343 Ga0496113_0434645 3300048916 Bacteria 1054
344 Ga0496114_0000129 3300048917 Bacteria 54506
345 Ga0496114_0001201 3300048917 Bacteria 19599
346 Ga0496114_0002907 3300048917 Bacteria 13126
347 Ga0496114_0013541 3300048917 Bacteria 6543
348 Ga0496115_0004026 3300048918 Bacteria 10613
349 Ga0496115_0028082 3300048918 Archaea 4407
350 Ga0496115_0163719 3300048918 Bacteria 1839
351 Ga0501041_0171374 3300049577 Bacteria 1358
352 Ga0501042_0027627 3300049578 Bacteria 3991
353 Ga0501046_0485361 3300049580 Bacteria 886
354 Ga0501067_0003124 3300049583 Bacteria 9146
355 Ga0501067_0020979 3300049583 Bacteria 3614
356 Ga0501067_0050038 3300049583 Bacteria 2316
357 Ga0501068_0243802 3300049584 Bacteria 1144
358 Ga0501069_0204265 3300049585 Bacteria 1145
359 Ga0501070_0186780 3300049586 Bacteria 1705
360 Ga0501070_0390293 3300049586 Bacteria 1127
361 Ga0501076_0157088 3300049592 Bacteria 1852
362 Ga0501079_0155769 3300049741 Bacteria 1781
363 Ga0501080_0037902 3300049742 Bacteria 4502
364 Ga0501045_0414258 3300049824 Bacteria 1002
365 nmdc:mga05p37_187454_c1 3300050507 Bacteria 2514
366 nmdc:mga08y16_465154_c1 3300050511 Archaea 1288
367 nmdc:mga0rr50_386657_c1 3300050513 Bacteria 1180
368 nmdc:mga0rr50_805631_c1 3300050513 Bacteria 801
369 nmdc:mga0a205_343771_c1 3300050515 Bacteria 1360
370 nmdc:mga0a205_788481_c1 3300050515 Bacteria 798
371 Ga0495612_0105086 3300053078 Unclassified 1205
372 Ga0495655_0052439 3300053083 Bacteria 1085
373 Ga0530510_0022516 3300061734 Bacteria 4489
374 Ga0496104_0575455
375 Ga0070658_10077640
376 Ga0070683_100009228
377 Ga0070680_100009159
378 Ga0070680_100730876
379 Ga0070682_100037179
380 Ga0070682_100272745
381 Ga0070682_100530084
382 Ga0070682_100950630
383 Ga0070660_100115079
384 Ga0070660_100334311
385 Ga0070691_10531485
386 Ga0070691_10763008
387 Ga0070687_100010995
388 Ga0070687_100370455
389 Ga0070668_101511115
390 Ga0070675_101893936
391 Ga0070671_101126033
392 Ga0070674_100254007
393 Ga0070688_100824190
394 Ga0070659_101316863
395 Ga0070667_100034981
396 Ga0070709_10208707
397 Ga0070714_100038306
398 Ga0070713_100130004
399 Ga0070710_10025923
400 Ga0070701_10464282
401 Ga0070705_100020933
402 Ga0070705_100154220
403 Ga0070694_100235718
404 Ga0070708_100143977
405 Ga0070708_100220096
406 Ga0070708_101360089
407 Ga0070663_100016095
408 Ga0070663_100776559
409 Ga0070678_100001086
410 Ga0070662_100786542
411 Ga0070662_100850443
412 Ga0070681_10040018
413 Ga0068867_100386441
414 Ga0068867_100517807
415 Ga0070685_10934141
416 Ga0070706_100047150
417 Ga0070706_100120216
418 Ga0070706_100177946
419 Ga0070707_100003853
420 Ga0070707_100867742
421 Ga0070698_100002289
422 Ga0070698_100023735
423 Ga0070698_100049381
424 Ga0070699_100031636
425 Ga0070699_100581224
426 Ga0070679_100003293
427 Ga0070684_100000507
428 Ga0070684_100328665
429 Ga0070684_100436382
430 Ga0070697_100156894
431 Ga0070686_100002363
432 Ga0070695_100974325
433 Ga0070696_100066388
434 Ga0070696_100279624
435 Ga0070693_100101833
436 Ga0070693_100485726
437 Ga0070665_100339924
438 Ga0070704_100003576
439 Ga0070704_100123548
440 Ga0070704_100487746
441 Ga0070704_101185897
442 Ga0068855_101716400
443 Ga0068855_101883395
444 Ga0070664_100253466
445 Ga0068857_100839189
446 Ga0068857_102229763
447 Ga0068856_100065002
448 Ga0068856_100084567
449 Ga0068856_100093553
450 Ga0068856_100552606
451 Ga0070702_100010308
452 Ga0070702_100052175
453 Ga0068859_100065584
454 Ga0068859_101817351
455 Ga0068864_100644532
456 Ga0068866_10060189
457 Ga0068861_100077697
458 Ga0068861_100611238
459 Ga0068861_102431184
460 Ga0068870_10632845
461 Ga0068863_100965249
462 Ga0068858_100027991
463 Ga0068860_100070810
464 Ga0068860_102449523
465 Ga0081455_10035932
466 Ga0081538_10047004
467 Ga0081538_10077658
468 Ga0081539_10008097
469 Ga0081539_10008144
470 Ga0070717_10060377
471 Ga0070717_10082290
472 Ga0070715_10004249
473 Ga0070715_10125644
474 Ga0070716_100037362
475 Ga0070716_100431293
476 Ga0070712_100115931
477 Ga0097621_100003029
478 Ga0097621_100054967
479 Ga0068871_100248442
480 Ga0075428_102096639
481 Ga0075433_10127837
482 Ga0075433_10939701
483 Ga0075434_100747457
484 Ga0075434_102172532
485 Ga0068865_100039182
486 Ga0097620_100065587
487 Ga0097620_101818108
488 Ga0075435_100359539
489 Ga0075435_100783073
490 Ga0111539_10491983
491 Ga0105245_10005404
492 Ga0105245_10190218
493 Ga0105245_10783094
494 Ga0105245_10866900
495 Ga0105245_12849889
496 Ga0105247_10183703
497 Ga0114129_10988790
498 Ga0105243_10011107
499 Ga0105243_10018195
500 Ga0105243_10218881
501 Ga0105243_10483647
502 Ga0105241_10036987
503 Ga0105241_10062475
504 Ga0105241_10501070
505 Ga0105242_10026340
506 Ga0105248_10026784
507 Ga0105248_10750429
508 Ga0105238_11372132
509 Ga0105238_11564173
510 Ga0105249_11370013
511 Ga0105239_10625264
512 Ga0105239_10700370
513 Ga0105239_11117055
514 Ga0105246_10337692
515 Ga0157369_11733688
516 Ga0157369_12071014
517 Ga0157374_10056334
518 Ga0157378_10038099
519 Ga0157378_10550411
520 Ga0163162_10466293
521 Ga0157372_10706459
522 Ga0157375_11853929
523 Ga0163163_10381184
524 Ga0163163_10851740
525 Ga0163163_10925427
526 Ga0163163_10977057
527 Ga0157380_10038629
528 Ga0157380_11773601
529 Ga0182008_10053084
530 Ga0157377_10224443
531 Ga0157379_10002574
532 Ga0157379_11054464
533 Ga0157376_10052264
534 Ga0157376_10373309
535 Ga0157376_10862888
536 Ga0182007_10238473
537 Ga0163161_11226512
538 Ga0207653_10040060
539 Ga0207692_10213564
540 Ga0207642_10013326
541 Ga0207710_10014719
542 Ga0207688_11042787
543 Ga0207680_10269954
544 Ga0207685_10012908
545 Ga0207685_10014747
546 Ga0207643_10487391
547 Ga0207643_10611626
548 Ga0207705_10570881
549 Ga0207684_10096992
550 Ga0207684_10127288
551 Ga0207684_10251377
552 Ga0207684_10259495
553 Ga0207684_11149386
554 Ga0207654_10044757
555 Ga0207654_10143631
556 Ga0207707_10030346
557 Ga0207693_10001920
558 Ga0207663_10064225
559 Ga0207660_10006359
560 Ga0207660_10249247
561 Ga0207657_10006534
562 Ga0207657_10131683
563 Ga0207649_10820731
564 Ga0207652_10002716
565 Ga0207659_11623246
566 Ga0207687_10008205
567 Ga0207687_10040747
568 Ga0207687_10568211
569 Ga0207700_10105747
570 Ga0207664_10009046
571 Ga0207664_10930699
572 Ga0207644_10554465
573 Ga0207644_10790959
574 Ga0207709_10014889
575 Ga0207709_10104444
576 Ga0207670_10889003
577 Ga0207669_10598054
578 Ga0207704_10410689
579 Ga0207665_10123396
580 Ga0207691_10192450
581 Ga0207711_10065729
582 Ga0207661_10012681
583 Ga0207679_10189968
584 Ga0207667_11733232
585 Ga0207640_10325958
586 Ga0207658_10258815
587 Ga0207703_10095869
588 Ga0207703_10724566
589 Ga0207678_10027459
590 Ga0207708_10297318
591 Ga0207708_10399909
592 Ga0207708_11288146
593 Ga0207702_10003255
594 Ga0207702_10135113
595 Ga0207702_10164199
596 Ga0207648_10392321
597 Ga0207676_11515000
598 Ga0207676_11532146
599 Ga0207675_100109281
600 Ga0207675_100959594
601 Ga0207683_10000047
602 Ga0207683_10043195
603 Ga0207698_10275208
604 Ga0268266_10684672
605 Ga0268265_10347745
606 Ga0268265_11816532
607 Ga0268264_10368594
608 Ga0268264_11264405
609 Ga0265334_10285715
610 Ga0265338_10455144
611 Ga0307405_11413954
612 Ga0307405_12067137
613 Ga0307407_10869831
614 Ga0307409_101668528
615 Ga0373931_0354928
616 Ga0373937_0395148
617 Ga0395899_0509543
618 Ga0395900_0038863
619 Ga0395900_0409356
620 Ga0395900_0613391
621 Ga0395900_1288451
622 Ga0395898_0016989
623 Ga0395898_0017941
624 Ga0395898_0592949
625 Ga0395905_0032942
626 Ga0395905_0112917
627 Ga0395905_0427750
628 Ga0395901_0006001
629 Ga0395901_0015926
630 Ga0395901_0101858
631 Ga0395901_0199210
632 Ga0451849_0785311
633 Ga0451855_0426238
634 Ga0466965_0586726
635 Ga0466963_1014438
636 Ga0451576_1379266
637 Ga0466967_1544797
638 Ga0495639_0140494
639 Ga0495584_0674538
640 Ga0495585_0167218
641 Ga0495596_0154634
642 Ga0495656_0065586
643 Ga0495659_0093951
644 Ga0495661_0450804
645 Ga0495589_0164914
646 Ga0495589_0195566
647 Ga0495680_0795981
648 Ga0495677_0345173
649 Ga0496100_0039686
650 Ga0496100_0644019
651 Ga0496101_0001218
652 Ga0496101_0105509
653 Ga0496101_0107573
654 Ga0496101_0107873
655 Ga0496101_0113046
656 Ga0496101_1054275
657 Ga0496102_0002587
658 Ga0496102_0004037
659 Ga0496102_0127668
660 Ga0496102_0240768
661 Ga0496102_0466148
662 Ga0496103_0037660
663 Ga0496103_0105520
664 Ga0496103_0349111
665 Ga0496104_0000151
666 Ga0496104_0003850
667 Ga0496104_0008392
668 Ga0496104_0027434
669 Ga0496104_0060974
670 Ga0496105_0000049
671 Ga0496105_0007141
672 Ga0496105_0008308
673 Ga0496105_0037208
674 Ga0496105_0053537
675 Ga0496106_0003633
676 Ga0496106_0030817
677 Ga0496106_0119046
678 Ga0496107_0028597
679 Ga0496107_0047824
680 Ga0496107_0236877
681 Ga0496107_0386426
682 Ga0496107_0488475
683 Ga0496108_0001597
684 Ga0496108_0007452
685 Ga0496108_0440141
686 Ga0496108_0617287
687 Ga0496109_0000205
688 Ga0496109_0000613
689 Ga0496109_0004319
690 Ga0496109_0051253
691 Ga0496109_0052741
692 Ga0496109_0685269
693 Ga0496110_0000227
694 Ga0496110_0000363
695 Ga0496110_0002454
696 Ga0496110_0526678
697 Ga0496111_0002721
698 Ga0496111_0004118
699 Ga0496111_0021233
700 Ga0496111_0068896
701 Ga0496111_0214585
702 Ga0496111_1210774
703 Ga0496112_0022047
704 Ga0496112_0027399
705 Ga0496112_0036933
706 Ga0496112_0308403
707 Ga0496112_0800926
708 Ga0496112_0897550
709 Ga0496112_0993307
710 Ga0496112_1278901
711 Ga0496112_1317214
712 Ga0496112_1836511
713 Ga0496113_0013491
714 Ga0496113_0047175
715 Ga0496113_0183925
716 Ga0496113_0434645
717 Ga0496114_0000129
718 Ga0496114_0001201
719 Ga0496114_0002907
720 Ga0496114_0013541
721 Ga0496115_0004026
722 Ga0496115_0028082
723 Ga0496115_0163719
724 Ga0501041_0171374
725 Ga0501042_0027627
726 Ga0501046_0485361
727 Ga0501067_0003124
728 Ga0501067_0020979
729 Ga0501067_0050038
730 Ga0501068_0243802
731 Ga0501069_0204265
732 Ga0501070_0186780
733 Ga0501070_0390293
734 Ga0501076_0157088
735 Ga0501079_0155769
736 Ga0501080_0037902
737 Ga0501045_0414258
738 nmdc:mga05p37_187454_c1
739 nmdc:mga08y16_465154_c1
740 nmdc:mga0rr50_386657_c1
741 nmdc:mga0rr50_805631_c1
742 nmdc:mga0a205_343771_c1
743 nmdc:mga0a205_788481_c1
744 Ga0495612_0105086
745 Ga0495655_0052439
746 Ga0530510_0022516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

41

109

0.94

PF02311

AraC_binding

AraC-like ligand binding domain

36

106

0.9

PF00190

Cupin_1

Cupin

3

110

0.85

PF05899

Cupin_3

EutQ-like cupin domain

43

108

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.9354 5 109
5fq0-assembly2.cif.gz_D the structure of kdgf from halomonas sp. 0.9331 7 109
7zvm-assembly1.cif.gz_A-2 thermococcus barophilus phosphomannose isomerase protein structure at 1.6 a 0.9271 21 105
2y0o-assembly1.cif.gz_A-2 the structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis 0.9258 22 105
3kv9-assembly1.cif.gz_A structure of kiaa1718 jumonji domain 0.9198 34 104
ID Description Score Start End Superfamily
af_Q95Q98_1_277_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9325 34 104 2.60.120.650
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9323 24 105 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9259 4 109 2.60.120.10
af_O53413_44_172_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9246 22 105 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9196 21 104 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538I603-F1-model_v4 Cupin domain-containing protein 0.9964 4 131
AF-A0A538I603-F1-model_v4 Cupin domain-containing protein 0.9811 4 131
AF-A0A1E4GD14-F1-model_v4 Cupin type-2 domain-containing protein 0.9753 30 105
AF-A0A2S6UW89-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9744 21 105
AF-A0A662UF84-F1-model_v4 Cupin type-2 domain-containing protein 0.9676 22 105

Map