F426366

General Info

Members Datasets Scaffolds Average Seq Length
373 189 746 113

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10166776|Ga0213875_101667762
Length 127
Sequence MSDQAQLLPGTLDLLILKAVSLGPLHGYGVLLRIGQISGQALLVEQGALYPALFRLVRQGLLKASWGTSENNRRAKFYELTAAGRKRLREETEGWNRLASAIASALAAQPIAQTSPRAAFALKPEET

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.88
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 28.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10166776 3300021388 Bacteria 1034
2 rootH2_10084815 3300003320 Bacteria 4256
3 rootH2_10178165 3300003320 Unclassified 1415
4 Ga0065712_10253695 3300005290 Unclassified 941
5 Ga0065715_10152031 3300005293 Unclassified 1718
6 Ga0070683_100018328 3300005329 Bacteria 6198
7 Ga0070683_100903446 3300005329 Bacteria 847
8 Ga0070689_100002049 3300005340 Bacteria 13085
9 Ga0070689_100074058 3300005340 Bacteria 2664
10 Ga0070689_100190920 3300005340 Bacteria 1668
11 Ga0070687_100156064 3300005343 Bacteria 1345
12 Ga0070675_101289953 3300005354 Unclassified 673
13 Ga0070673_100887153 3300005364 Unclassified 826
14 Ga0070688_100000001 3300005365 Bacteria 106331
15 Ga0070688_100000479 3300005365 Bacteria 20267
16 Ga0070703_10421309 3300005406 Unclassified 585
17 Ga0070709_10207696 3300005434 Bacteria 1390
18 Ga0070709_10491225 3300005434 Unclassified 931
19 Ga0070714_100285538 3300005435 Bacteria 1534
20 Ga0070714_100693684 3300005435 Bacteria 982
21 Ga0070714_101008856 3300005435 Bacteria 810
22 Ga0070713_100388180 3300005436 Bacteria 1302
23 Ga0070713_100454356 3300005436 Bacteria 1204
24 Ga0070713_100576980 3300005436 Bacteria 1067
25 Ga0070713_100747613 3300005436 Bacteria 935
26 Ga0070710_10965099 3300005437 Unclassified 619
27 Ga0070710_11154594 3300005437 Unclassified 571
28 Ga0070701_10040214 3300005438 Bacteria 2376
29 Ga0070711_100005049 3300005439 Bacteria 7857
30 Ga0070711_100412878 3300005439 Bacteria 1098
31 Ga0070711_100586552 3300005439 Bacteria 928
32 Ga0070711_100859165 3300005439 Bacteria 772
33 Ga0070711_101242260 3300005439 Bacteria 645
34 Ga0070705_100045927 3300005440 Unclassified 2516
35 Ga0070705_100376609 3300005440 Bacteria 1043
36 Ga0070705_100614801 3300005440 Unclassified 842
37 Ga0070694_100046215 3300005444 Bacteria 2922
38 Ga0070708_100007101 3300005445 Bacteria 8939
39 Ga0070708_100018387 3300005445 Bacteria 5850
40 Ga0070708_100024281 3300005445 Bacteria 5169
41 Ga0070708_100173152 3300005445 Bacteria 2016
42 Ga0070708_100413587 3300005445 Unclassified 1272
43 Ga0070708_101150856 3300005445 Bacteria 726
44 Ga0070663_100027897 3300005455 Bacteria 3839
45 Ga0070681_10008874 3300005458 Bacteria 9879
46 Ga0068867_100867172 3300005459 Unclassified 810
47 Ga0070706_100003356 3300005467 Bacteria 15795
48 Ga0070706_100003485 3300005467 Bacteria 15473
49 Ga0070706_100006890 3300005467 Bacteria 10725
50 Ga0070706_100007120 3300005467 Bacteria 10519
51 Ga0070706_100020212 3300005467 Bacteria 6136
52 Ga0070706_100066082 3300005467 Bacteria 3345
53 Ga0070706_100941837 3300005467 Unclassified 797
54 Ga0070707_100011416 3300005468 Bacteria 8282
55 Ga0070707_100550607 3300005468 Unclassified 1116
56 Ga0070707_100669953 3300005468 Unclassified 1000
57 Ga0070707_101534726 3300005468 Bacteria 633
58 Ga0070698_100052677 3300005471 Bacteria 4139
59 Ga0070698_100117869 3300005471 Bacteria 2617
60 Ga0070698_100220736 3300005471 Bacteria 1829
61 Ga0070698_100697810 3300005471 Unclassified 957
62 Ga0070698_100768965 3300005471 Bacteria 906
63 Ga0070699_100000003 3300005518 Bacteria 418047
64 Ga0070699_100110600 3300005518 Bacteria 2412
65 Ga0070699_100303022 3300005518 Bacteria 1434
66 Ga0070699_101118498 3300005518 Unclassified 722
67 Ga0070699_101346213 3300005518 Bacteria 655
68 Ga0070684_100274736 3300005535 Unclassified 1543
69 Ga0070684_100308795 3300005535 Bacteria 1452
70 Ga0070697_100007847 3300005536 Bacteria 8312
71 Ga0070697_100316347 3300005536 Bacteria 1344
72 Ga0070697_101096175 3300005536 Unclassified 709
73 Ga0070697_101127110 3300005536 Bacteria 698
74 Ga0068853_100027695 3300005539 Bacteria 4762
75 Ga0070672_101270573 3300005543 Unclassified 657
76 Ga0070686_100137461 3300005544 Bacteria 1697
77 Ga0070704_100550684 3300005549 Bacteria 1008
78 Ga0070704_100983232 3300005549 Bacteria 762
79 Ga0068855_100014925 3300005563 Bacteria 9359
80 Ga0068855_100490203 3300005563 Bacteria 1337
81 Ga0070664_100112358 3300005564 Unclassified 2379
82 Ga0068857_100004060 3300005577 Bacteria 12324
83 Ga0068856_100003095 3300005614 Bacteria 16980
84 Ga0068856_100003102 3300005614 Bacteria 16967
85 Ga0068856_100088418 3300005614 Bacteria 3080
86 Ga0068856_100335911 3300005614 Bacteria 1529
87 Ga0070702_100624425 3300005615 Bacteria 811
88 Ga0068852_100000023 3300005616 Bacteria 120576
89 Ga0068852_100122003 3300005616 Bacteria 2388
90 Ga0068859_100239291 3300005617 Bacteria 1904
91 Ga0068859_100440973 3300005617 Bacteria 1398
92 Ga0068864_100531030 3300005618 Bacteria 1135
93 Ga0068851_10007241 3300005834 Bacteria 5086
94 Ga0068863_100186666 3300005841 Bacteria 1992
95 Ga0068863_101420774 3300005841 Bacteria 702
96 Ga0068860_100156418 3300005843 Bacteria 2197
97 Ga0068860_100734684 3300005843 Bacteria 998
98 Ga0068862_100080385 3300005844 Bacteria 2827
99 Ga0068862_100568366 3300005844 Bacteria 1085
100 Ga0081455_10014032 3300005937 Bacteria 7873
101 Ga0081455_10301982 3300005937 Bacteria 1148
102 Ga0070717_10012090 3300006028 Bacteria 6577
103 Ga0070717_10032405 3300006028 Bacteria 4211
104 Ga0070717_10086774 3300006028 Bacteria 2635
105 Ga0070717_10174864 3300006028 Bacteria 1869
106 Ga0070717_10969741 3300006028 Unclassified 774
107 Ga0070717_11232035 3300006028 Unclassified 681
108 Ga0070717_11555966 3300006028 Unclassified 599
109 Ga0070715_10044621 3300006163 Bacteria 1875
110 Ga0070716_100332171 3300006173 Unclassified 1069
111 Ga0070716_100464759 3300006173 Bacteria 926
112 Ga0070716_100551127 3300006173 Bacteria 860
113 Ga0070712_100239194 3300006175 Bacteria 1446
114 Ga0070712_100444715 3300006175 Bacteria 1078
115 Ga0070712_100457827 3300006175 Bacteria 1063
116 Ga0070712_100716656 3300006175 Bacteria 854
117 Ga0070712_102043988 3300006175 Unclassified 502
118 Ga0097621_100465369 3300006237 Bacteria 1141
119 Ga0075433_11459525 3300006852 Unclassified 591
120 Ga0075434_100117330 3300006871 Bacteria 2674
121 Ga0075434_100173528 3300006871 Bacteria 2176
122 Ga0075434_100542415 3300006871 Unclassified 1183
123 Ga0075434_102268849 3300006871 Unclassified 546
124 Ga0075436_100316288 3300006914 Unclassified 1121
125 Ga0075436_100913440 3300006914 Bacteria 657
126 Ga0097620_100239289 3300006931 Bacteria 1904
127 Ga0097620_100440940 3300006931 Bacteria 1398
128 Ga0075435_100347461 3300007076 Bacteria 1271
129 Ga0075435_100530999 3300007076 Bacteria 1018
130 Ga0075435_102016374 3300007076 Bacteria 507
131 Ga0099794_10085232 3300007265 Bacteria 1563
132 Ga0099794_10113349 3300007265 Unclassified 1360
133 Ga0105250_10483651 3300009092 Unclassified 560
134 Ga0105240_10000203 3300009093 Bacteria 120858
135 Ga0105240_10603391 3300009093 Unclassified 1208
136 Ga0105245_10161597 3300009098 Unclassified 2126
137 Ga0114129_10879213 3300009147 Bacteria 1137
138 Ga0105241_10358690 3300009174 Unclassified 1268
139 Ga0105241_10412034 3300009174 Bacteria 1188
140 Ga0105242_10911476 3300009176 Unclassified 880
141 Ga0105242_11644002 3300009176 Unclassified 677
142 Ga0105237_10074533 3300009545 Bacteria 3386
143 Ga0105237_10188526 3300009545 Bacteria 2062
144 Ga0105237_11032532 3300009545 Bacteria 829
145 Ga0105238_10058699 3300009551 Unclassified 3856
146 Ga0105238_10170614 3300009551 Bacteria 2151
147 Ga0099796_10172439 3300010159 Unclassified 864
148 Ga0157373_10185650 3300013100 Bacteria 1465
149 Ga0157370_10004444 3300013104 Bacteria 16068
150 Ga0157369_10000095 3300013105 Bacteria 121823
151 Ga0157369_10034337 3300013105 Bacteria 5568
152 Ga0157369_10334916 3300013105 Bacteria 1572
153 Ga0157369_10763475 3300013105 Bacteria 994
154 Ga0157374_10040761 3300013296 Bacteria 4278
155 Ga0157374_10298201 3300013296 Unclassified 1594
156 Ga0157374_10455997 3300013296 Bacteria 1280
157 Ga0157374_12516358 3300013296 Bacteria 542
158 Ga0157372_10001034 3300013307 Bacteria 30423
159 Ga0157372_10005602 3300013307 Bacteria 13352
160 Ga0157372_10012595 3300013307 Bacteria 9006
161 Ga0157372_10016210 3300013307 Bacteria 7995
162 Ga0157372_10117395 3300013307 Unclassified 3052
163 Ga0157372_10147612 3300013307 Bacteria 2712
164 Ga0157372_10473329 3300013307 Bacteria 1460
165 Ga0157372_12916663 3300013307 Bacteria 547
166 Ga0163163_10123318 3300014325 Bacteria 2627
167 Ga0163163_10515359 3300014325 Bacteria 1258
168 Ga0163163_10854553 3300014325 Unclassified 973
169 Ga0157379_10655123 3300014968 Bacteria 983
170 Ga0182007_10127796 3300015262 Bacteria 853
171 Ga0213873_10037654 3300021358 Bacteria 1233
172 Ga0213874_10024560 3300021377 Bacteria 1692
173 Ga0213874_10455979 3300021377 Unclassified 505
174 Ga0213876_10363323 3300021384 Bacteria 770
175 Ga0213876_10705262 3300021384 Unclassified 537
176 Ga0213875_10000103 3300021388 Bacteria 96738
177 Ga0213875_10029620 3300021388 Bacteria 2596
178 Ga0213875_10063818 3300021388 Bacteria 1721
179 Ga0213875_10478911 3300021388 Unclassified 597
180 Ga0213871_10209831 3300021441 Unclassified 610
181 Ga0213871_10288597 3300021441 Unclassified 528
182 Ga0207653_10413020 3300025885 Unclassified 529
183 Ga0207692_10361159 3300025898 Bacteria 897
184 Ga0207692_11085969 3300025898 Unclassified 530
185 Ga0207685_10051351 3300025905 Bacteria 1592
186 Ga0207699_10354510 3300025906 Bacteria 1036
187 Ga0207699_10824363 3300025906 Unclassified 683
188 Ga0207684_10000379 3300025910 Bacteria 60091
189 Ga0207684_10003290 3300025910 Bacteria 15856
190 Ga0207684_10004634 3300025910 Bacteria 12910
191 Ga0207684_10005648 3300025910 Bacteria 11489
192 Ga0207684_10042896 3300025910 Unclassified 3835
193 Ga0207684_10543968 3300025910 Bacteria 994
194 Ga0207684_10723700 3300025910 Unclassified 845
195 Ga0207654_10264773 3300025911 Bacteria 1157
196 Ga0207654_10980784 3300025911 Bacteria 614
197 Ga0207707_10020262 3300025912 Bacteria 5806
198 Ga0207695_10000303 3300025913 Bacteria 120876
199 Ga0207695_10031040 3300025913 Bacteria 5871
200 Ga0207695_10422488 3300025913 Unclassified 1217
201 Ga0207671_10145038 3300025914 Bacteria 1831
202 Ga0207671_10445090 3300025914 Bacteria 1032
203 Ga0207671_11321780 3300025914 Bacteria 561
204 Ga0207693_10058404 3300025915 Bacteria 3022
205 Ga0207693_10360399 3300025915 Bacteria 1137
206 Ga0207693_10865034 3300025915 Bacteria 695
207 Ga0207693_11012268 3300025915 Unclassified 634
208 Ga0207693_11177356 3300025915 Unclassified 579
209 Ga0207693_11452381 3300025915 Unclassified 507
210 Ga0207663_10016659 3300025916 Unclassified 4082
211 Ga0207663_10382410 3300025916 Bacteria 1073
212 Ga0207663_10503568 3300025916 Bacteria 941
213 Ga0207663_10751967 3300025916 Bacteria 774
214 Ga0207663_11082791 3300025916 Unclassified 644
215 Ga0207663_11244992 3300025916 Bacteria 599
216 Ga0207662_10002743 3300025918 Bacteria 8888
217 Ga0207646_10009611 3300025922 Bacteria 9539
218 Ga0207646_10039299 3300025922 Unclassified 4259
219 Ga0207646_10257818 3300025922 Bacteria 1576
220 Ga0207646_10393132 3300025922 Bacteria 1252
221 Ga0207646_10571508 3300025922 Unclassified 1016
222 Ga0207646_11296239 3300025922 Unclassified 636
223 Ga0207694_10126294 3300025924 Bacteria 2047
224 Ga0207694_10132677 3300025924 Unclassified 1997
225 Ga0207694_10172710 3300025924 Bacteria 1751
226 Ga0207687_10218410 3300025927 Unclassified 1499
227 Ga0207700_10287601 3300025928 Bacteria 1416
228 Ga0207700_10375925 3300025928 Bacteria 1242
229 Ga0207700_10509442 3300025928 Bacteria 1065
230 Ga0207700_11496689 3300025928 Unclassified 599
231 Ga0207664_10355242 3300025929 Bacteria 1298
232 Ga0207664_10591831 3300025929 Bacteria 996
233 Ga0207644_10920865 3300025931 Bacteria 733
234 Ga0207670_10000012 3300025936 Bacteria 246808
235 Ga0207670_10012607 3300025936 Bacteria 4952
236 Ga0207670_10066552 3300025936 Bacteria 2476
237 Ga0207669_11864600 3300025937 Unclassified 514
238 Ga0207665_10049202 3300025939 Bacteria 2831
239 Ga0207691_10754053 3300025940 Unclassified 819
240 Ga0207711_10619189 3300025941 Bacteria 1010
241 Ga0207689_10308053 3300025942 Bacteria 1313
242 Ga0207661_10027328 3300025944 Unclassified 4358
243 Ga0207661_10641142 3300025944 Unclassified 976
244 Ga0207661_11520970 3300025944 Bacteria 613
245 Ga0207679_10460422 3300025945 Bacteria 1129
246 Ga0207667_10004628 3300025949 Bacteria 16881
247 Ga0207667_10022848 3300025949 Bacteria 6898
248 Ga0207639_10029699 3300026041 Bacteria 4005
249 Ga0207678_10082978 3300026067 Bacteria 2741
250 Ga0207708_10286907 3300026075 Bacteria 1335
251 Ga0207702_10005180 3300026078 Bacteria 11462
252 Ga0207702_10012628 3300026078 Bacteria 7031
253 Ga0207702_10171191 3300026078 Bacteria 1991
254 Ga0207702_11011045 3300026078 Bacteria 825
255 Ga0207641_10650365 3300026088 Bacteria 1035
256 Ga0207676_10324901 3300026095 Bacteria 1414
257 Ga0207676_10467610 3300026095 Bacteria 1192
258 Ga0207674_10003376 3300026116 Bacteria 19600
259 Ga0207675_101198189 3300026118 Unclassified 780
260 Ga0207698_10000026 3300026142 Bacteria 121055
261 Ga0207698_10116054 3300026142 Bacteria 2256
262 Ga0209588_1069961 3300027671 Bacteria 1134
263 Ga0268265_10055555 3300028380 Bacteria 3009
264 Ga0268264_10050612 3300028381 Bacteria 3460
265 Ga0268264_10842717 3300028381 Bacteria 918
266 Ga0265770_1083136 3300030878 Bacteria 628
267 Ga0265765_1007553 3300030879 Bacteria 1172
268 Ga0265760_10058715 3300031090 Bacteria 1166
269 Ga0265325_10183522 3300031241 Bacteria 973
270 Ga0265340_10120133 3300031247 Bacteria 1210
271 Ga0265331_10399565 3300031250 Unclassified 616
272 Ga0265327_10386126 3300031251 Bacteria 609
273 Ga0265316_10055987 3300031344 Bacteria 3082
274 Ga0265314_10003062 3300031711 Bacteria 16483
275 Ga0316215_1008301 3300033544 Bacteria 1020
276 Ga0373923_0479695 3300035111 Bacteria 605
277 Ga0373945_0174870 3300035116 Bacteria 881
278 Ga0373954_0386513 3300035118 Bacteria 692
279 Ga0373960_0148033 3300035121 Unclassified 800
280 Ga0373943_0015260 3300035170 Bacteria 3488
281 Ga0373943_0282992 3300035170 Unclassified 938
282 Ga0373955_0244122 3300035172 Unclassified 1076
283 Ga0373955_0881066 3300035172 Bacteria 551
284 Ga0373931_0241226 3300035691 Unclassified 1096
285 Ga0373931_0965075 3300035691 Unclassified 575
286 Ga0373927_0062484 3300035695 Bacteria 2408
287 Ga0373947_0078571 3300035725 Unclassified 2037
288 Ga0373947_0282706 3300035725 Unclassified 1103
289 Ga0373947_0375480 3300035725 Bacteria 956
290 Ga0373937_0147918 3300036401 Bacteria 2200
291 Ga0373937_0366226 3300036401 Bacteria 1366
292 Ga0373937_1011462 3300036401 Bacteria 780
293 Ga0373925_0051832 3300037068 Bacteria 3064
294 Ga0395900_0022103 3300037418 Bacteria 6507
295 Ga0395900_0617829 3300037418 Unclassified 1023
296 Ga0395898_0110514 3300037466 Bacteria 2635
297 Ga0395905_0311714 3300037471 Unclassified 1462
298 Ga0395905_0821759 3300037471 Bacteria 832
299 Ga0436364_0116052 3300037853 Bacteria 3268
300 Ga0436364_0129406 3300037853 Bacteria 129389
301 Ga0436364_0170813 3300037853 Unclassified 814
302 Ga0436364_0312936 3300037853 Bacteria 5489
303 Ga0436364_0507467 3300037853 Unclassified 807
304 Ga0436364_0898416 3300037853 Bacteria 5076
305 Ga0436364_0940248 3300037853 Bacteria 592364
306 Ga0436364_1000463 3300037853 Unclassified 1155
307 Ga0436364_1431862 3300037853 Unclassified 2318
308 Ga0395901_0035440 3300038443 Bacteria 5155
309 Ga0436365_0103793 3300039437 Bacteria 945
310 Ga0436365_0500420 3300039437 Unclassified 3441
311 Ga0436365_0819339 3300039437 Bacteria 1381
312 Ga0436365_1138085 3300039437 Bacteria 2387
313 Ga0436360_0897199 3300039438 Unclassified 1331
314 Ga0436360_1037650 3300039438 Bacteria 2243
315 Ga0436360_1153712 3300039438 Bacteria 1041
316 Ga0436363_0247301 3300039450 Bacteria 2725
317 Ga0436363_0317525 3300039450 Unclassified 573
318 Ga0436363_0579571 3300039450 Unclassified 606
319 Ga0436363_1233885 3300039450 Bacteria 782
320 Ga0436362_0053952 3300039453 Bacteria 4160
321 Ga0436362_0876255 3300039453 Unclassified 3038
322 Ga0451839_0076048 3300041496 Bacteria 773
323 Ga0451577_2040145 3300042876 Bacteria 501
324 Ga0453683_0016109 3300044673 Bacteria 4831
325 Ga0466966_0494967 3300044684 Bacteria 735
326 Ga0466963_0110225 3300044694 Bacteria 1889
327 Ga0466964_0303193 3300044706 Unclassified 806
328 Ga0466957_0488880 3300044842 Unclassified 852
329 Ga0466959_0093721 3300045049 Unclassified 2155
330 Ga0451576_0082143 3300045051 Bacteria 3351
331 Ga0466958_0033847 3300045836 Bacteria 3046
332 Ga0466967_0659884 3300045976 Bacteria 1035
333 Ga0466967_1937472 3300045976 Unclassified 586
334 Ga0495603_0027148 3300046455 Bacteria 3457
335 Ga0495653_0050729 3300046463 Bacteria 3190
336 Ga0495580_0073902 3300046472 Bacteria 2380
337 Ga0495580_0088261 3300046472 Unclassified 2160
338 Ga0495662_0373400 3300046476 Bacteria 701
339 Ga0495664_0268600 3300046477 Unclassified 1031
340 Ga0495628_0300253 3300046516 Bacteria 1189
341 Ga0495630_0136235 3300046517 Bacteria 1866
342 Ga0495630_0183661 3300046517 Bacteria 1595
343 Ga0495642_0239093 3300046528 Bacteria 794
344 Ga0495634_0397492 3300046642 Unclassified 819
345 Ga0495635_0367167 3300046663 Bacteria 959
346 Ga0495659_0292881 3300046664 Unclassified 686
347 Ga0495669_0217279 3300046684 Bacteria 916
348 Ga0495613_0379336 3300046689 Bacteria 967
349 Ga0495624_0806119 3300046690 Bacteria 555
350 Ga0495581_0194674 3300047315 Bacteria 1186
351 Ga0495581_0253674 3300047315 Bacteria 1029
352 Ga0495674_0576466 3300047319 Unclassified 893
353 Ga0495680_0081481 3300047322 Bacteria 2443
354 Ga0495675_0140233 3300047444 Bacteria 1499
355 Ga0495615_0062585 3300048090 Unclassified 986
356 Ga0496104_0777322 3300048907 Bacteria 864
357 Ga0496105_0352406 3300048908 Bacteria 1175
358 Ga0496105_1059869 3300048908 Unclassified 604
359 Ga0496109_1741017 3300048912 Unclassified 557
360 Ga0496112_0676008 3300048915 Bacteria 961
361 Ga0496112_1676870 3300048915 Unclassified 548
362 Ga0496113_0103285 3300048916 Bacteria 2211
363 Ga0501069_0677370 3300049585 Unclassified 621
364 nmdc:mga06r32_1570401_c1 3300050510 Unclassified 597
365 nmdc:mga0n895_427222_c1 3300050512 Unclassified 1339
366 nmdc:mga0n895_845478_c1 3300050512 Bacteria 903
367 nmdc:mga0rr50_754923_c1 3300050513 Bacteria 830
368 nmdc:mga08x19_296418_c1 3300050514 Unclassified 1123
369 nmdc:mga08x19_700325_c1 3300050514 Bacteria 719
370 nmdc:mga08x19_946275_c1 3300050514 Bacteria 612
371 nmdc:mga0a205_132427_c1 3300050515 Bacteria 2393
372 nmdc:mga0a205_327054_c1 3300050515 Bacteria 1403
373 Ga0495612_0395137 3300053078 Bacteria 628
374 Ga0213875_10166776
375 rootH2_10084815
376 rootH2_10178165
377 Ga0065712_10253695
378 Ga0065715_10152031
379 Ga0070683_100018328
380 Ga0070683_100903446
381 Ga0070689_100002049
382 Ga0070689_100074058
383 Ga0070689_100190920
384 Ga0070687_100156064
385 Ga0070675_101289953
386 Ga0070673_100887153
387 Ga0070688_100000001
388 Ga0070688_100000479
389 Ga0070703_10421309
390 Ga0070709_10207696
391 Ga0070709_10491225
392 Ga0070714_100285538
393 Ga0070714_100693684
394 Ga0070714_101008856
395 Ga0070713_100388180
396 Ga0070713_100454356
397 Ga0070713_100576980
398 Ga0070713_100747613
399 Ga0070710_10965099
400 Ga0070710_11154594
401 Ga0070701_10040214
402 Ga0070711_100005049
403 Ga0070711_100412878
404 Ga0070711_100586552
405 Ga0070711_100859165
406 Ga0070711_101242260
407 Ga0070705_100045927
408 Ga0070705_100376609
409 Ga0070705_100614801
410 Ga0070694_100046215
411 Ga0070708_100007101
412 Ga0070708_100018387
413 Ga0070708_100024281
414 Ga0070708_100173152
415 Ga0070708_100413587
416 Ga0070708_101150856
417 Ga0070663_100027897
418 Ga0070681_10008874
419 Ga0068867_100867172
420 Ga0070706_100003356
421 Ga0070706_100003485
422 Ga0070706_100006890
423 Ga0070706_100007120
424 Ga0070706_100020212
425 Ga0070706_100066082
426 Ga0070706_100941837
427 Ga0070707_100011416
428 Ga0070707_100550607
429 Ga0070707_100669953
430 Ga0070707_101534726
431 Ga0070698_100052677
432 Ga0070698_100117869
433 Ga0070698_100220736
434 Ga0070698_100697810
435 Ga0070698_100768965
436 Ga0070699_100000003
437 Ga0070699_100110600
438 Ga0070699_100303022
439 Ga0070699_101118498
440 Ga0070699_101346213
441 Ga0070684_100274736
442 Ga0070684_100308795
443 Ga0070697_100007847
444 Ga0070697_100316347
445 Ga0070697_101096175
446 Ga0070697_101127110
447 Ga0068853_100027695
448 Ga0070672_101270573
449 Ga0070686_100137461
450 Ga0070704_100550684
451 Ga0070704_100983232
452 Ga0068855_100014925
453 Ga0068855_100490203
454 Ga0070664_100112358
455 Ga0068857_100004060
456 Ga0068856_100003095
457 Ga0068856_100003102
458 Ga0068856_100088418
459 Ga0068856_100335911
460 Ga0070702_100624425
461 Ga0068852_100000023
462 Ga0068852_100122003
463 Ga0068859_100239291
464 Ga0068859_100440973
465 Ga0068864_100531030
466 Ga0068851_10007241
467 Ga0068863_100186666
468 Ga0068863_101420774
469 Ga0068860_100156418
470 Ga0068860_100734684
471 Ga0068862_100080385
472 Ga0068862_100568366
473 Ga0081455_10014032
474 Ga0081455_10301982
475 Ga0070717_10012090
476 Ga0070717_10032405
477 Ga0070717_10086774
478 Ga0070717_10174864
479 Ga0070717_10969741
480 Ga0070717_11232035
481 Ga0070717_11555966
482 Ga0070715_10044621
483 Ga0070716_100332171
484 Ga0070716_100464759
485 Ga0070716_100551127
486 Ga0070712_100239194
487 Ga0070712_100444715
488 Ga0070712_100457827
489 Ga0070712_100716656
490 Ga0070712_102043988
491 Ga0097621_100465369
492 Ga0075433_11459525
493 Ga0075434_100117330
494 Ga0075434_100173528
495 Ga0075434_100542415
496 Ga0075434_102268849
497 Ga0075436_100316288
498 Ga0075436_100913440
499 Ga0097620_100239289
500 Ga0097620_100440940
501 Ga0075435_100347461
502 Ga0075435_100530999
503 Ga0075435_102016374
504 Ga0099794_10085232
505 Ga0099794_10113349
506 Ga0105250_10483651
507 Ga0105240_10000203
508 Ga0105240_10603391
509 Ga0105245_10161597
510 Ga0114129_10879213
511 Ga0105241_10358690
512 Ga0105241_10412034
513 Ga0105242_10911476
514 Ga0105242_11644002
515 Ga0105237_10074533
516 Ga0105237_10188526
517 Ga0105237_11032532
518 Ga0105238_10058699
519 Ga0105238_10170614
520 Ga0099796_10172439
521 Ga0157373_10185650
522 Ga0157370_10004444
523 Ga0157369_10000095
524 Ga0157369_10034337
525 Ga0157369_10334916
526 Ga0157369_10763475
527 Ga0157374_10040761
528 Ga0157374_10298201
529 Ga0157374_10455997
530 Ga0157374_12516358
531 Ga0157372_10001034
532 Ga0157372_10005602
533 Ga0157372_10012595
534 Ga0157372_10016210
535 Ga0157372_10117395
536 Ga0157372_10147612
537 Ga0157372_10473329
538 Ga0157372_12916663
539 Ga0163163_10123318
540 Ga0163163_10515359
541 Ga0163163_10854553
542 Ga0157379_10655123
543 Ga0182007_10127796
544 Ga0213873_10037654
545 Ga0213874_10024560
546 Ga0213874_10455979
547 Ga0213876_10363323
548 Ga0213876_10705262
549 Ga0213875_10000103
550 Ga0213875_10029620
551 Ga0213875_10063818
552 Ga0213875_10478911
553 Ga0213871_10209831
554 Ga0213871_10288597
555 Ga0207653_10413020
556 Ga0207692_10361159
557 Ga0207692_11085969
558 Ga0207685_10051351
559 Ga0207699_10354510
560 Ga0207699_10824363
561 Ga0207684_10000379
562 Ga0207684_10003290
563 Ga0207684_10004634
564 Ga0207684_10005648
565 Ga0207684_10042896
566 Ga0207684_10543968
567 Ga0207684_10723700
568 Ga0207654_10264773
569 Ga0207654_10980784
570 Ga0207707_10020262
571 Ga0207695_10000303
572 Ga0207695_10031040
573 Ga0207695_10422488
574 Ga0207671_10145038
575 Ga0207671_10445090
576 Ga0207671_11321780
577 Ga0207693_10058404
578 Ga0207693_10360399
579 Ga0207693_10865034
580 Ga0207693_11012268
581 Ga0207693_11177356
582 Ga0207693_11452381
583 Ga0207663_10016659
584 Ga0207663_10382410
585 Ga0207663_10503568
586 Ga0207663_10751967
587 Ga0207663_11082791
588 Ga0207663_11244992
589 Ga0207662_10002743
590 Ga0207646_10009611
591 Ga0207646_10039299
592 Ga0207646_10257818
593 Ga0207646_10393132
594 Ga0207646_10571508
595 Ga0207646_11296239
596 Ga0207694_10126294
597 Ga0207694_10132677
598 Ga0207694_10172710
599 Ga0207687_10218410
600 Ga0207700_10287601
601 Ga0207700_10375925
602 Ga0207700_10509442
603 Ga0207700_11496689
604 Ga0207664_10355242
605 Ga0207664_10591831
606 Ga0207644_10920865
607 Ga0207670_10000012
608 Ga0207670_10012607
609 Ga0207670_10066552
610 Ga0207669_11864600
611 Ga0207665_10049202
612 Ga0207691_10754053
613 Ga0207711_10619189
614 Ga0207689_10308053
615 Ga0207661_10027328
616 Ga0207661_10641142
617 Ga0207661_11520970
618 Ga0207679_10460422
619 Ga0207667_10004628
620 Ga0207667_10022848
621 Ga0207639_10029699
622 Ga0207678_10082978
623 Ga0207708_10286907
624 Ga0207702_10005180
625 Ga0207702_10012628
626 Ga0207702_10171191
627 Ga0207702_11011045
628 Ga0207641_10650365
629 Ga0207676_10324901
630 Ga0207676_10467610
631 Ga0207674_10003376
632 Ga0207675_101198189
633 Ga0207698_10000026
634 Ga0207698_10116054
635 Ga0209588_1069961
636 Ga0268265_10055555
637 Ga0268264_10050612
638 Ga0268264_10842717
639 Ga0265770_1083136
640 Ga0265765_1007553
641 Ga0265760_10058715
642 Ga0265325_10183522
643 Ga0265340_10120133
644 Ga0265331_10399565
645 Ga0265327_10386126
646 Ga0265316_10055987
647 Ga0265314_10003062
648 Ga0316215_1008301
649 Ga0373923_0479695
650 Ga0373945_0174870
651 Ga0373954_0386513
652 Ga0373960_0148033
653 Ga0373943_0015260
654 Ga0373943_0282992
655 Ga0373955_0244122
656 Ga0373955_0881066
657 Ga0373931_0241226
658 Ga0373931_0965075
659 Ga0373927_0062484
660 Ga0373947_0078571
661 Ga0373947_0282706
662 Ga0373947_0375480
663 Ga0373937_0147918
664 Ga0373937_0366226
665 Ga0373937_1011462
666 Ga0373925_0051832
667 Ga0395900_0022103
668 Ga0395900_0617829
669 Ga0395898_0110514
670 Ga0395905_0311714
671 Ga0395905_0821759
672 Ga0436364_0116052
673 Ga0436364_0129406
674 Ga0436364_0170813
675 Ga0436364_0312936
676 Ga0436364_0507467
677 Ga0436364_0898416
678 Ga0436364_0940248
679 Ga0436364_1000463
680 Ga0436364_1431862
681 Ga0395901_0035440
682 Ga0436365_0103793
683 Ga0436365_0500420
684 Ga0436365_0819339
685 Ga0436365_1138085
686 Ga0436360_0897199
687 Ga0436360_1037650
688 Ga0436360_1153712
689 Ga0436363_0247301
690 Ga0436363_0317525
691 Ga0436363_0579571
692 Ga0436363_1233885
693 Ga0436362_0053952
694 Ga0436362_0876255
695 Ga0451839_0076048
696 Ga0451577_2040145
697 Ga0453683_0016109
698 Ga0466966_0494967
699 Ga0466963_0110225
700 Ga0466964_0303193
701 Ga0466957_0488880
702 Ga0466959_0093721
703 Ga0451576_0082143
704 Ga0466958_0033847
705 Ga0466967_0659884
706 Ga0466967_1937472
707 Ga0495603_0027148
708 Ga0495653_0050729
709 Ga0495580_0073902
710 Ga0495580_0088261
711 Ga0495662_0373400
712 Ga0495664_0268600
713 Ga0495628_0300253
714 Ga0495630_0136235
715 Ga0495630_0183661
716 Ga0495642_0239093
717 Ga0495634_0397492
718 Ga0495635_0367167
719 Ga0495659_0292881
720 Ga0495669_0217279
721 Ga0495613_0379336
722 Ga0495624_0806119
723 Ga0495581_0194674
724 Ga0495581_0253674
725 Ga0495674_0576466
726 Ga0495680_0081481
727 Ga0495675_0140233
728 Ga0495615_0062585
729 Ga0496104_0777322
730 Ga0496105_0352406
731 Ga0496105_1059869
732 Ga0496109_1741017
733 Ga0496112_0676008
734 Ga0496112_1676870
735 Ga0496113_0103285
736 Ga0501069_0677370
737 nmdc:mga06r32_1570401_c1
738 nmdc:mga0n895_427222_c1
739 nmdc:mga0n895_845478_c1
740 nmdc:mga0rr50_754923_c1
741 nmdc:mga08x19_296418_c1
742 nmdc:mga08x19_700325_c1
743 nmdc:mga08x19_946275_c1
744 nmdc:mga0a205_132427_c1
745 nmdc:mga0a205_327054_c1
746 Ga0495612_0395137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

16

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9366 8 105
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9197 10 105
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9173 10 102
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9036 13 102
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.8943 10 102
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9098 11 108 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9036 13 102 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8849 12 92 1.10.10.10
5x13A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8816 12 89 1.10.10.10
4esbA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8816 10 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A143PJ72-F1-model_v4 Lineage-specific thermal regulator protein 0.979 5 113
AF-A0A2V8L8E9-F1-model_v4 PadR family transcriptional regulator 0.9789 10 109
AF-A0A2V6MFC0-F1-model_v4 PadR family transcriptional regulator 0.9788 10 96
AF-A0A2E8EBH7-F1-model_v4 PadR family transcriptional regulator 0.978 11 111
AF-A0A2V8YVR9-F1-model_v4 PadR family transcriptional regulator 0.9771 10 109

Map