F426324

General Info

Members Datasets Scaffolds Average Seq Length
373 211 367 408

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10035200|Ga0105240_100352002
Length 440
Sequence MVMVPYDLQHAPGPVNLGRSAIQEEMTTMRFAKAVLLLTLAPVVAGAQVNVGEQKPEDSLPFTMTTVTTFRLPWRLAFLPDGRMLITEKPGPVWLVTQKGEKIQIENTPKVYFQGQNGMMGIFLSPHYATDHNIYLTYVEPGDYGGGFALARARLKATDTSAALENFQVLWRQVPTGKGGQAGGPIAFTADGKYLFLAVGDRQRMTPAQDPDQPVGKILRLTLDGKPAPGNPNSGKTGAGTIPLIDPPRDTELAKTARVVSTYTFPGPNLTPSETWAVGVRTPYGMAFSPNGELWEVEHGPAGGDELNLIERGKNYGWPLVSYGNNYNRTPIPKPDTRPDLTKPVLYWVPVIAPGNLMFYHGTKTFPQWNGNGFISGLGSQTLNRIIFDGHGGAKTAERWKVGHRVRDVEEGPDGSLWMLEDASPGALIHVTPTAPSPKQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
3 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
4 2818991457 Xanthomonas translucens 569 Isolate Unclassified
5 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
6 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
7 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 2.68
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2195627 2162886007 Bacteria 5080
2 JGI24746J21847_1003705 3300001977 Bacteria 2414
3 Ga0065714_10085211 3300005288 Bacteria 2159
4 Ga0065704_10072362 3300005289 Bacteria 8666
5 Ga0065712_10071452 3300005290 Bacteria 5252
6 Ga0065715_10036957 3300005293 Bacteria 1309
7 Ga0070676_10001236 3300005328 Bacteria 12854
8 Ga0070676_10018368 3300005328 Bacteria 3875
9 Ga0070683_100000006 3300005329 Bacteria 361071
10 Ga0070683_100103667 3300005329 Bacteria 2681
11 Ga0070683_100106391 3300005329 Bacteria 2645
12 Ga0070670_100001128 3300005331 Bacteria 21227
13 Ga0070670_100032832 3300005331 Bacteria 4472
14 Ga0070677_10000083 3300005333 Bacteria 30149
15 Ga0070677_10011763 3300005333 Bacteria 3026
16 Ga0068869_100023655 3300005334 Bacteria 4248
17 Ga0068869_100036976 3300005334 Bacteria 3470
18 Ga0070666_10000843 3300005335 Bacteria 18607
19 Ga0070666_10012601 3300005335 Bacteria 5340
20 Ga0068868_100000990 3300005338 Bacteria 19365
21 Ga0068868_100005683 3300005338 Bacteria 8782
22 Ga0070687_100039235 3300005343 Bacteria 2378
23 Ga0070687_100056895 3300005343 Bacteria 2048
24 Ga0070661_100049093 3300005344 Bacteria 3090
25 Ga0070668_100001844 3300005347 Bacteria 15441
26 Ga0070668_100026564 3300005347 Bacteria 4394
27 Ga0070669_100021964 3300005353 Bacteria 4563
28 Ga0070669_100037272 3300005353 Bacteria 3527
29 Ga0070669_100052019 3300005353 Bacteria 2995
30 Ga0070675_100001140 3300005354 Bacteria 19177
31 Ga0070675_100002170 3300005354 Bacteria 14522
32 Ga0070675_100046965 3300005354 Bacteria 3537
33 Ga0070671_100004356 3300005355 Bacteria 11194
34 Ga0070671_100007411 3300005355 Bacteria 8769
35 Ga0070671_100174502 3300005355 Bacteria 1818
36 Ga0070674_100001028 3300005356 Bacteria 14573
37 Ga0070674_100001404 3300005356 Bacteria 12758
38 Ga0070674_100005360 3300005356 Bacteria 7395
39 Ga0070673_100000948 3300005364 Bacteria 16423
40 Ga0070673_100002258 3300005364 Bacteria 11678
41 Ga0070673_100061304 3300005364 Bacteria 2984
42 Ga0070688_100050798 3300005365 Bacteria 2584
43 Ga0070688_100085631 3300005365 Bacteria 2049
44 Ga0070659_100000593 3300005366 Bacteria 26524
45 Ga0070659_100183227 3300005366 Bacteria 1719
46 Ga0070667_100003406 3300005367 Bacteria 13540
47 Ga0070667_100006765 3300005367 Bacteria 9520
48 Ga0070714_100005505 3300005435 Bacteria 9666
49 Ga0070713_100001213 3300005436 Bacteria 16464
50 Ga0070701_10013326 3300005438 Bacteria 3737
51 Ga0070711_100005753 3300005439 Bacteria 7438
52 Ga0070694_100222277 3300005444 Bacteria 1417
53 Ga0070678_100001284 3300005456 Bacteria 13306
54 Ga0070678_100007849 3300005456 Bacteria 6350
55 Ga0070678_100008137 3300005456 Bacteria 6266
56 Ga0070678_100085439 3300005456 Bacteria 2404
57 Ga0070678_100128379 3300005456 Bacteria 2010
58 Ga0070662_100010328 3300005457 Bacteria 6121
59 Ga0070662_100024893 3300005457 Bacteria 4129
60 Ga0070681_10003684 3300005458 Bacteria 14374
61 Ga0068867_100002105 3300005459 Bacteria 13949
62 Ga0070685_10008217 3300005466 Bacteria 5353
63 Ga0070706_100289471 3300005467 Bacteria 1529
64 Ga0070707_100025682 3300005468 Bacteria 5592
65 Ga0070684_100000050 3300005535 Bacteria 78974
66 Ga0070684_100008044 3300005535 Bacteria 8232
67 Ga0068853_100026761 3300005539 Bacteria 4845
68 Ga0070672_100007854 3300005543 Bacteria 7280
69 Ga0070672_100011980 3300005543 Bacteria 6064
70 Ga0070672_100030488 3300005543 Bacteria 4052
71 Ga0070672_100031199 3300005543 Bacteria 4009
72 Ga0070686_100048840 3300005544 Bacteria 2682
73 Ga0070686_100066384 3300005544 Bacteria 2347
74 Ga0070696_100127379 3300005546 Bacteria 1849
75 Ga0070665_100017031 3300005548 Bacteria 7288
76 Ga0070665_100030841 3300005548 Bacteria 5396
77 Ga0070665_100078134 3300005548 Bacteria 3316
78 Ga0070665_100315156 3300005548 Bacteria 1568
79 Ga0068855_100075360 3300005563 Bacteria 3918
80 Ga0070664_100031258 3300005564 Bacteria 4447
81 Ga0068857_100230218 3300005577 Bacteria 1695
82 Ga0070702_100126437 3300005615 Bacteria 1608
83 Ga0068852_100051989 3300005616 Bacteria 3519
84 Ga0068859_100017888 3300005617 Bacteria 7125
85 Ga0068859_100020932 3300005617 Bacteria 6565
86 Ga0068859_100172649 3300005617 Bacteria 2243
87 Ga0068859_100246973 3300005617 Bacteria 1874
88 Ga0068864_100006403 3300005618 Bacteria 9649
89 Ga0068864_100024254 3300005618 Bacteria 5101
90 Ga0068866_10032626 3300005718 Bacteria 2520
91 Ga0068861_100047512 3300005719 Bacteria 3240
92 Ga0068851_10002671 3300005834 Bacteria 7857
93 Ga0068863_100008212 3300005841 Bacteria 10202
94 Ga0068863_100014720 3300005841 Bacteria 7528
95 Ga0068863_100027123 3300005841 Bacteria 5463
96 Ga0068858_100013929 3300005842 Bacteria 7585
97 Ga0068858_100020510 3300005842 Bacteria 6177
98 Ga0068858_100132648 3300005842 Bacteria 2336
99 Ga0068860_100020374 3300005843 Bacteria 6423
100 Ga0068860_100043907 3300005843 Bacteria 4262
101 Ga0068860_100342734 3300005843 Bacteria 1469
102 Ga0068862_100021988 3300005844 Bacteria 5334
103 Ga0081455_10000803 3300005937 Bacteria 40440
104 Ga0081540_1043278 3300005983 Bacteria 2312
105 Ga0081539_10007806 3300005985 Bacteria 9573
106 Ga0075367_10001835 3300006178 Bacteria 9365
107 Ga0075366_10001821 3300006195 Bacteria 10767
108 Ga0097621_100084078 3300006237 Bacteria 2652
109 Ga0068871_100007878 3300006358 Bacteria 7637
110 Ga0068871_100045392 3300006358 Bacteria 3537
111 Ga0068871_100058917 3300006358 Bacteria 3128
112 Ga0068871_100090117 3300006358 Bacteria 2554
113 Ga0068871_100125344 3300006358 Bacteria 2173
114 Ga0075428_100292948 3300006844 Bacteria 1750
115 Ga0075431_100055249 3300006847 Bacteria 4095
116 Ga0075431_100145734 3300006847 Bacteria 2440
117 Ga0075431_100188106 3300006847 Bacteria 2116
118 Ga0075433_10006128 3300006852 Bacteria 9471
119 Ga0075434_100214561 3300006871 Bacteria 1944
120 Ga0075429_100147144 3300006880 Bacteria 2062
121 Ga0068865_100012000 3300006881 Bacteria 5443
122 Ga0068865_100015830 3300006881 Bacteria 4814
123 Ga0068865_100041684 3300006881 Bacteria 3126
124 Ga0097620_100017888 3300006931 Bacteria 7125
125 Ga0097620_100020932 3300006931 Bacteria 6565
126 Ga0097620_100172652 3300006931 Bacteria 2243
127 Ga0097620_100246956 3300006931 Bacteria 1874
128 Ga0075435_100024984 3300007076 Bacteria 4645
129 Ga0105240_10001065 3300009093 Bacteria 48581
130 Ga0105240_10002115 3300009093 Bacteria 32484
131 Ga0105240_10035200 3300009093 Bacteria 6454
132 Ga0105240_10063433 3300009093 Bacteria 4596
133 Ga0111539_10001245 3300009094 Bacteria 33905
134 Ga0111539_10006856 3300009094 Bacteria 14635
135 Ga0111539_10008175 3300009094 Bacteria 13327
136 Ga0111539_10016105 3300009094 Bacteria 9277
137 Ga0111539_10057584 3300009094 Bacteria 4614
138 Ga0111539_10086943 3300009094 Bacteria 3673
139 Ga0111539_10123246 3300009094 Bacteria 3038
140 Ga0111539_10143275 3300009094 Bacteria 2797
141 Ga0114129_10166435 3300009147 Bacteria 3008
142 Ga0105248_10003489 3300009177 Bacteria 17450
143 Ga0105248_10075109 3300009177 Bacteria 3799
144 Ga0105248_10076536 3300009177 Bacteria 3761
145 Ga0105248_10490111 3300009177 Bacteria 1385
146 Ga0105237_10007563 3300009545 Bacteria 11875
147 Ga0105249_10033524 3300009553 Bacteria 4649
148 Ga0105249_10051617 3300009553 Bacteria 3752
149 Ga0105249_10226294 3300009553 Bacteria 1843
150 Ga0105239_10007828 3300010375 Bacteria 12220
151 Ga0157370_10000371 3300013104 Bacteria 56531
152 Ga0157369_10143849 3300013105 Bacteria 2522
153 Ga0157369_10418626 3300013105 Bacteria 1389
154 Ga0157374_10048683 3300013296 Bacteria 3934
155 Ga0157378_10004200 3300013297 Bacteria 12715
156 Ga0157378_10095402 3300013297 Bacteria 2709
157 Ga0157378_10197871 3300013297 Bacteria 1899
158 Ga0163162_10016406 3300013306 Bacteria 7238
159 Ga0163162_10031297 3300013306 Bacteria 5277
160 Ga0157375_10057450 3300013308 Bacteria 3846
161 Ga0157375_10061141 3300013308 Bacteria 3739
162 Ga0163163_10251010 3300014325 Bacteria 1820
163 Ga0157380_10100979 3300014326 Bacteria 2403
164 Ga0157379_10011587 3300014968 Bacteria 7699
165 Ga0157379_10018047 3300014968 Bacteria 6219
166 Ga0157376_10016232 3300014969 Bacteria 5646
167 Ga0157376_10142208 3300014969 Bacteria 2154
168 Ga0182005_1007508 3300015265 Bacteria 3267
169 Ga0163161_10014776 3300017792 Bacteria 5439
170 Ga0163161_10067906 3300017792 Bacteria 2604
171 Ga0207697_10010993 3300025315 Bacteria 3843
172 Ga0207697_10011854 3300025315 Bacteria 3674
173 Ga0207697_10024271 3300025315 Bacteria 2483
174 Ga0207656_10002527 3300025321 Bacteria 6181
175 Ga0207713_1008319 3300025735 Bacteria 5989
176 Ga0207682_10000116 3300025893 Bacteria 36921
177 Ga0207688_10020053 3300025901 Bacteria 3647
178 Ga0207680_10008072 3300025903 Bacteria 5157
179 Ga0207680_10043416 3300025903 Bacteria 2636
180 Ga0207645_10000204 3300025907 Bacteria 48370
181 Ga0207645_10002117 3300025907 Bacteria 15889
182 Ga0207645_10041619 3300025907 Bacteria 2940
183 Ga0207643_10000423 3300025908 Bacteria 27902
184 Ga0207695_10000895 3300025913 Bacteria 53944
185 Ga0207695_10006283 3300025913 Bacteria 15462
186 Ga0207695_10108991 3300025913 Bacteria 2752
187 Ga0207671_10013300 3300025914 Bacteria 6563
188 Ga0207662_10011148 3300025918 Bacteria 4975
189 Ga0207649_10028559 3300025920 Bacteria 3285
190 Ga0207649_10110617 3300025920 Bacteria 1834
191 Ga0207646_10023911 3300025922 Bacteria 5606
192 Ga0207646_10028121 3300025922 Bacteria 5121
193 Ga0207681_10011025 3300025923 Bacteria 5551
194 Ga0207681_10018122 3300025923 Bacteria 4432
195 Ga0207681_10020383 3300025923 Bacteria 4201
196 Ga0207694_10057428 3300025924 Bacteria 3025
197 Ga0207650_10005973 3300025925 Bacteria 8309
198 Ga0207659_10011399 3300025926 Bacteria 5615
199 Ga0207659_10027020 3300025926 Bacteria 3880
200 Ga0207659_10036054 3300025926 Bacteria 3423
201 Ga0207700_10001814 3300025928 Bacteria 12133
202 Ga0207700_10223561 3300025928 Bacteria 1597
203 Ga0207664_10015617 3300025929 Bacteria 5518
204 Ga0207644_10003529 3300025931 Bacteria 10125
205 Ga0207644_10011714 3300025931 Bacteria 5805
206 Ga0207706_10017048 3300025933 Bacteria 6551
207 Ga0207706_10041210 3300025933 Bacteria 4094
208 Ga0207706_10199443 3300025933 Bacteria 1755
209 Ga0207709_10024683 3300025935 Bacteria 3435
210 Ga0207669_10002734 3300025937 Bacteria 7560
211 Ga0207669_10004305 3300025937 Bacteria 6257
212 Ga0207704_10002643 3300025938 Bacteria 8087
213 Ga0207704_10109104 3300025938 Bacteria 1866
214 Ga0207704_10122282 3300025938 Bacteria 1784
215 Ga0207691_10000050 3300025940 Bacteria 94763
216 Ga0207691_10000428 3300025940 Bacteria 41817
217 Ga0207691_10013794 3300025940 Bacteria 7719
218 Ga0207691_10017941 3300025940 Bacteria 6704
219 Ga0207689_10007968 3300025942 Bacteria 9254
220 Ga0207689_10018268 3300025942 Bacteria 5918
221 Ga0207689_10028146 3300025942 Bacteria 4700
222 Ga0207689_10036030 3300025942 Bacteria 4108
223 Ga0207661_10000011 3300025944 Bacteria 361200
224 Ga0207661_10023561 3300025944 Bacteria 4653
225 Ga0207661_10080210 3300025944 Bacteria 2692
226 Ga0207679_10012171 3300025945 Bacteria 5602
227 Ga0207679_10078377 3300025945 Bacteria 2517
228 Ga0207679_10139473 3300025945 Bacteria 1958
229 Ga0207651_10004198 3300025960 Bacteria 7216
230 Ga0207651_10114214 3300025960 Bacteria 2033
231 Ga0207651_10151319 3300025960 Bacteria 1807
232 Ga0207712_10018265 3300025961 Bacteria 4566
233 Ga0207668_10009794 3300025972 Bacteria 5757
234 Ga0207658_10018409 3300025986 Bacteria 4822
235 Ga0207658_10118957 3300025986 Bacteria 2102
236 Ga0207677_10081378 3300026023 Bacteria 2324
237 Ga0207677_10209274 3300026023 Bacteria 1556
238 Ga0207639_10025521 3300026041 Bacteria 4285
239 Ga0207678_10053806 3300026067 Bacteria 3468
240 Ga0207708_10026727 3300026075 Bacteria 4369
241 Ga0207702_10175511 3300026078 Bacteria 1969
242 Ga0207641_10007786 3300026088 Bacteria 8902
243 Ga0207641_10010899 3300026088 Bacteria 7449
244 Ga0207641_10012868 3300026088 Bacteria 6862
245 Ga0207641_10020046 3300026088 Bacteria 5491
246 Ga0207641_10101735 3300026088 Bacteria 2533
247 Ga0207648_10000251 3300026089 Bacteria 58026
248 Ga0207648_10001093 3300026089 Bacteria 30397
249 Ga0207648_10021209 3300026089 Bacteria 5841
250 Ga0207648_10110347 3300026089 Bacteria 2415
251 Ga0207676_10010459 3300026095 Bacteria 6609
252 Ga0207676_10035271 3300026095 Bacteria 3795
253 Ga0207676_10114651 3300026095 Bacteria 2261
254 Ga0207675_100009141 3300026118 Bacteria 9294
255 Ga0207675_100052860 3300026118 Bacteria 3790
256 Ga0207675_100087355 3300026118 Bacteria 2928
257 Ga0207683_10000278 3300026121 Bacteria 45668
258 Ga0207683_10001841 3300026121 Bacteria 18746
259 Ga0207683_10003108 3300026121 Bacteria 14507
260 Ga0207683_10003689 3300026121 Bacteria 13304
261 Ga0207683_10027064 3300026121 Bacteria 4956
262 Ga0207683_10157039 3300026121 Bacteria 2055
263 Ga0207698_10144994 3300026142 Bacteria 2052
264 Ga0207698_10243733 3300026142 Bacteria 1640
265 Ga0209371_1000209 3300027312 Bacteria 81879
266 Ga0207428_10000412 3300027907 Bacteria 53243
267 Ga0207428_10000814 3300027907 Bacteria 35226
268 Ga0207428_10018926 3300027907 Bacteria 5873
269 Ga0207428_10080393 3300027907 Bacteria 2547
270 Ga0207428_10189812 3300027907 Bacteria 1549
271 Ga0268266_10003348 3300028379 Bacteria 16048
272 Ga0268266_10110175 3300028379 Bacteria 2438
273 Ga0268265_10051505 3300028380 Bacteria 3108
274 Ga0268264_10006113 3300028381 Bacteria 10173
275 Ga0268264_10038637 3300028381 Bacteria 3940
276 Ga0268264_10237359 3300028381 Bacteria 1687
277 Ga0268256_1000167 3300030500 Bacteria 81875
278 Ga0265316_10001628 3300031344 Bacteria 23917
279 Ga0307510_10000038 3300033180 Bacteria 106256
280 Ga0373931_0213644 3300035691 Bacteria 1158
281 Ga0373935_0023803 3300035692 Bacteria 3763
282 Ga0373927_0006701 3300035695 Bacteria 7837
283 Ga0373927_0007018 3300035695 Bacteria 7646
284 Ga0373947_0002213 3300035725 Bacteria 11776
285 Ga0373947_0025020 3300035725 Bacteria 3481
286 Ga0373937_0019724 3300036401 Bacteria 6039
287 Ga0373937_0027591 3300036401 Bacteria 5136
288 Ga0373925_0002263 3300037068 Bacteria 15582
289 Ga0451804_1106456 3300041463 Bacteria 4636
290 Ga0451807_1661108 3300041486 Bacteria 4744
291 Ga0439464_0042467 3300042439 Bacteria 1298
292 Ga0466957_0035730 3300044842 Bacteria 2983
293 Ga0451576_0104561 3300045051 Bacteria 2946
294 Ga0466958_0050393 3300045836 Bacteria 2521
295 Ga0495651_0014734 3300046462 Bacteria 6046
296 Ga0495580_0067660 3300046472 Bacteria 2499
297 Ga0495662_0054099 3300046476 Bacteria 1939
298 Ga0495664_0001156 3300046477 Bacteria 13718
299 Ga0495664_0107867 3300046477 Bacteria 1680
300 Ga0495585_0000001 3300046492 Bacteria 609804
301 Ga0495606_0000150 3300046507 Bacteria 119726
302 Ga0495630_0040095 3300046517 Bacteria 3499
303 Ga0495631_0000115 3300046518 Bacteria 53939
304 Ga0495648_0003098 3300046524 Bacteria 14841
305 Ga0495640_0109108 3300046533 Bacteria 1810
306 Ga0495640_0146644 3300046533 Bacteria 1518
307 Ga0495645_0014579 3300046543 Bacteria 5580
308 Ga0495645_0021115 3300046543 Bacteria 4706
309 Ga0495667_0054823 3300046559 Bacteria 2622
310 Ga0495667_0071204 3300046559 Bacteria 2268
311 Ga0495661_0000098 3300046665 Bacteria 106670
312 Ga0495657_0146326 3300046675 Bacteria 1470
313 Ga0495599_0014845 3300046678 Bacteria 4824
314 Ga0495658_0210461 3300046683 Bacteria 1215
315 Ga0495613_0026549 3300046689 Bacteria 4313
316 Ga0495670_0088644 3300046691 Bacteria 1581
317 Ga0495674_0000776 3300047319 Bacteria 30376
318 Ga0495675_0013902 3300047444 Bacteria 5089
319 Ga0495675_0041730 3300047444 Bacteria 2924
320 Ga0495684_0002096 3300047471 Bacteria 16007
321 Ga0495684_0037828 3300047471 Bacteria 3701
322 Ga0495686_0000019 3300047472 Bacteria 434054
323 Ga0495602_0203238 3300048088 Bacteria 1510
324 Ga0496101_0013435 3300048904 Bacteria 5486
325 Ga0496105_0102215 3300048908 Bacteria 2367
326 Ga0496109_0000231 3300048912 Bacteria 54570
327 Ga0496109_0006188 3300048912 Bacteria 10061
328 Ga0496109_0259872 3300048912 Bacteria 1636
329 Ga0496112_0000561 3300048915 Bacteria 25482
330 Ga0496112_0203411 3300048915 Bacteria 1939
331 Ga0496114_0000696 3300048917 Bacteria 25022
332 Ga0496117_0004256 3300048920 Bacteria 15974
333 Ga0496118_0000469 3300048921 Bacteria 67113
334 Ga0496118_0057143 3300048921 Bacteria 2928
335 Ga0496119_0000681 3300048922 Bacteria 45369
336 Ga0496120_0000674 3300048923 Bacteria 50098
337 Ga0496122_0001602 3300048925 Bacteria 35406
338 Ga0496123_0001307 3300048926 Bacteria 35406
339 Ga0496124_0026667 3300048927 Bacteria 5207
340 Ga0496126_0006469 3300048929 Bacteria 13052
341 Ga0496126_0026619 3300048929 Bacteria 5542
342 Ga0495682_0001339 3300049460 Bacteria 13615
343 Ga0501032_0004661 3300049569 Bacteria 10302
344 Ga0501047_0281108 3300049581 Bacteria 1509
345 Ga0501076_0185421 3300049592 Bacteria 1697
346 nmdc:mga03n38_8338_c1 3300050490 Bacteria 3715
347 nmdc:mga00v17_168944_c1 3300050491 Bacteria 1410
348 nmdc:mga0yw44_67461_c1 3300050492 Bacteria 2211
349 nmdc:mga06z11_1113_c1 3300050494 Bacteria 9779
350 nmdc:mga09592_177529_c1 3300050508 Bacteria 1842
351 nmdc:mga09592_211535_c1 3300050508 Bacteria 1680
352 nmdc:mga09592_34007_c1 3300050508 Bacteria 4260
353 nmdc:mga0qj67_3196_c1 3300050509 Bacteria 11795
354 nmdc:mga06r32_117979_c1 3300050510 Bacteria 2616
355 nmdc:mga06r32_5868_c1 3300050510 Bacteria 11049
356 nmdc:mga08y16_127883_c1 3300050511 Bacteria 2643
357 nmdc:mga08y16_202203_c1 3300050511 Bacteria 2059
358 nmdc:mga08y16_21389_c1 3300050511 Bacteria 6832
359 nmdc:mga08y16_23981_c1 3300050511 Bacteria 6444
360 nmdc:mga08y16_250037_c1 3300050511 Bacteria 1832
361 nmdc:mga08y16_482_c1 3300050511 Bacteria 36840
362 nmdc:mga08y16_73301_c1 3300050511 Bacteria 3568
363 nmdc:mga0a205_182667_c1 3300050515 Bacteria 1991
364 nmdc:mga0a205_31573_c1 3300050515 Bacteria 5075
365 Ga0500641_0023194 3300053096 Bacteria 2384
366 Ga0500645_000597 3300053730 Bacteria 23163
367 Ga0501082_0000022 3300060353 Bacteria 105710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10123246 Ga0111539_101232463 358
2 3300035691 Ga0373931_0213644 Ga0373931_0213644_52_1146 358
3 3300005331 Ga0070670_100032832 Ga0070670_1000328324 360
4 3300046683 Ga0495658_0210461 Ga0495658_0210461_45_1181 370
5 3300005329 Ga0070683_100106391 Ga0070683_1001063912 385
6 3300005535 Ga0070684_100008044 Ga0070684_1000080448 385
7 3300025944 Ga0207661_10023561 Ga0207661_100235612 385
8 3300025945 Ga0207679_10139473 Ga0207679_101394732 385
9 3300046507 Ga0495606_0000150 Ga0495606_0000150_41108_42334 392
10 3300046691 Ga0495670_0088644 Ga0495670_0088644_295_1521 392
11 3300005355 Ga0070671_100007411 Ga0070671_1000074117 395
12 3300009147 Ga0114129_10166435 Ga0114129_101664352 395
13 3300013297 Ga0157378_10004200 Ga0157378_100042002 395
14 3300025931 Ga0207644_10003529 Ga0207644_100035298 395
15 3300048912 Ga0496109_0006188 Ga0496109_0006188_4512_5738 395
16 3300050515 nmdc:mga0a205_182667_c1 nmdc:mga0a205_182667_c1_299_1525 395
17 3300005467 Ga0070706_100289471 Ga0070706_1002894712 396
18 3300005577 Ga0068857_100230218 Ga0068857_1002302182 396
19 3300005617 Ga0068859_100172649 Ga0068859_1001726492 396
20 3300006931 Ga0097620_100172652 Ga0097620_1001726522 396
21 3300026078 Ga0207702_10175511 Ga0207702_101755111 396
22 3300028380 Ga0268265_10051505 Ga0268265_100515052 396
23 3300005288 Ga0065714_10085211 Ga0065714_100852111 397
24 3300005290 Ga0065712_10071452 Ga0065712_100714522 397
25 3300005334 Ga0068869_100036976 Ga0068869_1000369763 397
26 3300005457 Ga0070662_100024893 Ga0070662_1000248933 397
27 3300025933 Ga0207706_10041210 Ga0207706_100412103 397
28 3300009553 Ga0105249_10033524 Ga0105249_100335242 398
29 3300025944 Ga0207661_10000011 Ga0207661_10000011153 398
30 3300005841 Ga0068863_100014720 Ga0068863_1000147204 402
31 3300009094 Ga0111539_10016105 Ga0111539_100161059 402
32 3300026088 Ga0207641_10020046 Ga0207641_100200463 402
33 3300027907 Ga0207428_10189812 Ga0207428_101898121 402
34 3300050511 nmdc:mga08y16_21389_c1 nmdc:mga08y16_21389_c1_479_1708 402
35 iso_pu_bacteria 2643221685 2644476779 402
36 iso_pu_bacteria 2818991440 2819562738 402
37 iso_pu_bacteria 2818991457 2819663312 402
38 iso_pu_bacteria 2852684882 2852688249 402
39 iso_pu_bacteria 2884338543 2884340515 402
40 iso_pu_bacteria 2904463128 2904463348 402
41 3300005985 Ga0081539_10007806 Ga0081539_100078067 403
42 3300035695 Ga0373927_0007018 Ga0373927_0007018_4301_5518 403
43 3300005468 Ga0070707_100025682 Ga0070707_1000256822 404
44 3300005937 Ga0081455_10000803 Ga0081455_1000080332 404
45 3300005983 Ga0081540_1043278 Ga0081540_10432784 404
46 3300006844 Ga0075428_100292948 Ga0075428_1002929481 404
47 3300006847 Ga0075431_100188106 Ga0075431_1001881062 404
48 3300013297 Ga0157378_10197871 Ga0157378_101978712 404
49 3300025922 Ga0207646_10023911 Ga0207646_100239119 404
50 3300027907 Ga0207428_10018926 Ga0207428_100189266 404
51 3300001977 JGI24746J21847_1003705 JGI24746J21847_10037052 405
52 3300005293 Ga0065715_10036957 Ga0065715_100369571 405
53 3300005328 Ga0070676_10018368 Ga0070676_100183685 405
54 3300005329 Ga0070683_100000006 Ga0070683_100000006152 405
55 3300005329 Ga0070683_100103667 Ga0070683_1001036672 405
56 3300005333 Ga0070677_10011763 Ga0070677_100117631 405
57 3300005334 Ga0068869_100023655 Ga0068869_1000236553 405
58 3300005343 Ga0070687_100056895 Ga0070687_1000568952 405
59 3300005344 Ga0070661_100049093 Ga0070661_1000490934 405
60 3300005353 Ga0070669_100037272 Ga0070669_1000372722 405
61 3300005354 Ga0070675_100046965 Ga0070675_1000469653 405
62 3300005355 Ga0070671_100174502 Ga0070671_1001745022 405
63 3300005356 Ga0070674_100005360 Ga0070674_1000053601 405
64 3300005364 Ga0070673_100061304 Ga0070673_1000613044 405
65 3300005365 Ga0070688_100050798 Ga0070688_1000507983 405
66 3300005366 Ga0070659_100183227 Ga0070659_1001832272 405
67 3300005435 Ga0070714_100005505 Ga0070714_1000055057 405
68 3300005436 Ga0070713_100001213 Ga0070713_1000012132 405
69 3300005438 Ga0070701_10013326 Ga0070701_100133262 405
70 3300005439 Ga0070711_100005753 Ga0070711_1000057537 405
71 3300005456 Ga0070678_100007849 Ga0070678_1000078495 405
72 3300005456 Ga0070678_100128379 Ga0070678_1001283792 405
73 3300005457 Ga0070662_100010328 Ga0070662_1000103284 405
74 3300005466 Ga0070685_10008217 Ga0070685_100082175 405
75 3300005535 Ga0070684_100000050 Ga0070684_10000005048 405
76 3300005543 Ga0070672_100030488 Ga0070672_1000304884 405
77 3300005544 Ga0070686_100048840 Ga0070686_1000488402 405
78 3300005546 Ga0070696_100127379 Ga0070696_1001273791 405
79 3300005548 Ga0070665_100078134 Ga0070665_1000781341 405
80 3300005563 Ga0068855_100075360 Ga0068855_1000753601 405
81 3300005564 Ga0070664_100031258 Ga0070664_1000312584 405
82 3300005617 Ga0068859_100020932 Ga0068859_1000209323 405
83 3300005841 Ga0068863_100027123 Ga0068863_1000271233 405
84 3300005842 Ga0068858_100020510 Ga0068858_1000205103 405
85 3300006237 Ga0097621_100084078 Ga0097621_1000840784 405
86 3300006358 Ga0068871_100090117 Ga0068871_1000901172 405
87 3300006358 Ga0068871_100125344 Ga0068871_1001253444 405
88 3300006847 Ga0075431_100145734 Ga0075431_1001457342 405
89 3300006852 Ga0075433_10006128 Ga0075433_100061285 405
90 3300006871 Ga0075434_100214561 Ga0075434_1002145612 405
91 3300006880 Ga0075429_100147144 Ga0075429_1001471442 405
92 3300006881 Ga0068865_100041684 Ga0068865_1000416845 405
93 3300006931 Ga0097620_100020932 Ga0097620_1000209323 405
94 3300007076 Ga0075435_100024984 Ga0075435_1000249845 405
95 3300009094 Ga0111539_10057584 Ga0111539_100575842 405
96 3300009177 Ga0105248_10075109 Ga0105248_100751092 405
97 3300009177 Ga0105248_10076536 Ga0105248_100765365 405
98 3300009545 Ga0105237_10007563 Ga0105237_100075632 405
99 3300010375 Ga0105239_10007828 Ga0105239_100078285 405
100 3300013105 Ga0157369_10143849 Ga0157369_101438491 405
101 3300013105 Ga0157369_10418626 Ga0157369_104186261 405
102 3300013306 Ga0163162_10031297 Ga0163162_100312975 405
103 3300014325 Ga0163163_10251010 Ga0163163_102510102 405
104 3300014968 Ga0157379_10018047 Ga0157379_100180473 405
105 3300017792 Ga0163161_10067906 Ga0163161_100679062 405
106 3300025315 Ga0207697_10011854 Ga0207697_100118542 405
107 3300025315 Ga0207697_10024271 Ga0207697_100242712 405
108 3300025901 Ga0207688_10020053 Ga0207688_100200532 405
109 3300025907 Ga0207645_10041619 Ga0207645_100416195 405
110 3300025908 Ga0207643_10000423 Ga0207643_1000042317 405
111 3300025913 Ga0207695_10006283 Ga0207695_100062838 405
112 3300025914 Ga0207671_10013300 Ga0207671_100133002 405
113 3300025920 Ga0207649_10028559 Ga0207649_100285592 405
114 3300025923 Ga0207681_10011025 Ga0207681_100110253 405
115 3300025926 Ga0207659_10011399 Ga0207659_100113992 405
116 3300025928 Ga0207700_10001814 Ga0207700_100018148 405
117 3300025928 Ga0207700_10223561 Ga0207700_102235611 405
118 3300025929 Ga0207664_10015617 Ga0207664_100156171 405
119 3300025933 Ga0207706_10017048 Ga0207706_100170485 405
120 3300025937 Ga0207669_10002734 Ga0207669_100027349 405
121 3300025938 Ga0207704_10109104 Ga0207704_101091041 405
122 3300025938 Ga0207704_10122282 Ga0207704_101222822 405
123 3300025940 Ga0207691_10017941 Ga0207691_100179412 405
124 3300025942 Ga0207689_10007968 Ga0207689_100079683 405
125 3300025942 Ga0207689_10018268 Ga0207689_100182682 405
126 3300025942 Ga0207689_10036030 Ga0207689_100360303 405
127 3300025944 Ga0207661_10080210 Ga0207661_100802102 405
128 3300025945 Ga0207679_10012171 Ga0207679_100121715 405
129 3300025960 Ga0207651_10114214 Ga0207651_101142142 405
130 3300025961 Ga0207712_10018265 Ga0207712_100182655 405
131 3300026023 Ga0207677_10209274 Ga0207677_102092741 405
132 3300026088 Ga0207641_10007786 Ga0207641_100077864 405
133 3300026089 Ga0207648_10110347 Ga0207648_101103472 405
134 3300026095 Ga0207676_10114651 Ga0207676_101146512 405
135 3300026118 Ga0207675_100009141 Ga0207675_1000091416 405
136 3300026121 Ga0207683_10003108 Ga0207683_100031082 405
137 3300026121 Ga0207683_10027064 Ga0207683_100270643 405
138 3300026142 Ga0207698_10144994 Ga0207698_101449942 405
139 3300026142 Ga0207698_10243733 Ga0207698_102437332 405
140 3300027907 Ga0207428_10080393 Ga0207428_100803932 405
141 3300031344 Ga0265316_10001628 Ga0265316_100016282 405
142 3300035692 Ga0373935_0023803 Ga0373935_0023803_1069_2292 405
143 3300035695 Ga0373927_0006701 Ga0373927_0006701_5681_6904 405
144 3300035725 Ga0373947_0002213 Ga0373947_0002213_5796_7019 405
145 3300037068 Ga0373925_0002263 Ga0373925_0002263_11961_13184 405
146 3300045051 Ga0451576_0104561 Ga0451576_0104561_772_2007 405
147 3300046462 Ga0495651_0014734 Ga0495651_0014734_4663_5898 405
148 3300046476 Ga0495662_0054099 Ga0495662_0054099_514_1749 405
149 3300046477 Ga0495664_0001156 Ga0495664_0001156_9608_10843 405
150 3300046477 Ga0495664_0107867 Ga0495664_0107867_353_1588 405
151 3300046517 Ga0495630_0040095 Ga0495630_0040095_2016_3251 405
152 3300046533 Ga0495640_0109108 Ga0495640_0109108_292_1527 405
153 3300046533 Ga0495640_0146644 Ga0495640_0146644_268_1503 405
154 3300046543 Ga0495645_0014579 Ga0495645_0014579_986_2221 405
155 3300046543 Ga0495645_0021115 Ga0495645_0021115_684_1919 405
156 3300046559 Ga0495667_0054823 Ga0495667_0054823_543_1778 405
157 3300046559 Ga0495667_0071204 Ga0495667_0071204_633_1868 405
158 3300046675 Ga0495657_0146326 Ga0495657_0146326_31_1251 405
159 3300046678 Ga0495599_0014845 Ga0495599_0014845_3103_4338 405
160 3300047319 Ga0495674_0000776 Ga0495674_0000776_4188_5423 405
161 3300047444 Ga0495675_0013902 Ga0495675_0013902_950_2185 405
162 3300047444 Ga0495675_0041730 Ga0495675_0041730_1234_2493 405
163 3300047471 Ga0495684_0002096 Ga0495684_0002096_14041_15276 405
164 3300047471 Ga0495684_0037828 Ga0495684_0037828_2201_3436 405
165 3300048088 Ga0495602_0203238 Ga0495602_0203238_76_1311 405
166 3300049592 Ga0501076_0185421 Ga0501076_0185421_192_1415 405
167 3300050508 nmdc:mga09592_177529_c1 nmdc:mga09592_177529_c1_49_1284 405
168 3300050511 nmdc:mga08y16_202203_c1 nmdc:mga08y16_202203_c1_559_1794 405
169 3300060353 Ga0501082_0000022 Ga0501082_0000022_29819_31042 405
170 3300005289 Ga0065704_10072362 Ga0065704_100723624 406
171 3300005328 Ga0070676_10001236 Ga0070676_1000123612 406
172 3300005331 Ga0070670_100001128 Ga0070670_1000011283 406
173 3300005333 Ga0070677_10000083 Ga0070677_1000008318 406
174 3300005335 Ga0070666_10000843 Ga0070666_1000084322 406
175 3300005335 Ga0070666_10012601 Ga0070666_100126012 406
176 3300005338 Ga0068868_100000990 Ga0068868_1000009904 406
177 3300005338 Ga0068868_100005683 Ga0068868_1000056833 406
178 3300005343 Ga0070687_100039235 Ga0070687_1000392352 406
179 3300005347 Ga0070668_100001844 Ga0070668_1000018442 406
180 3300005347 Ga0070668_100026564 Ga0070668_1000265643 406
181 3300005353 Ga0070669_100021964 Ga0070669_1000219642 406
182 3300005353 Ga0070669_100052019 Ga0070669_1000520191 406
183 3300005354 Ga0070675_100001140 Ga0070675_10000114015 406
184 3300005354 Ga0070675_100002170 Ga0070675_10000217012 406
185 3300005355 Ga0070671_100004356 Ga0070671_1000043567 406
186 3300005356 Ga0070674_100001028 Ga0070674_1000010287 406
187 3300005356 Ga0070674_100001404 Ga0070674_1000014049 406
188 3300005364 Ga0070673_100000948 Ga0070673_1000009488 406
189 3300005364 Ga0070673_100002258 Ga0070673_1000022587 406
190 3300005365 Ga0070688_100085631 Ga0070688_1000856312 406
191 3300005366 Ga0070659_100000593 Ga0070659_10000059328 406
192 3300005367 Ga0070667_100003406 Ga0070667_1000034065 406
193 3300005367 Ga0070667_100006765 Ga0070667_1000067658 406
194 3300005444 Ga0070694_100222277 Ga0070694_1002222771 406
195 3300005456 Ga0070678_100001284 Ga0070678_1000012845 406
196 3300005456 Ga0070678_100008137 Ga0070678_1000081371 406
197 3300005456 Ga0070678_100085439 Ga0070678_1000854392 406
198 3300005458 Ga0070681_10003684 Ga0070681_100036849 406
199 3300005459 Ga0068867_100002105 Ga0068867_1000021055 406
200 3300005539 Ga0068853_100026761 Ga0068853_1000267612 406
201 3300005543 Ga0070672_100007854 Ga0070672_10000785410 406
202 3300005543 Ga0070672_100011980 Ga0070672_1000119803 406
203 3300005543 Ga0070672_100031199 Ga0070672_1000311993 406
204 3300005544 Ga0070686_100066384 Ga0070686_1000663842 406
205 3300005548 Ga0070665_100030841 Ga0070665_1000308412 406
206 3300005548 Ga0070665_100315156 Ga0070665_1003151562 406
207 3300005615 Ga0070702_100126437 Ga0070702_1001264371 406
208 3300005616 Ga0068852_100051989 Ga0068852_1000519893 406
209 3300005617 Ga0068859_100017888 Ga0068859_1000178882 406
210 3300005617 Ga0068859_100246973 Ga0068859_1002469732 406
211 3300005618 Ga0068864_100006403 Ga0068864_1000064036 406
212 3300005618 Ga0068864_100024254 Ga0068864_1000242548 406
213 3300005718 Ga0068866_10032626 Ga0068866_100326262 406
214 3300005719 Ga0068861_100047512 Ga0068861_1000475122 406
215 3300005834 Ga0068851_10002671 Ga0068851_100026712 406
216 3300005841 Ga0068863_100008212 Ga0068863_1000082129 406
217 3300005842 Ga0068858_100013929 Ga0068858_1000139299 406
218 3300005842 Ga0068858_100132648 Ga0068858_1001326482 406
219 3300005843 Ga0068860_100020374 Ga0068860_1000203742 406
220 3300005843 Ga0068860_100043907 Ga0068860_1000439074 406
221 3300005843 Ga0068860_100342734 Ga0068860_1003427342 406
222 3300005844 Ga0068862_100021988 Ga0068862_1000219886 406
223 3300006178 Ga0075367_10001835 Ga0075367_100018355 406
224 3300006195 Ga0075366_10001821 Ga0075366_100018213 406
225 3300006358 Ga0068871_100007878 Ga0068871_1000078786 406
226 3300006358 Ga0068871_100058917 Ga0068871_1000589172 406
227 3300006881 Ga0068865_100012000 Ga0068865_1000120002 406
228 3300006881 Ga0068865_100015830 Ga0068865_1000158303 406
229 3300006931 Ga0097620_100017888 Ga0097620_1000178882 406
230 3300006931 Ga0097620_100246956 Ga0097620_1002469562 406
231 3300009093 Ga0105240_10001065 Ga0105240_1000106524 406
232 3300009093 Ga0105240_10063433 Ga0105240_100634332 406
233 3300009094 Ga0111539_10001245 Ga0111539_1000124515 406
234 3300009094 Ga0111539_10143275 Ga0111539_101432752 406
235 3300009177 Ga0105248_10003489 Ga0105248_100034892 406
236 3300009177 Ga0105248_10490111 Ga0105248_104901111 406
237 3300009553 Ga0105249_10051617 Ga0105249_100516172 406
238 3300009553 Ga0105249_10226294 Ga0105249_102262941 406
239 3300013296 Ga0157374_10048683 Ga0157374_100486834 406
240 3300013306 Ga0163162_10016406 Ga0163162_100164065 406
241 3300013308 Ga0157375_10061141 Ga0157375_100611412 406
242 3300014326 Ga0157380_10100979 Ga0157380_101009793 406
243 3300014968 Ga0157379_10011587 Ga0157379_1001158710 406
244 3300014969 Ga0157376_10142208 Ga0157376_101422083 406
245 3300017792 Ga0163161_10014776 Ga0163161_100147763 406
246 3300025315 Ga0207697_10010993 Ga0207697_100109933 406
247 3300025321 Ga0207656_10002527 Ga0207656_100025272 406
248 3300025735 Ga0207713_1008319 Ga0207713_10083196 406
249 3300025893 Ga0207682_10000116 Ga0207682_1000011611 406
250 3300025903 Ga0207680_10008072 Ga0207680_100080727 406
251 3300025903 Ga0207680_10043416 Ga0207680_100434162 406
252 3300025907 Ga0207645_10000204 Ga0207645_1000020412 406
253 3300025907 Ga0207645_10002117 Ga0207645_100021174 406
254 3300025913 Ga0207695_10000895 Ga0207695_100008957 406
255 3300025913 Ga0207695_10108991 Ga0207695_101089912 406
256 3300025918 Ga0207662_10011148 Ga0207662_100111482 406
257 3300025922 Ga0207646_10028121 Ga0207646_100281214 406
258 3300025923 Ga0207681_10018122 Ga0207681_100181226 406
259 3300025923 Ga0207681_10020383 Ga0207681_100203832 406
260 3300025924 Ga0207694_10057428 Ga0207694_100574283 406
261 3300025925 Ga0207650_10005973 Ga0207650_100059733 406
262 3300025926 Ga0207659_10027020 Ga0207659_100270202 406
263 3300025926 Ga0207659_10036054 Ga0207659_100360545 406
264 3300025931 Ga0207644_10011714 Ga0207644_100117142 406
265 3300025933 Ga0207706_10199443 Ga0207706_101994431 406
266 3300025935 Ga0207709_10024683 Ga0207709_100246833 406
267 3300025937 Ga0207669_10004305 Ga0207669_100043056 406
268 3300025938 Ga0207704_10002643 Ga0207704_100026437 406
269 3300025940 Ga0207691_10000050 Ga0207691_100000505 406
270 3300025940 Ga0207691_10000428 Ga0207691_1000042812 406
271 3300025940 Ga0207691_10013794 Ga0207691_100137941 406
272 3300025942 Ga0207689_10028146 Ga0207689_100281462 406
273 3300025945 Ga0207679_10078377 Ga0207679_100783772 406
274 3300025960 Ga0207651_10004198 Ga0207651_100041986 406
275 3300025960 Ga0207651_10151319 Ga0207651_101513192 406
276 3300025972 Ga0207668_10009794 Ga0207668_100097949 406
277 3300025986 Ga0207658_10018409 Ga0207658_100184092 406
278 3300025986 Ga0207658_10118957 Ga0207658_101189571 406
279 3300026023 Ga0207677_10081378 Ga0207677_100813782 406
280 3300026041 Ga0207639_10025521 Ga0207639_100255215 406
281 3300026067 Ga0207678_10053806 Ga0207678_100538064 406
282 3300026075 Ga0207708_10026727 Ga0207708_100267273 406
283 3300026088 Ga0207641_10010899 Ga0207641_100108992 406
284 3300026088 Ga0207641_10101735 Ga0207641_101017352 406
285 3300026089 Ga0207648_10000251 Ga0207648_1000025149 406
286 3300026089 Ga0207648_10001093 Ga0207648_100010936 406
287 3300026089 Ga0207648_10021209 Ga0207648_100212094 406
288 3300026095 Ga0207676_10010459 Ga0207676_1001045910 406
289 3300026095 Ga0207676_10035271 Ga0207676_100352714 406
290 3300026118 Ga0207675_100052860 Ga0207675_1000528602 406
291 3300026118 Ga0207675_100087355 Ga0207675_1000873551 406
292 3300026121 Ga0207683_10000278 Ga0207683_100002785 406
293 3300026121 Ga0207683_10001841 Ga0207683_1000184111 406
294 3300026121 Ga0207683_10157039 Ga0207683_101570391 406
295 3300027312 Ga0209371_1000209 Ga0209371_100020916 406
296 3300027907 Ga0207428_10000412 Ga0207428_1000041221 406
297 3300028379 Ga0268266_10003348 Ga0268266_1000334812 406
298 3300028381 Ga0268264_10006113 Ga0268264_1000611312 406
299 3300028381 Ga0268264_10038637 Ga0268264_100386372 406
300 3300028381 Ga0268264_10237359 Ga0268264_102373592 406
301 3300030500 Ga0268256_1000167 Ga0268256_100016758 406
302 3300033180 Ga0307510_10000038 Ga0307510_1000003837 406
303 3300036401 Ga0373937_0027591 Ga0373937_0027591_68_1291 406
304 3300041463 Ga0451804_1106456 Ga0451804_1106456_2849_4078 406
305 3300041486 Ga0451807_1661108 Ga0451807_1661108_476_1705 406
306 3300046492 Ga0495585_0000001 Ga0495585_0000001_450408_451628 406
307 3300046518 Ga0495631_0000115 Ga0495631_0000115_47132_48352 406
308 3300046665 Ga0495661_0000098 Ga0495661_0000098_95601_96821 406
309 3300046689 Ga0495613_0026549 Ga0495613_0026549_2287_3522 406
310 3300047472 Ga0495686_0000019 Ga0495686_0000019_22640_23860 406
311 3300048912 Ga0496109_0000231 Ga0496109_0000231_31269_32507 406
312 3300048912 Ga0496109_0259872 Ga0496109_0259872_283_1503 406
313 3300048915 Ga0496112_0000561 Ga0496112_0000561_18287_19507 406
314 3300048915 Ga0496112_0203411 Ga0496112_0203411_377_1597 406
315 3300048921 Ga0496118_0000469 Ga0496118_0000469_41633_42853 406
316 3300048929 Ga0496126_0006469 Ga0496126_0006469_8095_9315 406
317 3300050490 nmdc:mga03n38_8338_c1 nmdc:mga03n38_8338_c1_2068_3297 406
318 3300050491 nmdc:mga00v17_168944_c1 nmdc:mga00v17_168944_c1_25_1254 406
319 3300050492 nmdc:mga0yw44_67461_c1 nmdc:mga0yw44_67461_c1_705_1934 406
320 3300050494 nmdc:mga06z11_1113_c1 nmdc:mga06z11_1113_c1_8395_9624 406
321 3300050508 nmdc:mga09592_211535_c1 nmdc:mga09592_211535_c1_282_1520 406
322 3300050508 nmdc:mga09592_34007_c1 nmdc:mga09592_34007_c1_2439_3668 406
323 3300050511 nmdc:mga08y16_23981_c1 nmdc:mga08y16_23981_c1_502_1740 406
324 3300050511 nmdc:mga08y16_482_c1 nmdc:mga08y16_482_c1_30176_31405 406
325 3300053096 Ga0500641_0023194 Ga0500641_0023194_122_1357 406
326 3300006847 Ga0075431_100055249 Ga0075431_1000552492 407
327 3300009093 Ga0105240_10002115 Ga0105240_1000211511 407
328 3300009094 Ga0111539_10006856 Ga0111539_1000685610 407
329 3300009094 Ga0111539_10008175 Ga0111539_1000817512 407
330 3300009094 Ga0111539_10086943 Ga0111539_100869431 407
331 3300013308 Ga0157375_10057450 Ga0157375_100574504 407
332 3300025920 Ga0207649_10110617 Ga0207649_101106172 407
333 3300027907 Ga0207428_10000814 Ga0207428_1000081426 407
334 3300036401 Ga0373937_0019724 Ga0373937_0019724_759_1985 407
335 3300042439 Ga0439464_0042467 Ga0439464_0042467_24_1262 407
336 3300045836 Ga0466958_0050393 Ga0466958_0050393_272_1498 407
337 3300046472 Ga0495580_0067660 Ga0495580_0067660_391_1617 407
338 3300048904 Ga0496101_0013435 Ga0496101_0013435_272_1519 407
339 3300048908 Ga0496105_0102215 Ga0496105_0102215_996_2243 407
340 3300048917 Ga0496114_0000696 Ga0496114_0000696_21466_22713 407
341 3300050509 nmdc:mga0qj67_3196_c1 nmdc:mga0qj67_3196_c1_7106_8344 407
342 3300050510 nmdc:mga06r32_117979_c1 nmdc:mga06r32_117979_c1_564_1835 407
343 3300050510 nmdc:mga06r32_5868_c1 nmdc:mga06r32_5868_c1_7886_9124 407
344 3300050511 nmdc:mga08y16_127883_c1 nmdc:mga08y16_127883_c1_1290_2549 407
345 3300050511 nmdc:mga08y16_250037_c1 nmdc:mga08y16_250037_c1_358_1584 407
346 3300050511 nmdc:mga08y16_73301_c1 nmdc:mga08y16_73301_c1_320_1591 407
347 2162886007 SwRhRL2b_contig_2195627 SwRhRL2b_0796.00004160 408
348 3300005548 Ga0070665_100017031 Ga0070665_1000170316 408
349 3300006358 Ga0068871_100045392 Ga0068871_1000453922 408
350 3300009093 Ga0105240_10035200 Ga0105240_100352002 408
351 3300013104 Ga0157370_10000371 Ga0157370_1000037112 408
352 3300013297 Ga0157378_10095402 Ga0157378_100954022 408
353 3300014969 Ga0157376_10016232 Ga0157376_100162324 408
354 3300015265 Ga0182005_1007508 Ga0182005_10075081 408
355 3300026088 Ga0207641_10012868 Ga0207641_100128685 408
356 3300026121 Ga0207683_10003689 Ga0207683_1000368910 408
357 3300028379 Ga0268266_10110175 Ga0268266_101101752 408
358 3300035725 Ga0373947_0025020 Ga0373947_0025020_1878_3104 408
359 3300044842 Ga0466957_0035730 Ga0466957_0035730_399_1655 408
360 3300046524 Ga0495648_0003098 Ga0495648_0003098_9737_10963 408
361 3300048920 Ga0496117_0004256 Ga0496117_0004256_297_1523 408
362 3300048921 Ga0496118_0057143 Ga0496118_0057143_1085_2311 408
363 3300048922 Ga0496119_0000681 Ga0496119_0000681_43847_45073 408
364 3300048923 Ga0496120_0000674 Ga0496120_0000674_297_1523 408
365 3300048925 Ga0496122_0001602 Ga0496122_0001602_20921_22147 408
366 3300048926 Ga0496123_0001307 Ga0496123_0001307_20921_22147 408
367 3300048927 Ga0496124_0026667 Ga0496124_0026667_3696_4922 408
368 3300048929 Ga0496126_0026619 Ga0496126_0026619_152_1378 408
369 3300049460 Ga0495682_0001339 Ga0495682_0001339_9866_11092 408
370 3300049569 Ga0501032_0004661 Ga0501032_0004661_511_1737 408
371 3300049581 Ga0501047_0281108 Ga0501047_0281108_199_1425 408
372 3300050515 nmdc:mga0a205_31573_c1 nmdc:mga0a205_31573_c1_302_1567 408
373 3300053730 Ga0500645_000597 Ga0500645_000597_3895_5121 408

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

70

242

0.94

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

251

430

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.9137 38 408
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.9082 38 408
7cdy-assembly1.cif.gz_A crystal structure of glucose dehydrogenase 0.9011 38 408
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.8976 38 408
7cdy-assembly1.cif.gz_A crystal structure of glucose dehydrogenase 0.8961 38 408
ID Description Score Start End Superfamily
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.876 29 408 2.120.10.30
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8689 29 408 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8488 34 408 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8417 34 408 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8213 37 405 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A2Z5G140-F1-model_v4 PQQ-dependent oxidoreductase, gdhB family 0.9777 23 407 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V8EUS3-F1-model_v4 Dehydrogenase 0.9766 40 145
AF-A0A2V5BH95-F1-model_v4 deleted 0.9741 23 408
AF-A0A2V8EX76-F1-model_v4 Dehydrogenase 0.9731 40 408
AF-A0A653XSF3-F1-model_v4 Dehydrogenase 0.9724 24 408

Feature Viewer

pLDDT pTM Quality
86.98 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map