F426443

General Info

Members Datasets Scaffolds Average Seq Length
373 268 746 255

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0147337|Ga0466963_0147337_683_1582
Length 299
Sequence MTSMATGAAARARRAEPLMGTVFSFDVRVETGDEAWALTVIDDAIAWLRWVDATFSTYRADSEISRLGRGELRIADCHNDVREVLDRCAQLATATGGYFSATATGVLDPSALVKGWSVGRVAGRLRCAGLSRFAVNGGGDVALGSAPEPGGAWQVGIADPHRPGVLAAVVRGNEVAVATSGTAERGTHVVDPLTGRPATALAAVTVVGPDIADADAYATAALAMGHRALAWVEELPGYEALAIDRAGARSTTSGFRAYLTPWSPLAAYSTSCSALPISQRVGGHSPTNSARRSAFSRSF

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
89 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
111 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
112 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
129 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
130 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
131 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
219 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
220 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
221 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
222 2643221647 Streptomyces sp. Root369 Isolate Unclassified
223 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
224 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
225 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
226 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
227 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
228 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
229 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
230 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
231 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
232 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
233 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
234 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
235 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
236 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
237 2867428634 Streptomyces sp. RP5T Isolate Unclassified
238 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
239 2891562705 Microbispora tritici MT50 Isolate Unclassified
240 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
241 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
242 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
243 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
244 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
245 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
246 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
247 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
248 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
249 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
250 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
251 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
252 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
253 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
254 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
255 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
256 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
257 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
258 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
259 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
260 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
261 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
262 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
263 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
264 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
265 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
266 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
267 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
268 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.72
Metatranscriptomes 0.27
Isolates 15.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 3.49
Rhizosphere 79.36
Stem 0
Stem Tuber 0
Unclassified 6.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0147337 3300044694 Bacteria 1634
2 rootH1_10017925 3300003316 Bacteria 6867
3 rootH1_10017926 3300003316 Bacteria 2879
4 rootH1_10112212 3300003316 Bacteria 1243
5 rootH2_10229879 3300003320 Bacteria 1188
6 rootL2_10013765 3300003322 Bacteria 1182
7 rootH1_10003613 3300003323 Bacteria 4332
8 rootH1_10013485 3300003323 Bacteria 4636
9 Ga0006562J51391_1197510 3300003578 Bacteria 1037
10 Ga0070659_100534297 3300005366 Unclassified 1002
11 Ga0070709_10010688 3300005434 Bacteria 5092
12 Ga0070713_100113622 3300005436 Bacteria 2364
13 Ga0070713_100181899 3300005436 Bacteria 1889
14 Ga0070713_100210369 3300005436 Bacteria 1760
15 Ga0070713_100506235 3300005436 Bacteria 1140
16 Ga0070710_10023608 3300005437 Bacteria 3234
17 Ga0070711_100050342 3300005439 Bacteria 2856
18 Ga0070705_100040313 3300005440 Bacteria 2655
19 Ga0070685_10040902 3300005466 Bacteria 2640
20 Ga0070707_100151685 3300005468 Bacteria 2257
21 Ga0070698_100022253 3300005471 Bacteria 6633
22 Ga0070699_100104443 3300005518 Bacteria 2485
23 Ga0070699_100429581 3300005518 Unclassified 1196
24 Ga0068853_100010575 3300005539 Bacteria 7462
25 Ga0068853_100366788 3300005539 Bacteria 1343
26 Ga0070672_100683009 3300005543 Bacteria 898
27 Ga0070695_100017988 3300005545 Bacteria 4289
28 Ga0070696_100021548 3300005546 Bacteria 4369
29 Ga0070693_100005937 3300005547 Bacteria 5903
30 Ga0070665_100740176 3300005548 Bacteria 996
31 Ga0070704_100204681 3300005549 Unclassified 1595
32 Ga0068856_100060174 3300005614 Bacteria 3752
33 Ga0068856_100219469 3300005614 Bacteria 1917
34 Ga0068860_100353373 3300005843 Unclassified 1447
35 Ga0068862_100098978 3300005844 Unclassified 2548
36 Ga0070717_10078826 3300006028 Bacteria 2761
37 Ga0070717_10312693 3300006028 Bacteria 1398
38 Ga0075368_10002020 3300006042 Bacteria 6564
39 Ga0070715_10068345 3300006163 Bacteria 1580
40 Ga0070712_100022647 3300006175 Bacteria 4140
41 Ga0075367_10013366 3300006178 Bacteria 4411
42 Ga0075370_10049535 3300006353 Bacteria 2382
43 Ga0068871_100023934 3300006358 Bacteria 4732
44 Ga0075435_100040475 3300007076 Bacteria 3721
45 Ga0105251_10102610 3300009011 Bacteria 1306
46 Ga0105240_10064950 3300009093 Bacteria 4532
47 Ga0105247_10014047 3300009101 Bacteria 4803
48 Ga0105243_10118797 3300009148 Bacteria 2225
49 Ga0105237_10426142 3300009545 Unclassified 1332
50 Ga0105249_10320265 3300009553 Unclassified 1562
51 Ga0105246_10014801 3300011119 Bacteria 4913
52 Ga0105246_10356009 3300011119 Bacteria 1201
53 Ga0157371_10093676 3300013102 Unclassified 2128
54 Ga0157369_10176639 3300013105 Unclassified 2248
55 Ga0157372_10230793 3300013307 Bacteria 2146
56 Ga0163163_10080493 3300014325 Bacteria 3257
57 Ga0163163_10178120 3300014325 Unclassified 2173
58 Ga0157380_10011394 3300014326 Bacteria 6425
59 Ga0182008_10003548 3300014497 Bacteria 9370
60 Ga0157377_10158845 3300014745 Archaea 1404
61 Ga0157379_10053795 3300014968 Bacteria 3597
62 Ga0182007_10000773 3300015262 Bacteria 17925
63 Ga0182005_1008939 3300015265 Bacteria 2936
64 Ga0183367_1001 3300015688 Bacteria 1225545
65 Ga0183367_1010 3300015688 Bacteria 416164
66 Ga0213875_10000242 3300021388 Bacteria 54644
67 Ga0209758_1014964 3300025297 Bacteria 4063
68 Ga0207692_10022569 3300025898 Bacteria 2897
69 Ga0207688_10022528 3300025901 Bacteria 3447
70 Ga0207647_10013172 3300025904 Bacteria 5743
71 Ga0207647_10020469 3300025904 Bacteria 4436
72 Ga0207685_10170316 3300025905 Unclassified 1002
73 Ga0207699_10001020 3300025906 Bacteria 13234
74 Ga0207693_10000802 3300025915 Bacteria 28087
75 Ga0207693_10049574 3300025915 Bacteria 3297
76 Ga0207663_10322589 3300025916 Unclassified 1161
77 Ga0207663_10505728 3300025916 Bacteria 939
78 Ga0207662_10012914 3300025918 Bacteria 4661
79 Ga0207657_10030712 3300025919 Bacteria 4874
80 Ga0207646_10047550 3300025922 Bacteria 3848
81 Ga0207694_10048814 3300025924 Bacteria 3276
82 Ga0207687_10088114 3300025927 Unclassified 2257
83 Ga0207700_10031878 3300025928 Bacteria 3750
84 Ga0207700_10329888 3300025928 Bacteria 1324
85 Ga0207700_10594993 3300025928 Bacteria 984
86 Ga0207664_10034234 3300025929 Bacteria 3911
87 Ga0207664_10125139 3300025929 Bacteria 2157
88 Ga0207644_10095920 3300025931 Bacteria 2219
89 Ga0207690_10176363 3300025932 Unclassified 1605
90 Ga0207665_10004064 3300025939 Bacteria 9768
91 Ga0207665_10006204 3300025939 Bacteria 7940
92 Ga0207691_10543800 3300025940 Bacteria 985
93 Ga0207689_10039480 3300025942 Bacteria 3907
94 Ga0207651_10628906 3300025960 Unclassified 941
95 Ga0207712_10329365 3300025961 Unclassified 1263
96 Ga0207640_10327074 3300025981 Bacteria 1223
97 Ga0207658_10728977 3300025986 Bacteria 897
98 Ga0207639_10142478 3300026041 Bacteria 1998
99 Ga0207678_10083020 3300026067 Bacteria 2740
100 Ga0207702_10299666 3300026078 Bacteria 1525
101 Ga0207675_100078125 3300026118 Bacteria 3101
102 Ga0207683_10006447 3300026121 Bacteria 10047
103 Ga0209371_1043451 3300027312 Bacteria 898
104 Ga0209813_10001116 3300027866 Bacteria 5989
105 Ga0268266_10431041 3300028379 Bacteria 1251
106 Ga0268265_10103911 3300028380 Unclassified 2302
107 Ga0265337_1000276 3300028556 Bacteria 28064
108 Ga0265326_10001901 3300028558 Bacteria 7159
109 Ga0265319_1003270 3300028563 Bacteria 8529
110 Ga0265334_10002917 3300028573 Bacteria 7836
111 Ga0265322_10002630 3300028654 Bacteria 5508
112 Ga0307515_10098551 3300028794 Bacteria 3558
113 Ga0307515_10124337 3300028794 Bacteria 2895
114 Ga0265338_10002647 3300028800 Bacteria 26361
115 Ga0265324_10001196 3300029957 Bacteria 15431
116 Ga0268256_1049168 3300030500 Bacteria 898
117 Ga0307511_10027542 3300030521 Bacteria 5190
118 Ga0307512_10002415 3300030522 Bacteria 23741
119 Ga0307512_10031089 3300030522 Bacteria 4632
120 Ga0265332_10018936 3300031238 Bacteria 3039
121 Ga0265320_10006609 3300031240 Bacteria 7286
122 Ga0265325_10022337 3300031241 Bacteria 3467
123 Ga0265325_10048408 3300031241 Bacteria 2197
124 Ga0265340_10070302 3300031247 Unclassified 1660
125 Ga0265331_10046439 3300031250 Bacteria 2093
126 Ga0265316_10110197 3300031344 Bacteria 2085
127 Ga0307513_10035747 3300031456 Bacteria 5553
128 Ga0307513_10080194 3300031456 Bacteria 3368
129 Ga0307513_10194898 3300031456 Bacteria 1873
130 Ga0265313_10007255 3300031595 Bacteria 7618
131 Ga0265313_10027754 3300031595 Bacteria 2958
132 Ga0307508_10008381 3300031616 Bacteria 9552
133 Ga0307508_10008391 3300031616 Bacteria 9546
134 Ga0307508_10010779 3300031616 Bacteria 8359
135 Ga0307508_10016885 3300031616 Bacteria 6642
136 Ga0307514_10051064 3300031649 Bacteria 3206
137 Ga0307514_10100397 3300031649 Bacteria 2079
138 Ga0307514_10113895 3300031649 Bacteria 1907
139 Ga0307514_10147407 3300031649 Bacteria 1587
140 Ga0265342_10013201 3300031712 Bacteria 5555
141 Ga0307516_10003100 3300031730 Bacteria 21615
142 Ga0307518_10058064 3300031838 Bacteria 2811
143 Ga0307518_10334147 3300031838 Bacteria 895
144 Ga0373928_0036229 3300035084 Unclassified 1115
145 Ga0373951_0025099 3300035091 Bacteria 1383
146 Ga0373923_0003068 3300035111 Bacteria 5288
147 Ga0373932_0021592 3300035112 Unclassified 1701
148 Ga0373953_0010344 3300035117 Bacteria 3243
149 Ga0373954_0006144 3300035118 Bacteria 5231
150 Ga0373957_0010348 3300035120 Bacteria 3081
151 Ga0373960_0006697 3300035121 Bacteria 2711
152 Ga0373935_0391618 3300035692 Bacteria 996
153 Ga0373937_0277738 3300036401 Bacteria 1581
154 Ga0395898_0014763 3300037466 Bacteria 8018
155 Ga0436364_0977170 3300037853 Bacteria 1297
156 Ga0451837_1358960 3300041494 Bacteria 1107
157 Ga0451851_1181462 3300041507 Bacteria 1190
158 Ga0451853_2595831 3300041512 Bacteria 1228
159 Ga0439448_0002811 3300042005 Bacteria 4768
160 Ga0439448_0133068 3300042005 Bacteria 858
161 Ga0439449_0000899 3300042007 Bacteria 11615
162 Ga0450896_000227 3300042133 Bacteria 5058
163 Ga0450899_000504 3300042135 Bacteria 4410
164 Ga0450903_000850 3300042138 Bacteria 5928
165 Ga0439458_0000227 3300042157 Bacteria 13333
166 Ga0466972_0020719 3300044658 Bacteria 3284
167 Ga0466965_0001364 3300044683 Bacteria 9795
168 Ga0466966_0002524 3300044684 Bacteria 11996
169 Ga0466961_0008241 3300044693 Bacteria 6636
170 Ga0466963_0000272 3300044694 Bacteria 22996
171 Ga0466963_0000738 3300044694 Bacteria 16109
172 Ga0466964_0002728 3300044706 Bacteria 6336
173 Ga0466971_0000927 3300044719 Bacteria 12042
174 Ga0466970_0001187 3300044765 Bacteria 12650
175 Ga0466970_0003307 3300044765 Bacteria 7838
176 Ga0466957_0000283 3300044842 Bacteria 24756
177 Ga0466957_0038174 3300044842 Bacteria 2893
178 Ga0466957_0134205 3300044842 Bacteria 1589
179 Ga0466959_0001395 3300045049 Bacteria 14784
180 Ga0466958_0000165 3300045836 Bacteria 23507
181 Ga0466958_0119470 3300045836 Bacteria 1649
182 Ga0466958_0186951 3300045836 Bacteria 1316
183 Ga0466967_0037634 3300045976 Bacteria 4142
184 Ga0466967_0046849 3300045976 Bacteria 3767
185 Ga0466967_0434080 3300045976 Bacteria 1282
186 Ga0495592_0029401 3300046454 Bacteria 4161
187 Ga0495592_0286403 3300046454 Bacteria 1076
188 Ga0495603_0059357 3300046455 Bacteria 2261
189 Ga0495629_0028017 3300046459 Bacteria 4000
190 Ga0495651_0004454 3300046462 Bacteria 10725
191 Ga0495651_0071825 3300046462 Bacteria 2630
192 Ga0495653_0006265 3300046463 Bacteria 9762
193 Ga0495580_0030318 3300046472 Bacteria 3917
194 Ga0495580_0183752 3300046472 Bacteria 1443
195 Ga0495662_0003578 3300046476 Bacteria 7848
196 Ga0495662_0031435 3300046476 Bacteria 2564
197 Ga0495662_0033163 3300046476 Bacteria 2495
198 Ga0495662_0287270 3300046476 Bacteria 809
199 Ga0495664_0200748 3300046477 Bacteria 1208
200 Ga0495594_0250869 3300046499 Bacteria 1008
201 Ga0495608_0017316 3300046511 Bacteria 4985
202 Ga0495608_0175142 3300046511 Bacteria 1359
203 Ga0495618_0177874 3300046514 Bacteria 1352
204 Ga0495628_0290276 3300046516 Bacteria 1212
205 Ga0495630_0370587 3300046517 Bacteria 1097
206 Ga0495666_0001175 3300046526 Bacteria 12584
207 Ga0495666_0080600 3300046526 Bacteria 1540
208 Ga0495652_0034342 3300046529 Bacteria 4420
209 Ga0495652_0112374 3300046529 Bacteria 2188
210 Ga0495652_0181216 3300046529 Bacteria 1616
211 Ga0495665_0024297 3300046531 Bacteria 3256
212 Ga0495640_0060263 3300046533 Bacteria 2581
213 Ga0495586_0036595 3300046535 Bacteria 2635
214 Ga0495587_0030044 3300046536 Bacteria 3296
215 Ga0495645_0002534 3300046543 Bacteria 12408
216 Ga0495645_0015355 3300046543 Bacteria 5445
217 Ga0495667_0041298 3300046559 Bacteria 3059
218 Ga0495667_0086659 3300046559 Bacteria 2031
219 Ga0495634_0088383 3300046642 Bacteria 2015
220 Ga0495635_0027229 3300046663 Bacteria 3976
221 Ga0495635_0058522 3300046663 Bacteria 2651
222 Ga0495635_0100622 3300046663 Bacteria 1975
223 Ga0495588_0173840 3300046674 Bacteria 1139
224 Ga0495588_0233196 3300046674 Bacteria 971
225 Ga0495657_0009928 3300046675 Bacteria 7183
226 Ga0495657_0014916 3300046675 Bacteria 5699
227 Ga0495657_0048264 3300046675 Bacteria 2873
228 Ga0495657_0056618 3300046675 Bacteria 2609
229 Ga0495657_0168067 3300046675 Bacteria 1352
230 Ga0495623_0051879 3300046679 Bacteria 2593
231 Ga0495646_0004051 3300046680 Bacteria 9190
232 Ga0495613_0043325 3300046689 Bacteria 3329
233 Ga0495613_0076337 3300046689 Bacteria 2438
234 Ga0495613_0161511 3300046689 Bacteria 1593
235 Ga0495624_0030894 3300046690 Bacteria 3487
236 Ga0495600_0058027 3300046809 Bacteria 2528
237 Ga0495600_0079717 3300046809 Bacteria 2137
238 Ga0495600_0108227 3300046809 Bacteria 1810
239 Ga0495581_0120040 3300047315 Bacteria 1530
240 Ga0495581_0269273 3300047315 Bacteria 996
241 Ga0495604_0001190 3300047317 Bacteria 21463
242 Ga0495604_0014875 3300047317 Bacteria 6207
243 Ga0495676_0027091 3300047321 Bacteria 4921
244 Ga0495676_0131853 3300047321 Unclassified 1803
245 Ga0495680_0103126 3300047322 Bacteria 2123
246 Ga0495687_000581 3300047443 Bacteria 42904
247 Ga0495687_010994 3300047443 Bacteria 4905
248 Ga0495687_032469 3300047443 Bacteria 2381
249 Ga0495675_0010675 3300047444 Bacteria 5744
250 Ga0495684_0039200 3300047471 Bacteria 3632
251 Ga0495684_0231703 3300047471 Bacteria 1350
252 Ga0495686_0015618 3300047472 Bacteria 5178
253 Ga0495593_0046257 3300047673 Bacteria 2319
254 Ga0495614_0034287 3300048089 Bacteria 2182
255 Ga0496101_0697505 3300048904 Unclassified 802
256 Ga0496102_0332607 3300048905 Bacteria 1431
257 Ga0496104_0843585 3300048907 Bacteria 822
258 Ga0496105_0012468 3300048908 Bacteria 6730
259 Ga0496107_0157031 3300048910 Unclassified 1685
260 Ga0496108_0033153 3300048911 Bacteria 4290
261 Ga0496109_0184949 3300048912 Bacteria 1958
262 Ga0496109_0338846 3300048912 Bacteria 1420
263 Ga0496112_0075436 3300048915 Bacteria 3335
264 Ga0496113_0019721 3300048916 Bacteria 4725
265 Ga0496114_0011985 3300048917 Bacteria 6934
266 Ga0496126_0138494 3300048929 Bacteria 2097
267 Ga0496126_0358878 3300048929 Bacteria 1191
268 Ga0501031_0085055 3300049568 Bacteria 2062
269 Ga0501031_0129849 3300049568 Bacteria 1646
270 Ga0501032_0112006 3300049569 Bacteria 1805
271 Ga0501033_0001669 3300049570 Bacteria 19402
272 Ga0501033_0006830 3300049570 Bacteria 8906
273 Ga0501033_0007168 3300049570 Bacteria 8699
274 Ga0501034_0035028 3300049571 Bacteria 5091
275 Ga0501034_0052912 3300049571 Bacteria 4090
276 Ga0501034_0088579 3300049571 Bacteria 3093
277 Ga0501034_0344179 3300049571 Bacteria 1420
278 Ga0501036_0003087 3300049572 Bacteria 13290
279 Ga0501036_0027995 3300049572 Bacteria 4764
280 Ga0501037_0063314 3300049573 Bacteria 2696
281 Ga0501037_0344181 3300049573 Bacteria 1029
282 Ga0501038_0000741 3300049574 Bacteria 29112
283 Ga0501038_0124038 3300049574 Bacteria 2127
284 Ga0501038_0181595 3300049574 Bacteria 1697
285 Ga0501038_0646451 3300049574 Bacteria 796
286 Ga0501039_0004674 3300049575 Bacteria 10360
287 Ga0501039_0364586 3300049575 Bacteria 1135
288 Ga0501039_0776501 3300049575 Bacteria 748
289 Ga0501040_0226028 3300049576 Bacteria 1332
290 Ga0501042_0034878 3300049578 Bacteria 3569
291 Ga0501043_0043304 3300049579 Bacteria 3539
292 Ga0501043_0046114 3300049579 Bacteria 3427
293 Ga0501046_0038783 3300049580 Bacteria 3821
294 Ga0501046_0050578 3300049580 Bacteria 3282
295 Ga0501047_0011211 3300049581 Bacteria 8481
296 Ga0501047_0081222 3300049581 Bacteria 3116
297 Ga0501070_0009339 3300049586 Bacteria 8293
298 Ga0501070_0098093 3300049586 Bacteria 2424
299 Ga0501072_0322814 3300049588 Bacteria 1227
300 Ga0501035_0002168 3300049822 Bacteria 19485
301 Ga0501035_0018130 3300049822 Bacteria 6486
302 Ga0501035_0079326 3300049822 Bacteria 2900
303 Ga0501035_0093205 3300049822 Bacteria 2650
304 Ga0501035_0122844 3300049822 Bacteria 2268
305 Ga0501044_0023839 3300049823 Bacteria 6503
306 Ga0501044_0030819 3300049823 Bacteria 5648
307 Ga0501044_0041979 3300049823 Bacteria 4761
308 Ga0501044_0059174 3300049823 Bacteria 3926
309 Ga0501044_0203615 3300049823 Bacteria 1936
310 Ga0501045_0132581 3300049824 Bacteria 1852
311 Ga0501045_0407047 3300049824 Bacteria 1012
312 nmdc:mga06z11_631_c1 3300050494 Bacteria 4513
313 nmdc:mga04h51_1416_c1 3300050495 Bacteria 5542
314 Ga0495601_0054312 3300053077 Bacteria 2534
315 Ga0500600_0070087 3300053149 Bacteria 1925
316 Ga0501084_0438013 3300054114 Bacteria 1105
317 Ga0466962_0000971 3300061719 Bacteria 13051
318 2547406612 2547132111 Bacteria 8013147
319 2585303634 2582581313 Bacteria 10042643
320 2616695714 2616644814 Bacteria 11555299
321 2643946885 2643221587 Bacteria 7586415
322 2644268106 2643221647 Bacteria 10741251
323 2644435066 2643221677 Bacteria 7584031
324 2644443778 2643221678 Bacteria 9540101
325 2784586824 2784132148 Bacteria 8627943
326 2785345657 2784746763 Bacteria 9783172
327 2785367238 2784746768 Bacteria 10036182
328 2786668285 2786546132 Bacteria 10419719
329 2793981044 2791355406 Bacteria 11364898
330 2808847741 2808606359 Bacteria 9866990
331 2812360228 2811994879 Bacteria 9313447
332 2812482294 2811994917 Bacteria 7761064
333 2852637802 2852635781 Bacteria 8251373
334 2856744107 2856741275 Bacteria 8096094
335 2862289576 2862281513 Bacteria 9621493
336 2862510490 2862507626 Bacteria 9425308
337 2867431539 2867428634 Bacteria 9590268
338 2877683309 2877676314 Bacteria 9512378
339 2891564340 2891562705 Bacteria 8039471
340 2912722319 2912715099 Bacteria 9460473
341 2912762401 2912757875 Bacteria 7940295
342 2919472113 2919468124 Bacteria 9133025
343 2946065661 2946064051 Bacteria 8957905
344 2946074008 2946072368 Bacteria 8999607
345 2947231739 2947224130 Bacteria 9938529
346 2954010995 2954002825 Bacteria 9173742
347 2954388556 2954380949 Bacteria 10050426
348 2954674569 2954673503 Bacteria 9685905
349 2954689564 2954682443 Bacteria 9862841
350 2954699345 2954691527 Bacteria 10720516
351 2954702874 2954701450 Bacteria 10834262
352 2954718287 2954711539 Bacteria 10867210
353 2954728257 2954721474 Bacteria 10456478
354 2954733553 2954731030 Bacteria 10243860
355 2954747151 2954740390 Bacteria 10229294
356 2954752436 2954749733 Bacteria 10366972
357 2954766264 2954759201 Bacteria 9358192
358 2990061424 2990059506 Bacteria 9321252
359 2997605597 2997600082 Bacteria 9896405
360 3006499826 3006493962 Bacteria 8825450
361 8023628514 8023623736 Bacteria 8593882
362 8025536877 8025530807 Bacteria 8495698
363 8047894941 8047893842 Bacteria 11723082
364 8047903557 8047893842 Bacteria 11723082
365 8048130487 8048127548 Bacteria 11053136
366 8048135350 8048127548 Bacteria 11053136
367 8048356816 8048356638 Bacteria 11044339
368 8048364109 8048356638 Bacteria 11044339
369 8048371968 8048369669 Bacteria 11666822
370 8048379005 8048369669 Bacteria 11666822
371 8048380902 8048379754 Bacteria 11877923
372 8048388110 8048379754 Bacteria 11877923
373 8048413635 8048406513 Bacteria 8936924
374 Ga0466963_0147337
375 rootH1_10017925
376 rootH1_10017926
377 rootH1_10112212
378 rootH2_10229879
379 rootL2_10013765
380 rootH1_10003613
381 rootH1_10013485
382 Ga0006562J51391_1197510
383 Ga0070659_100534297
384 Ga0070709_10010688
385 Ga0070713_100113622
386 Ga0070713_100181899
387 Ga0070713_100210369
388 Ga0070713_100506235
389 Ga0070710_10023608
390 Ga0070711_100050342
391 Ga0070705_100040313
392 Ga0070685_10040902
393 Ga0070707_100151685
394 Ga0070698_100022253
395 Ga0070699_100104443
396 Ga0070699_100429581
397 Ga0068853_100010575
398 Ga0068853_100366788
399 Ga0070672_100683009
400 Ga0070695_100017988
401 Ga0070696_100021548
402 Ga0070693_100005937
403 Ga0070665_100740176
404 Ga0070704_100204681
405 Ga0068856_100060174
406 Ga0068856_100219469
407 Ga0068860_100353373
408 Ga0068862_100098978
409 Ga0070717_10078826
410 Ga0070717_10312693
411 Ga0075368_10002020
412 Ga0070715_10068345
413 Ga0070712_100022647
414 Ga0075367_10013366
415 Ga0075370_10049535
416 Ga0068871_100023934
417 Ga0075435_100040475
418 Ga0105251_10102610
419 Ga0105240_10064950
420 Ga0105247_10014047
421 Ga0105243_10118797
422 Ga0105237_10426142
423 Ga0105249_10320265
424 Ga0105246_10014801
425 Ga0105246_10356009
426 Ga0157371_10093676
427 Ga0157369_10176639
428 Ga0157372_10230793
429 Ga0163163_10080493
430 Ga0163163_10178120
431 Ga0157380_10011394
432 Ga0182008_10003548
433 Ga0157377_10158845
434 Ga0157379_10053795
435 Ga0182007_10000773
436 Ga0182005_1008939
437 Ga0183367_1001
438 Ga0183367_1010
439 Ga0213875_10000242
440 Ga0209758_1014964
441 Ga0207692_10022569
442 Ga0207688_10022528
443 Ga0207647_10013172
444 Ga0207647_10020469
445 Ga0207685_10170316
446 Ga0207699_10001020
447 Ga0207693_10000802
448 Ga0207693_10049574
449 Ga0207663_10322589
450 Ga0207663_10505728
451 Ga0207662_10012914
452 Ga0207657_10030712
453 Ga0207646_10047550
454 Ga0207694_10048814
455 Ga0207687_10088114
456 Ga0207700_10031878
457 Ga0207700_10329888
458 Ga0207700_10594993
459 Ga0207664_10034234
460 Ga0207664_10125139
461 Ga0207644_10095920
462 Ga0207690_10176363
463 Ga0207665_10004064
464 Ga0207665_10006204
465 Ga0207691_10543800
466 Ga0207689_10039480
467 Ga0207651_10628906
468 Ga0207712_10329365
469 Ga0207640_10327074
470 Ga0207658_10728977
471 Ga0207639_10142478
472 Ga0207678_10083020
473 Ga0207702_10299666
474 Ga0207675_100078125
475 Ga0207683_10006447
476 Ga0209371_1043451
477 Ga0209813_10001116
478 Ga0268266_10431041
479 Ga0268265_10103911
480 Ga0265337_1000276
481 Ga0265326_10001901
482 Ga0265319_1003270
483 Ga0265334_10002917
484 Ga0265322_10002630
485 Ga0307515_10098551
486 Ga0307515_10124337
487 Ga0265338_10002647
488 Ga0265324_10001196
489 Ga0268256_1049168
490 Ga0307511_10027542
491 Ga0307512_10002415
492 Ga0307512_10031089
493 Ga0265332_10018936
494 Ga0265320_10006609
495 Ga0265325_10022337
496 Ga0265325_10048408
497 Ga0265340_10070302
498 Ga0265331_10046439
499 Ga0265316_10110197
500 Ga0307513_10035747
501 Ga0307513_10080194
502 Ga0307513_10194898
503 Ga0265313_10007255
504 Ga0265313_10027754
505 Ga0307508_10008381
506 Ga0307508_10008391
507 Ga0307508_10010779
508 Ga0307508_10016885
509 Ga0307514_10051064
510 Ga0307514_10100397
511 Ga0307514_10113895
512 Ga0307514_10147407
513 Ga0265342_10013201
514 Ga0307516_10003100
515 Ga0307518_10058064
516 Ga0307518_10334147
517 Ga0373928_0036229
518 Ga0373951_0025099
519 Ga0373923_0003068
520 Ga0373932_0021592
521 Ga0373953_0010344
522 Ga0373954_0006144
523 Ga0373957_0010348
524 Ga0373960_0006697
525 Ga0373935_0391618
526 Ga0373937_0277738
527 Ga0395898_0014763
528 Ga0436364_0977170
529 Ga0451837_1358960
530 Ga0451851_1181462
531 Ga0451853_2595831
532 Ga0439448_0002811
533 Ga0439448_0133068
534 Ga0439449_0000899
535 Ga0450896_000227
536 Ga0450899_000504
537 Ga0450903_000850
538 Ga0439458_0000227
539 Ga0466972_0020719
540 Ga0466965_0001364
541 Ga0466966_0002524
542 Ga0466961_0008241
543 Ga0466963_0000272
544 Ga0466963_0000738
545 Ga0466964_0002728
546 Ga0466971_0000927
547 Ga0466970_0001187
548 Ga0466970_0003307
549 Ga0466957_0000283
550 Ga0466957_0038174
551 Ga0466957_0134205
552 Ga0466959_0001395
553 Ga0466958_0000165
554 Ga0466958_0119470
555 Ga0466958_0186951
556 Ga0466967_0037634
557 Ga0466967_0046849
558 Ga0466967_0434080
559 Ga0495592_0029401
560 Ga0495592_0286403
561 Ga0495603_0059357
562 Ga0495629_0028017
563 Ga0495651_0004454
564 Ga0495651_0071825
565 Ga0495653_0006265
566 Ga0495580_0030318
567 Ga0495580_0183752
568 Ga0495662_0003578
569 Ga0495662_0031435
570 Ga0495662_0033163
571 Ga0495662_0287270
572 Ga0495664_0200748
573 Ga0495594_0250869
574 Ga0495608_0017316
575 Ga0495608_0175142
576 Ga0495618_0177874
577 Ga0495628_0290276
578 Ga0495630_0370587
579 Ga0495666_0001175
580 Ga0495666_0080600
581 Ga0495652_0034342
582 Ga0495652_0112374
583 Ga0495652_0181216
584 Ga0495665_0024297
585 Ga0495640_0060263
586 Ga0495586_0036595
587 Ga0495587_0030044
588 Ga0495645_0002534
589 Ga0495645_0015355
590 Ga0495667_0041298
591 Ga0495667_0086659
592 Ga0495634_0088383
593 Ga0495635_0027229
594 Ga0495635_0058522
595 Ga0495635_0100622
596 Ga0495588_0173840
597 Ga0495588_0233196
598 Ga0495657_0009928
599 Ga0495657_0014916
600 Ga0495657_0048264
601 Ga0495657_0056618
602 Ga0495657_0168067
603 Ga0495623_0051879
604 Ga0495646_0004051
605 Ga0495613_0043325
606 Ga0495613_0076337
607 Ga0495613_0161511
608 Ga0495624_0030894
609 Ga0495600_0058027
610 Ga0495600_0079717
611 Ga0495600_0108227
612 Ga0495581_0120040
613 Ga0495581_0269273
614 Ga0495604_0001190
615 Ga0495604_0014875
616 Ga0495676_0027091
617 Ga0495676_0131853
618 Ga0495680_0103126
619 Ga0495687_000581
620 Ga0495687_010994
621 Ga0495687_032469
622 Ga0495675_0010675
623 Ga0495684_0039200
624 Ga0495684_0231703
625 Ga0495686_0015618
626 Ga0495593_0046257
627 Ga0495614_0034287
628 Ga0496101_0697505
629 Ga0496102_0332607
630 Ga0496104_0843585
631 Ga0496105_0012468
632 Ga0496107_0157031
633 Ga0496108_0033153
634 Ga0496109_0184949
635 Ga0496109_0338846
636 Ga0496112_0075436
637 Ga0496113_0019721
638 Ga0496114_0011985
639 Ga0496126_0138494
640 Ga0496126_0358878
641 Ga0501031_0085055
642 Ga0501031_0129849
643 Ga0501032_0112006
644 Ga0501033_0001669
645 Ga0501033_0006830
646 Ga0501033_0007168
647 Ga0501034_0035028
648 Ga0501034_0052912
649 Ga0501034_0088579
650 Ga0501034_0344179
651 Ga0501036_0003087
652 Ga0501036_0027995
653 Ga0501037_0063314
654 Ga0501037_0344181
655 Ga0501038_0000741
656 Ga0501038_0124038
657 Ga0501038_0181595
658 Ga0501038_0646451
659 Ga0501039_0004674
660 Ga0501039_0364586
661 Ga0501039_0776501
662 Ga0501040_0226028
663 Ga0501042_0034878
664 Ga0501043_0043304
665 Ga0501043_0046114
666 Ga0501046_0038783
667 Ga0501046_0050578
668 Ga0501047_0011211
669 Ga0501047_0081222
670 Ga0501070_0009339
671 Ga0501070_0098093
672 Ga0501072_0322814
673 Ga0501035_0002168
674 Ga0501035_0018130
675 Ga0501035_0079326
676 Ga0501035_0093205
677 Ga0501035_0122844
678 Ga0501044_0023839
679 Ga0501044_0030819
680 Ga0501044_0041979
681 Ga0501044_0059174
682 Ga0501044_0203615
683 Ga0501045_0132581
684 Ga0501045_0407047
685 nmdc:mga06z11_631_c1
686 nmdc:mga04h51_1416_c1
687 Ga0495601_0054312
688 Ga0500600_0070087
689 Ga0501084_0438013
690 Ga0466962_0000971
691 2547406612
692 2585303634
693 2616695714
694 2643946885
695 2644268106
696 2644435066
697 2644443778
698 2784586824
699 2785345657
700 2785367238
701 2786668285
702 2793981044
703 2808847741
704 2812360228
705 2812482294
706 2852637802
707 2856744107
708 2862289576
709 2862510490
710 2867431539
711 2877683309
712 2891564340
713 2912722319
714 2912762401
715 2919472113
716 2946065661
717 2946074008
718 2947231739
719 2954010995
720 2954388556
721 2954674569
722 2954689564
723 2954699345
724 2954702874
725 2954718287
726 2954728257
727 2954733553
728 2954747151
729 2954752436
730 2954766264
731 2990061424
732 2997605597
733 3006499826
734 8023628514
735 8025536877
736 8047894941
737 8047903557
738 8048130487
739 8048135350
740 8048356816
741 8048364109
742 8048371968
743 8048379005
744 8048380902
745 8048388110
746 8048413635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02424

ApbE

ApbE family

19

106

0.89

PF02424

ApbE

ApbE family

102

242

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f2u-assembly2.cif.gz_B fmnb complexed with adp 0.8607 1 245
7f2u-assembly2.cif.gz_B fmnb complexed with adp 0.8574 1 245
7esb-assembly1.cif.gz_A fmnb complexed with atp 0.8339 1 245
7esb-assembly1.cif.gz_A fmnb complexed with atp 0.8307 1 245
4ifx-assembly1.cif.gz_A crystal structure of treponema pallidum tp0796 flavin trafficking protein, fad substrate bound form 0.823 1 245
ID Description Score Start End Superfamily
af_Q9ET39_36_143_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8302 223 237 2.60.40.10
af_Q9D3G2_18_127_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8293 223 237 2.60.40.10
4xdtA00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8174 1 244 3.10.520.10
4xdtA00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8112 1 244 3.10.520.10
af_Q4CMU8_39_363_3.10.520.10 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8082 1 237 3.10.520.10
ID Description Score Start End GO Terms
AF-A0A7K2JUU3-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9863 1 109 GO:0016740
GO:0046872
AF-A0A4P8TCG0-F1-model_v4 deleted 0.9857 1 245
AF-A0A3S9ZQN3-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9849 1 245 GO:0016740
GO:0046872
AF-A0A7G1PDQ4-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9846 1 245 GO:0016740
GO:0046872
AF-A0A2I0SWY3-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9825 1 245 GO:0016740
GO:0046872

Map