F426340

General Info

Members Datasets Scaffolds Average Seq Length
373 193 746 270

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10465447|Ga0114129_104654472
Length 305
Sequence MQDSSSVSSASTVVEMFNTEGVGRPMSARPLVLKFGGELLEDPAHVATVVSAVKTVASLGPVVIVHGGGKEIDAALKVAGLEKRQVDGLRVTDERTLDVVVSVLAGHVNTRFVAALSTAGVAAVGLTGADAACGLSSVAPPHRSTDGCEVDLERVGIPDAAADMRVLHTLVAGGFVPVVACIGLGHDGRLLNVNADTLAGYLAARLGARRLVIAGTTPGVLDERGATLEVLEAAAVADLVSRGTATAGMIAKLRACEHALTGGVDDVVIVDGRSAVALVGAAESAAPQMATRMVKEAAVACDRLG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 7.24
Rhizosphere 92.23
Stem 0
Stem Tuber 0
Unclassified 3.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10465447 3300009147 Bacteria 1656
2 Ga0065712_10116206 3300005290 Bacteria 1739
3 Ga0065707_10127555 3300005295 Bacteria 1981
4 Ga0070658_10086020 3300005327 Bacteria 2586
5 Ga0070683_100178287 3300005329 Bacteria 2017
6 Ga0070690_100243955 3300005330 Unclassified 1268
7 Ga0068869_100355458 3300005334 Bacteria 1195
8 Ga0070666_10028043 3300005335 Bacteria 3693
9 Ga0070680_100079722 3300005336 Bacteria 2699
10 Ga0068868_100096219 3300005338 Bacteria 2391
11 Ga0070660_100005591 3300005339 Bacteria 8715
12 Ga0070660_100016166 3300005339 Bacteria 5410
13 Ga0070689_100153523 3300005340 Bacteria 1858
14 Ga0070689_100265181 3300005340 Bacteria 1421
15 Ga0070691_10104675 3300005341 Bacteria 1409
16 Ga0070668_100389869 3300005347 Bacteria 1187
17 Ga0070669_100065526 3300005353 Bacteria 2676
18 Ga0070675_100002755 3300005354 Bacteria 13207
19 Ga0070675_100015148 3300005354 Bacteria 6089
20 Ga0070675_100538636 3300005354 Bacteria 1055
21 Ga0070674_100005121 3300005356 Bacteria 7536
22 Ga0070674_100330655 3300005356 Bacteria 1225
23 Ga0070659_100123370 3300005366 Bacteria 2100
24 Ga0070659_100161561 3300005366 Bacteria 1832
25 Ga0070667_100204602 3300005367 Bacteria 1752
26 Ga0070667_100339414 3300005367 Bacteria 1358
27 Ga0070709_10253038 3300005434 Bacteria 1270
28 Ga0070705_100017141 3300005440 Bacteria 3777
29 Ga0070700_100040481 3300005441 Bacteria 2853
30 Ga0070700_100090200 3300005441 Bacteria 1999
31 Ga0070694_100565888 3300005444 Bacteria 912
32 Ga0070708_100272938 3300005445 Bacteria 1591
33 Ga0070662_100064534 3300005457 Bacteria 2682
34 Ga0070681_10006653 3300005458 Bacteria 11251
35 Ga0068867_100115494 3300005459 Bacteria 2067
36 Ga0068867_100501279 3300005459 Bacteria 1043
37 Ga0070685_10099143 3300005466 Bacteria 1776
38 Ga0070706_100635818 3300005467 Bacteria 991
39 Ga0070707_100024081 3300005468 Bacteria 5762
40 Ga0070707_100073525 3300005468 Bacteria 3296
41 Ga0070698_100046896 3300005471 Bacteria 4418
42 Ga0070698_100425027 3300005471 Bacteria 1263
43 Ga0070699_100065570 3300005518 Bacteria 3152
44 Ga0070699_100388472 3300005518 Bacteria 1261
45 Ga0070697_100240528 3300005536 Unclassified 1546
46 Ga0068853_100274968 3300005539 Bacteria 1552
47 Ga0070672_100019097 3300005543 Bacteria 4968
48 Ga0070672_100412060 3300005543 Bacteria 1159
49 Ga0070686_100037862 3300005544 Bacteria 2995
50 Ga0070695_100004708 3300005545 Bacteria 8027
51 Ga0070695_100247033 3300005545 Unclassified 1297
52 Ga0070696_100116537 3300005546 Bacteria 1929
53 Ga0070665_100001384 3300005548 Bacteria 28575
54 Ga0070665_100004631 3300005548 Bacteria 14377
55 Ga0070665_100193324 3300005548 Bacteria 2035
56 Ga0070704_100002214 3300005549 Bacteria 10835
57 Ga0070704_100027953 3300005549 Bacteria 3746
58 Ga0070704_100108370 3300005549 Bacteria 2109
59 Ga0068855_100004263 3300005563 Bacteria 17459
60 Ga0070664_100086778 3300005564 Bacteria 2704
61 Ga0070664_100202192 3300005564 Unclassified 1773
62 Ga0070664_100216143 3300005564 Bacteria 1714
63 Ga0070664_100222334 3300005564 Bacteria 1690
64 Ga0068857_100022240 3300005577 Bacteria 5579
65 Ga0068857_100345690 3300005577 Bacteria 1377
66 Ga0068859_100003788 3300005617 Bacteria 15423
67 Ga0068859_100440440 3300005617 Bacteria 1399
68 Ga0068859_100548074 3300005617 Bacteria 1251
69 Ga0068859_100689177 3300005617 Bacteria 1113
70 Ga0068859_100720704 3300005617 Bacteria 1087
71 Ga0068864_100004024 3300005618 Bacteria 12078
72 Ga0068864_100070984 3300005618 Bacteria 3032
73 Ga0068864_100071198 3300005618 Bacteria 3027
74 Ga0068864_100200455 3300005618 Bacteria 1833
75 Ga0068864_100646228 3300005618 Bacteria 1030
76 Ga0068866_10043313 3300005718 Bacteria 2246
77 Ga0068861_100040126 3300005719 Bacteria 3498
78 Ga0068863_100010645 3300005841 Bacteria 8929
79 Ga0068863_100150520 3300005841 Bacteria 2226
80 Ga0068863_100185376 3300005841 Bacteria 1998
81 Ga0068863_100261656 3300005841 Bacteria 1673
82 Ga0068858_100004822 3300005842 Bacteria 13211
83 Ga0068858_100068791 3300005842 Bacteria 3281
84 Ga0068858_100627522 3300005842 Bacteria 1043
85 Ga0068860_100064105 3300005843 Bacteria 3491
86 Ga0068860_100148900 3300005843 Bacteria 2253
87 Ga0068860_100390079 3300005843 Bacteria 1376
88 Ga0068862_100005863 3300005844 Bacteria 10233
89 Ga0068862_100039799 3300005844 Bacteria 3994
90 Ga0081539_10003680 3300005985 Bacteria 18367
91 Ga0075432_10058421 3300006058 Bacteria 1370
92 Ga0070715_10035706 3300006163 Bacteria 2046
93 Ga0070715_10223244 3300006163 Bacteria 970
94 Ga0070716_100300784 3300006173 Bacteria 1116
95 Ga0097621_100011145 3300006237 Bacteria 6615
96 Ga0097621_100443715 3300006237 Bacteria 1168
97 Ga0068871_100002546 3300006358 Bacteria 12439
98 Ga0068871_100073214 3300006358 Bacteria 2824
99 Ga0075428_100008611 3300006844 Bacteria 11317
100 Ga0075428_100094858 3300006844 Bacteria 3252
101 Ga0075431_100446084 3300006847 Bacteria 1290
102 Ga0075433_10313180 3300006852 Bacteria 1389
103 Ga0075433_10470325 3300006852 Bacteria 1107
104 Ga0075433_10495005 3300006852 Unclassified 1076
105 Ga0075434_100006255 3300006871 Bacteria 10904
106 Ga0075434_100148614 3300006871 Bacteria 2363
107 Ga0075434_100199091 3300006871 Bacteria 2022
108 Ga0075434_100213262 3300006871 Bacteria 1951
109 Ga0075434_100332423 3300006871 Bacteria 1540
110 Ga0075429_100043454 3300006880 Bacteria 3911
111 Ga0075429_100177286 3300006880 Bacteria 1868
112 Ga0068865_100000944 3300006881 Bacteria 16522
113 Ga0068865_100269432 3300006881 Bacteria 1351
114 Ga0075436_100004866 3300006914 Bacteria 9229
115 Ga0097620_100003788 3300006931 Bacteria 15423
116 Ga0097620_100440445 3300006931 Bacteria 1399
117 Ga0097620_100548068 3300006931 Bacteria 1251
118 Ga0097620_100689222 3300006931 Bacteria 1113
119 Ga0097620_100720716 3300006931 Bacteria 1087
120 Ga0075435_100005015 3300007076 Bacteria 9190
121 Ga0075435_100011862 3300007076 Bacteria 6433
122 Ga0075435_100015685 3300007076 Bacteria 5700
123 Ga0075435_100031187 3300007076 Bacteria 4197
124 Ga0075435_100349555 3300007076 Bacteria 1267
125 Ga0105240_10557869 3300009093 Bacteria 1266
126 Ga0111539_10001186 3300009094 Bacteria 34634
127 Ga0111539_10004085 3300009094 Bacteria 19151
128 Ga0111539_10006521 3300009094 Bacteria 15036
129 Ga0111539_10093426 3300009094 Bacteria 3533
130 Ga0111539_10157782 3300009094 Bacteria 2655
131 Ga0111539_10295681 3300009094 Bacteria 1884
132 Ga0111539_10515591 3300009094 Bacteria 1393
133 Ga0105245_10066956 3300009098 Bacteria 3252
134 Ga0105245_10102418 3300009098 Bacteria 2651
135 Ga0105245_10116557 3300009098 Bacteria 2491
136 Ga0105247_10031765 3300009101 Bacteria 3206
137 Ga0114129_10001435 3300009147 Bacteria 32173
138 Ga0114129_10005106 3300009147 Bacteria 18477
139 Ga0114129_10022929 3300009147 Bacteria 8855
140 Ga0114129_10034998 3300009147 Bacteria 7094
141 Ga0114129_10100891 3300009147 Bacteria 3994
142 Ga0114129_10108784 3300009147 Bacteria 3827
143 Ga0114129_10285494 3300009147 Bacteria 2204
144 Ga0114129_10609610 3300009147 Unclassified 1413
145 Ga0114129_10700498 3300009147 Unclassified 1302
146 Ga0105243_10017403 3300009148 Bacteria 5433
147 Ga0105242_10005849 3300009176 Bacteria 9476
148 Ga0105242_10222443 3300009176 Bacteria 1688
149 Ga0105248_10015618 3300009177 Bacteria 8370
150 Ga0105248_10019486 3300009177 Bacteria 7507
151 Ga0105248_10074996 3300009177 Bacteria 3802
152 Ga0105248_10091391 3300009177 Bacteria 3428
153 Ga0105248_10163374 3300009177 Bacteria 2511
154 Ga0105238_10322977 3300009551 Bacteria 1530
155 Ga0105249_10438520 3300009553 Bacteria 1343
156 Ga0157378_10459748 3300013297 Bacteria 1264
157 Ga0163162_10143648 3300013306 Bacteria 2501
158 Ga0163162_10170208 3300013306 Bacteria 2303
159 Ga0157372_10285651 3300013307 Bacteria 1919
160 Ga0157375_10466383 3300013308 Bacteria 1428
161 Ga0157375_10484619 3300013308 Bacteria 1401
162 Ga0163163_10004856 3300014325 Bacteria 11552
163 Ga0163163_10005209 3300014325 Bacteria 11216
164 Ga0163163_10058808 3300014325 Bacteria 3801
165 Ga0163163_10366493 3300014325 Bacteria 1498
166 Ga0163163_10961734 3300014325 Unclassified 917
167 Ga0157380_10323159 3300014326 Bacteria 1431
168 Ga0157377_10039021 3300014745 Bacteria 2625
169 Ga0157377_10056634 3300014745 Bacteria 2227
170 Ga0157379_10010647 3300014968 Bacteria 8015
171 Ga0157379_10071212 3300014968 Bacteria 3111
172 Ga0157379_10157185 3300014968 Bacteria 2051
173 Ga0157376_10084219 3300014969 Bacteria 2737
174 Ga0157376_10157203 3300014969 Bacteria 2057
175 Ga0157376_10235246 3300014969 Bacteria 1704
176 Ga0157376_10596728 3300014969 Bacteria 1099
177 Ga0207710_10009783 3300025900 Bacteria 4029
178 Ga0207680_10014704 3300025903 Bacteria 4062
179 Ga0207680_10051042 3300025903 Bacteria 2472
180 Ga0207685_10002870 3300025905 Bacteria 4061
181 Ga0207645_10186885 3300025907 Bacteria 1361
182 Ga0207645_10279204 3300025907 Bacteria 1109
183 Ga0207707_10030861 3300025912 Bacteria 4688
184 Ga0207707_10105472 3300025912 Bacteria 2463
185 Ga0207660_10015876 3300025917 Bacteria 4977
186 Ga0207660_10127396 3300025917 Bacteria 1935
187 Ga0207660_10323774 3300025917 Bacteria 1231
188 Ga0207657_10005945 3300025919 Bacteria 12701
189 Ga0207657_10050190 3300025919 Bacteria 3631
190 Ga0207649_10345444 3300025920 Bacteria 1100
191 Ga0207646_10072049 3300025922 Bacteria 3086
192 Ga0207646_10470092 3300025922 Bacteria 1134
193 Ga0207681_10011617 3300025923 Bacteria 5412
194 Ga0207681_10052677 3300025923 Bacteria 2760
195 Ga0207650_10031665 3300025925 Bacteria 3821
196 Ga0207659_10001358 3300025926 Bacteria 14609
197 Ga0207659_10077881 3300025926 Bacteria 2441
198 Ga0207659_10080869 3300025926 Bacteria 2401
199 Ga0207659_10146918 3300025926 Unclassified 1837
200 Ga0207659_10469760 3300025926 Bacteria 1061
201 Ga0207644_10016341 3300025931 Bacteria 4993
202 Ga0207644_10409964 3300025931 Bacteria 1109
203 Ga0207706_10035538 3300025933 Bacteria 4429
204 Ga0207706_10110325 3300025933 Bacteria 2420
205 Ga0207706_10340887 3300025933 Bacteria 1304
206 Ga0207706_10364345 3300025933 Bacteria 1256
207 Ga0207686_10071086 3300025934 Bacteria 2238
208 Ga0207686_10179303 3300025934 Bacteria 1501
209 Ga0207709_10031486 3300025935 Bacteria 3099
210 Ga0207709_10143808 3300025935 Bacteria 1643
211 Ga0207709_10307870 3300025935 Bacteria 1181
212 Ga0207670_10070810 3300025936 Bacteria 2410
213 Ga0207670_10139111 3300025936 Bacteria 1788
214 Ga0207669_10005993 3300025937 Bacteria 5512
215 Ga0207711_10017574 3300025941 Bacteria 5942
216 Ga0207711_10019284 3300025941 Bacteria 5680
217 Ga0207711_10208306 3300025941 Bacteria 1786
218 Ga0207711_10555488 3300025941 Bacteria 1071
219 Ga0207689_10222050 3300025942 Bacteria 1561
220 Ga0207661_10202449 3300025944 Bacteria 1746
221 Ga0207667_10120333 3300025949 Bacteria 2705
222 Ga0207651_10067210 3300025960 Bacteria 2522
223 Ga0207651_10269777 3300025960 Bacteria 1401
224 Ga0207712_10242574 3300025961 Bacteria 1452
225 Ga0207668_10011441 3300025972 Bacteria 5392
226 Ga0207668_10023022 3300025972 Bacteria 3997
227 Ga0207640_10370665 3300025981 Bacteria 1157
228 Ga0207658_10351151 3300025986 Bacteria 1284
229 Ga0207677_10155681 3300026023 Bacteria 1769
230 Ga0207677_10185131 3300026023 Bacteria 1641
231 Ga0207703_10023920 3300026035 Bacteria 4804
232 Ga0207703_10037185 3300026035 Bacteria 3878
233 Ga0207703_10044737 3300026035 Bacteria 3560
234 Ga0207703_10386051 3300026035 Bacteria 1296
235 Ga0207703_10490404 3300026035 Bacteria 1152
236 Ga0207708_10029847 3300026075 Bacteria 4134
237 Ga0207641_10000870 3300026088 Bacteria 31696
238 Ga0207641_10158239 3300026088 Bacteria 2057
239 Ga0207641_10356250 3300026088 Bacteria 1396
240 Ga0207648_10008433 3300026089 Bacteria 9984
241 Ga0207648_10042300 3300026089 Bacteria 3999
242 Ga0207648_10318290 3300026089 Bacteria 1398
243 Ga0207676_10005066 3300026095 Bacteria 9324
244 Ga0207676_10051450 3300026095 Bacteria 3216
245 Ga0207676_10167648 3300026095 Bacteria 1910
246 Ga0207674_10271403 3300026116 Bacteria 1644
247 Ga0207674_10376918 3300026116 Bacteria 1371
248 Ga0207675_100003742 3300026118 Bacteria 14820
249 Ga0207675_100027753 3300026118 Bacteria 5273
250 Ga0207675_100403168 3300026118 Bacteria 1348
251 Ga0207675_100423146 3300026118 Bacteria 1316
252 Ga0207683_10217921 3300026121 Bacteria 1738
253 Ga0207683_10364947 3300026121 Bacteria 1326
254 Ga0207698_10122367 3300026142 Bacteria 2205
255 Ga0207428_10029598 3300027907 Bacteria 4536
256 Ga0207428_10086150 3300027907 Bacteria 2445
257 Ga0207428_10364015 3300027907 Bacteria 1063
258 Ga0268266_10040337 3300028379 Bacteria 3979
259 Ga0268266_10084540 3300028379 Bacteria 2771
260 Ga0268265_10085009 3300028380 Bacteria 2509
261 Ga0268264_10048107 3300028381 Bacteria 3547
262 Ga0268264_10522983 3300028381 Bacteria 1160
263 Ga0265332_10055647 3300031238 Bacteria 1696
264 Ga0265320_10087940 3300031240 Bacteria 1442
265 Ga0307408_100143646 3300031548 Bacteria 1876
266 Ga0307410_10039040 3300031852 Bacteria 3114
267 Ga0307416_100625967 3300032002 Bacteria 1159
268 Ga0373938_0012633 3300034957 Bacteria 1589
269 Ga0373944_0100497 3300035089 Bacteria 977
270 Ga0373932_0030487 3300035112 Bacteria 1495
271 Ga0373957_0081116 3300035120 Bacteria 1281
272 Ga0373946_0111706 3300035171 Bacteria 1238
273 Ga0373962_0051105 3300035242 Bacteria 1192
274 Ga0373931_0177155 3300035691 Bacteria 1260
275 Ga0373935_0210788 3300035692 Bacteria 1346
276 Ga0373927_0173197 3300035695 Bacteria 1415
277 Ga0373947_0107415 3300035725 Bacteria 1760
278 Ga0373937_0244445 3300036401 Bacteria 1691
279 Ga0373925_0160825 3300037068 Bacteria 1769
280 Ga0495582_0127988 3300046473 Bacteria 1434
281 Ga0495628_0086489 3300046516 Bacteria 2431
282 Ga0495628_0129186 3300046516 Bacteria 1934
283 Ga0495586_0061788 3300046535 Bacteria 2039
284 Ga0495586_0137539 3300046535 Bacteria 1370
285 Ga0495587_0162047 3300046536 Unclassified 1272
286 Ga0495621_0002781 3300046539 Bacteria 4757
287 Ga0495634_0022869 3300046642 Bacteria 4401
288 Ga0495658_0014056 3300046683 Bacteria 4081
289 Ga0495658_0122116 3300046683 Bacteria 1576
290 Ga0495669_0002771 3300046684 Bacteria 7182
291 Ga0495669_0151690 3300046684 Bacteria 1097
292 Ga0495613_0163041 3300046689 Bacteria 1585
293 Ga0495674_0113476 3300047319 Bacteria 2295
294 Ga0495674_0404761 3300047319 Bacteria 1101
295 Ga0496100_0077705 3300048903 Bacteria 2232
296 Ga0496101_0000685 3300048904 Bacteria 20428
297 Ga0496101_0206991 3300048904 Bacteria 1519
298 Ga0496102_0118528 3300048905 Bacteria 2471
299 Ga0496102_0233259 3300048905 Bacteria 1735
300 Ga0496104_0001648 3300048907 Bacteria 19263
301 Ga0496104_0198789 3300048907 Bacteria 1916
302 Ga0496104_0204826 3300048907 Bacteria 1885
303 Ga0496104_0221347 3300048907 Bacteria 1805
304 Ga0496105_0006629 3300048908 Bacteria 8914
305 Ga0496105_0203461 3300048908 Bacteria 1616
306 Ga0496106_0105847 3300048909 Unclassified 2186
307 Ga0496107_0133782 3300048910 Bacteria 1832
308 Ga0496107_0321905 3300048910 Bacteria 1151
309 Ga0496108_0113688 3300048911 Bacteria 2317
310 Ga0496109_0163342 3300048912 Bacteria 2087
311 Ga0496110_0306992 3300048913 Bacteria 1445
312 Ga0496112_0012595 3300048915 Bacteria 7772
313 Ga0496112_0043934 3300048915 Bacteria 4376
314 Ga0496112_0294680 3300048915 Bacteria 1568
315 Ga0496114_0000504 3300048917 Bacteria 28590
316 Ga0496114_0009672 3300048917 Bacteria 7659
317 Ga0496114_0137054 3300048917 Bacteria 2117
318 Ga0496114_0238848 3300048917 Bacteria 1597
319 Ga0496114_0247892 3300048917 Bacteria 1567
320 Ga0496114_0322364 3300048917 Bacteria 1365
321 Ga0496115_0137888 3300048918 Bacteria 2012
322 Ga0501034_0219659 3300049571 Bacteria 1853
323 Ga0501036_0060150 3300049572 Bacteria 3218
324 Ga0501038_0178806 3300049574 Bacteria 1713
325 Ga0501042_0053228 3300049578 Bacteria 2888
326 Ga0501047_0164867 3300049581 Bacteria 2087
327 Ga0501048_0099980 3300049582 Bacteria 2046
328 Ga0501068_0240124 3300049584 Bacteria 1153
329 Ga0501071_0007258 3300049587 Bacteria 7255
330 Ga0501072_0042616 3300049588 Bacteria 3565
331 Ga0501073_0000250 3300049589 Bacteria 35494
332 Ga0501074_0084087 3300049590 Bacteria 2281
333 Ga0501075_0158714 3300049591 Bacteria 1725
334 Ga0501079_0029816 3300049741 Bacteria 4190
335 Ga0501079_0136381 3300049741 Bacteria 1911
336 Ga0501045_0074372 3300049824 Bacteria 2502
337 nmdc:mga0k408_168501_c1 3300050493 Bacteria 1305
338 nmdc:mga05p37_10193_c1 3300050507 Bacteria 11157
339 nmdc:mga05p37_201260_c1 3300050507 Bacteria 2412
340 nmdc:mga05p37_249655_c1 3300050507 Bacteria 2129
341 nmdc:mga05p37_34136_c1 3300050507 Bacteria 6231
342 nmdc:mga05p37_40625_c1 3300050507 Bacteria 5713
343 nmdc:mga05p37_46925_c1 3300050507 Bacteria 5312
344 nmdc:mga05p37_6056_c1 3300050507 Bacteria 14238
345 nmdc:mga09592_321708_c1 3300050508 Bacteria 1340
346 nmdc:mga06r32_14130_c1 3300050510 Bacteria 7241
347 nmdc:mga08y16_35539_c1 3300050511 Bacteria 5233
348 nmdc:mga08y16_410659_c1 3300050511 Bacteria 1385
349 nmdc:mga08y16_41328_c1 3300050511 Bacteria 4830
350 nmdc:mga08y16_5669_c1 3300050511 Bacteria 13082
351 nmdc:mga08y16_8390_c1 3300050511 Bacteria 10811
352 nmdc:mga0n895_18382_c1 3300050512 Bacteria 6467
353 nmdc:mga0n895_207780_c1 3300050512 Bacteria 1988
354 nmdc:mga0n895_403182_c1 3300050512 Bacteria 1383
355 nmdc:mga0n895_706823_c1 3300050512 Bacteria 1004
356 nmdc:mga0rr50_217891_c1 3300050513 Bacteria 1575
357 nmdc:mga0rr50_26949_c1 3300050513 Bacteria 4018
358 nmdc:mga0rr50_332280_c1 3300050513 Bacteria 1276
359 nmdc:mga0rr50_9732_c1 3300050513 Bacteria 6064
360 nmdc:mga08x19_15570_c1 3300050514 Bacteria 4627
361 nmdc:mga08x19_245843_c1 3300050514 Bacteria 1234
362 nmdc:mga08x19_6098_c1 3300050514 Bacteria 7125
363 nmdc:mga0a205_205827_c1 3300050515 Bacteria 1857
364 nmdc:mga0a205_491980_c1 3300050515 Bacteria 1084
365 nmdc:mga0a205_543719_c1 3300050515 Unclassified 1017
366 nmdc:mga0a205_90572_c1 3300050515 Bacteria 2956
367 Ga0495601_0007459 3300053077 Bacteria 6416
368 Ga0495595_0008423 3300053084 Bacteria 4231
369 Ga0495619_0005976 3300053085 Bacteria 7707
370 Ga0495619_0063175 3300053085 Bacteria 2466
371 Ga0500646_0011496 3300053090 Bacteria 2278
372 Ga0501084_0108451 3300054114 Bacteria 2333
373 Ga0501084_0125482 3300054114 Bacteria 2160
374 Ga0114129_10465447
375 Ga0065712_10116206
376 Ga0065707_10127555
377 Ga0070658_10086020
378 Ga0070683_100178287
379 Ga0070690_100243955
380 Ga0068869_100355458
381 Ga0070666_10028043
382 Ga0070680_100079722
383 Ga0068868_100096219
384 Ga0070660_100005591
385 Ga0070660_100016166
386 Ga0070689_100153523
387 Ga0070689_100265181
388 Ga0070691_10104675
389 Ga0070668_100389869
390 Ga0070669_100065526
391 Ga0070675_100002755
392 Ga0070675_100015148
393 Ga0070675_100538636
394 Ga0070674_100005121
395 Ga0070674_100330655
396 Ga0070659_100123370
397 Ga0070659_100161561
398 Ga0070667_100204602
399 Ga0070667_100339414
400 Ga0070709_10253038
401 Ga0070705_100017141
402 Ga0070700_100040481
403 Ga0070700_100090200
404 Ga0070694_100565888
405 Ga0070708_100272938
406 Ga0070662_100064534
407 Ga0070681_10006653
408 Ga0068867_100115494
409 Ga0068867_100501279
410 Ga0070685_10099143
411 Ga0070706_100635818
412 Ga0070707_100024081
413 Ga0070707_100073525
414 Ga0070698_100046896
415 Ga0070698_100425027
416 Ga0070699_100065570
417 Ga0070699_100388472
418 Ga0070697_100240528
419 Ga0068853_100274968
420 Ga0070672_100019097
421 Ga0070672_100412060
422 Ga0070686_100037862
423 Ga0070695_100004708
424 Ga0070695_100247033
425 Ga0070696_100116537
426 Ga0070665_100001384
427 Ga0070665_100004631
428 Ga0070665_100193324
429 Ga0070704_100002214
430 Ga0070704_100027953
431 Ga0070704_100108370
432 Ga0068855_100004263
433 Ga0070664_100086778
434 Ga0070664_100202192
435 Ga0070664_100216143
436 Ga0070664_100222334
437 Ga0068857_100022240
438 Ga0068857_100345690
439 Ga0068859_100003788
440 Ga0068859_100440440
441 Ga0068859_100548074
442 Ga0068859_100689177
443 Ga0068859_100720704
444 Ga0068864_100004024
445 Ga0068864_100070984
446 Ga0068864_100071198
447 Ga0068864_100200455
448 Ga0068864_100646228
449 Ga0068866_10043313
450 Ga0068861_100040126
451 Ga0068863_100010645
452 Ga0068863_100150520
453 Ga0068863_100185376
454 Ga0068863_100261656
455 Ga0068858_100004822
456 Ga0068858_100068791
457 Ga0068858_100627522
458 Ga0068860_100064105
459 Ga0068860_100148900
460 Ga0068860_100390079
461 Ga0068862_100005863
462 Ga0068862_100039799
463 Ga0081539_10003680
464 Ga0075432_10058421
465 Ga0070715_10035706
466 Ga0070715_10223244
467 Ga0070716_100300784
468 Ga0097621_100011145
469 Ga0097621_100443715
470 Ga0068871_100002546
471 Ga0068871_100073214
472 Ga0075428_100008611
473 Ga0075428_100094858
474 Ga0075431_100446084
475 Ga0075433_10313180
476 Ga0075433_10470325
477 Ga0075433_10495005
478 Ga0075434_100006255
479 Ga0075434_100148614
480 Ga0075434_100199091
481 Ga0075434_100213262
482 Ga0075434_100332423
483 Ga0075429_100043454
484 Ga0075429_100177286
485 Ga0068865_100000944
486 Ga0068865_100269432
487 Ga0075436_100004866
488 Ga0097620_100003788
489 Ga0097620_100440445
490 Ga0097620_100548068
491 Ga0097620_100689222
492 Ga0097620_100720716
493 Ga0075435_100005015
494 Ga0075435_100011862
495 Ga0075435_100015685
496 Ga0075435_100031187
497 Ga0075435_100349555
498 Ga0105240_10557869
499 Ga0111539_10001186
500 Ga0111539_10004085
501 Ga0111539_10006521
502 Ga0111539_10093426
503 Ga0111539_10157782
504 Ga0111539_10295681
505 Ga0111539_10515591
506 Ga0105245_10066956
507 Ga0105245_10102418
508 Ga0105245_10116557
509 Ga0105247_10031765
510 Ga0114129_10001435
511 Ga0114129_10005106
512 Ga0114129_10022929
513 Ga0114129_10034998
514 Ga0114129_10100891
515 Ga0114129_10108784
516 Ga0114129_10285494
517 Ga0114129_10609610
518 Ga0114129_10700498
519 Ga0105243_10017403
520 Ga0105242_10005849
521 Ga0105242_10222443
522 Ga0105248_10015618
523 Ga0105248_10019486
524 Ga0105248_10074996
525 Ga0105248_10091391
526 Ga0105248_10163374
527 Ga0105238_10322977
528 Ga0105249_10438520
529 Ga0157378_10459748
530 Ga0163162_10143648
531 Ga0163162_10170208
532 Ga0157372_10285651
533 Ga0157375_10466383
534 Ga0157375_10484619
535 Ga0163163_10004856
536 Ga0163163_10005209
537 Ga0163163_10058808
538 Ga0163163_10366493
539 Ga0163163_10961734
540 Ga0157380_10323159
541 Ga0157377_10039021
542 Ga0157377_10056634
543 Ga0157379_10010647
544 Ga0157379_10071212
545 Ga0157379_10157185
546 Ga0157376_10084219
547 Ga0157376_10157203
548 Ga0157376_10235246
549 Ga0157376_10596728
550 Ga0207710_10009783
551 Ga0207680_10014704
552 Ga0207680_10051042
553 Ga0207685_10002870
554 Ga0207645_10186885
555 Ga0207645_10279204
556 Ga0207707_10030861
557 Ga0207707_10105472
558 Ga0207660_10015876
559 Ga0207660_10127396
560 Ga0207660_10323774
561 Ga0207657_10005945
562 Ga0207657_10050190
563 Ga0207649_10345444
564 Ga0207646_10072049
565 Ga0207646_10470092
566 Ga0207681_10011617
567 Ga0207681_10052677
568 Ga0207650_10031665
569 Ga0207659_10001358
570 Ga0207659_10077881
571 Ga0207659_10080869
572 Ga0207659_10146918
573 Ga0207659_10469760
574 Ga0207644_10016341
575 Ga0207644_10409964
576 Ga0207706_10035538
577 Ga0207706_10110325
578 Ga0207706_10340887
579 Ga0207706_10364345
580 Ga0207686_10071086
581 Ga0207686_10179303
582 Ga0207709_10031486
583 Ga0207709_10143808
584 Ga0207709_10307870
585 Ga0207670_10070810
586 Ga0207670_10139111
587 Ga0207669_10005993
588 Ga0207711_10017574
589 Ga0207711_10019284
590 Ga0207711_10208306
591 Ga0207711_10555488
592 Ga0207689_10222050
593 Ga0207661_10202449
594 Ga0207667_10120333
595 Ga0207651_10067210
596 Ga0207651_10269777
597 Ga0207712_10242574
598 Ga0207668_10011441
599 Ga0207668_10023022
600 Ga0207640_10370665
601 Ga0207658_10351151
602 Ga0207677_10155681
603 Ga0207677_10185131
604 Ga0207703_10023920
605 Ga0207703_10037185
606 Ga0207703_10044737
607 Ga0207703_10386051
608 Ga0207703_10490404
609 Ga0207708_10029847
610 Ga0207641_10000870
611 Ga0207641_10158239
612 Ga0207641_10356250
613 Ga0207648_10008433
614 Ga0207648_10042300
615 Ga0207648_10318290
616 Ga0207676_10005066
617 Ga0207676_10051450
618 Ga0207676_10167648
619 Ga0207674_10271403
620 Ga0207674_10376918
621 Ga0207675_100003742
622 Ga0207675_100027753
623 Ga0207675_100403168
624 Ga0207675_100423146
625 Ga0207683_10217921
626 Ga0207683_10364947
627 Ga0207698_10122367
628 Ga0207428_10029598
629 Ga0207428_10086150
630 Ga0207428_10364015
631 Ga0268266_10040337
632 Ga0268266_10084540
633 Ga0268265_10085009
634 Ga0268264_10048107
635 Ga0268264_10522983
636 Ga0265332_10055647
637 Ga0265320_10087940
638 Ga0307408_100143646
639 Ga0307410_10039040
640 Ga0307416_100625967
641 Ga0373938_0012633
642 Ga0373944_0100497
643 Ga0373932_0030487
644 Ga0373957_0081116
645 Ga0373946_0111706
646 Ga0373962_0051105
647 Ga0373931_0177155
648 Ga0373935_0210788
649 Ga0373927_0173197
650 Ga0373947_0107415
651 Ga0373937_0244445
652 Ga0373925_0160825
653 Ga0495582_0127988
654 Ga0495628_0086489
655 Ga0495628_0129186
656 Ga0495586_0061788
657 Ga0495586_0137539
658 Ga0495587_0162047
659 Ga0495621_0002781
660 Ga0495634_0022869
661 Ga0495658_0014056
662 Ga0495658_0122116
663 Ga0495669_0002771
664 Ga0495669_0151690
665 Ga0495613_0163041
666 Ga0495674_0113476
667 Ga0495674_0404761
668 Ga0496100_0077705
669 Ga0496101_0000685
670 Ga0496101_0206991
671 Ga0496102_0118528
672 Ga0496102_0233259
673 Ga0496104_0001648
674 Ga0496104_0198789
675 Ga0496104_0204826
676 Ga0496104_0221347
677 Ga0496105_0006629
678 Ga0496105_0203461
679 Ga0496106_0105847
680 Ga0496107_0133782
681 Ga0496107_0321905
682 Ga0496108_0113688
683 Ga0496109_0163342
684 Ga0496110_0306992
685 Ga0496112_0012595
686 Ga0496112_0043934
687 Ga0496112_0294680
688 Ga0496114_0000504
689 Ga0496114_0009672
690 Ga0496114_0137054
691 Ga0496114_0238848
692 Ga0496114_0247892
693 Ga0496114_0322364
694 Ga0496115_0137888
695 Ga0501034_0219659
696 Ga0501036_0060150
697 Ga0501038_0178806
698 Ga0501042_0053228
699 Ga0501047_0164867
700 Ga0501048_0099980
701 Ga0501068_0240124
702 Ga0501071_0007258
703 Ga0501072_0042616
704 Ga0501073_0000250
705 Ga0501074_0084087
706 Ga0501075_0158714
707 Ga0501079_0029816
708 Ga0501079_0136381
709 Ga0501045_0074372
710 nmdc:mga0k408_168501_c1
711 nmdc:mga05p37_10193_c1
712 nmdc:mga05p37_201260_c1
713 nmdc:mga05p37_249655_c1
714 nmdc:mga05p37_34136_c1
715 nmdc:mga05p37_40625_c1
716 nmdc:mga05p37_46925_c1
717 nmdc:mga05p37_6056_c1
718 nmdc:mga09592_321708_c1
719 nmdc:mga06r32_14130_c1
720 nmdc:mga08y16_35539_c1
721 nmdc:mga08y16_410659_c1
722 nmdc:mga08y16_41328_c1
723 nmdc:mga08y16_5669_c1
724 nmdc:mga08y16_8390_c1
725 nmdc:mga0n895_18382_c1
726 nmdc:mga0n895_207780_c1
727 nmdc:mga0n895_403182_c1
728 nmdc:mga0n895_706823_c1
729 nmdc:mga0rr50_217891_c1
730 nmdc:mga0rr50_26949_c1
731 nmdc:mga0rr50_332280_c1
732 nmdc:mga0rr50_9732_c1
733 nmdc:mga08x19_15570_c1
734 nmdc:mga08x19_245843_c1
735 nmdc:mga08x19_6098_c1
736 nmdc:mga0a205_205827_c1
737 nmdc:mga0a205_491980_c1
738 nmdc:mga0a205_543719_c1
739 nmdc:mga0a205_90572_c1
740 Ga0495601_0007459
741 Ga0495595_0008423
742 Ga0495619_0005976
743 Ga0495619_0063175
744 Ga0500646_0011496
745 Ga0501084_0108451
746 Ga0501084_0125482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

29

271

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2buf-assembly2.cif.gz_L arginine feed-back inhibitable acetylglutamate kinase 0.8951 3 253
2buf-assembly2.cif.gz_I arginine feed-back inhibitable acetylglutamate kinase 0.8883 2 251
2buf-assembly1.cif.gz_B arginine feed-back inhibitable acetylglutamate kinase 0.886 2 252
2buf-assembly1.cif.gz_D arginine feed-back inhibitable acetylglutamate kinase 0.8806 2 253
2buf-assembly2.cif.gz_H arginine feed-back inhibitable acetylglutamate kinase 0.8777 2 249
ID Description Score Start End Superfamily
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8913 2 252 3.40.1160.10
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.862 2 252 3.40.1160.10
1uvdA00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8608 1 253 3.40.1160.10
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8558 2 252 3.40.1160.10
1uvdA00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8394 1 253 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A7V9I1I1-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9534 103 250 GO:0003991
GO:0006526
AF-A0A1Q7MYP5-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9462 1 254 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-A0A3N5GF55-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9367 1 252 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-A0A843SME8-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9357 2 216 GO:0003991
GO:0005737
GO:0006526
AF-A0A7V9I1I1-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9342 103 250 GO:0003991
GO:0006526

Map