F426252
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 373 | 205 | 373 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100001331|Ga0068868_1000013316 |
| Length | 310 |
| Sequence | MESRPPPGLSRSTYLERFAWLSIAAALATIALKTLAWWLTGSVGLLSDALESLVNLVAAVLALSMLRLAATPPDDEYPHGLSKAEYLSAGIEGALIVLAAAGILYTAIPRLVSPQPIDAPFLGLGISFAASLINLGAALVLIRAGKRYDSITLEADGKHLMTDVWTSAGVIVGVALVFLTGWLRLDPLVALAVALHIVWTGVGLVRRSVAGLLDAAIVPGEQAEVTKIFSEYGQRYAVKFHAFRTRRAGVRRFISFHLLVPDEWSVQRAHQLSEEIEERIRELVPSSAILVHIEPISDPASYDDETLDRM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 126 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 127 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 128 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 129 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 130 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 131 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 134 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 139 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 145 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 146 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 148 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 149 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 150 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 151 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 152 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.27 |
| Rhizosphere | 99.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10025548 | 3300005328 | Bacteria | 3339 |
| 2 | Ga0070676_10295990 | 3300005328 | Bacteria | 1095 |
| 3 | Ga0070683_100061448 | 3300005329 | Bacteria | 3494 |
| 4 | Ga0070690_100001754 | 3300005330 | Bacteria | 11471 |
| 5 | Ga0070690_100010245 | 3300005330 | Bacteria | 5449 |
| 6 | Ga0068869_100001435 | 3300005334 | Bacteria | 14129 |
| 7 | Ga0070680_100000789 | 3300005336 | Bacteria | 22263 |
| 8 | Ga0070680_100187069 | 3300005336 | Bacteria | 1745 |
| 9 | Ga0070682_100006636 | 3300005337 | Bacteria | 6490 |
| 10 | Ga0068868_100001331 | 3300005338 | Bacteria | 17036 |
| 11 | Ga0070689_100000776 | 3300005340 | Bacteria | 19580 |
| 12 | Ga0070689_100016468 | 3300005340 | Bacteria | 5411 |
| 13 | Ga0070691_10034785 | 3300005341 | Bacteria | 2372 |
| 14 | Ga0070687_100000436 | 3300005343 | Bacteria | 14119 |
| 15 | Ga0070692_10000910 | 3300005345 | Bacteria | 10019 |
| 16 | Ga0070692_10064389 | 3300005345 | Bacteria | 1939 |
| 17 | Ga0070692_10133733 | 3300005345 | Bacteria | 1397 |
| 18 | Ga0070668_100016473 | 3300005347 | Bacteria | 5527 |
| 19 | Ga0070669_100000706 | 3300005353 | Bacteria | 24466 |
| 20 | Ga0070669_100366050 | 3300005353 | Bacteria | 1173 |
| 21 | Ga0070675_100006313 | 3300005354 | Bacteria | 9098 |
| 22 | Ga0070675_100135561 | 3300005354 | Bacteria | 2101 |
| 23 | Ga0070671_100386060 | 3300005355 | Bacteria | 1197 |
| 24 | Ga0070674_100082759 | 3300005356 | Bacteria | 2297 |
| 25 | Ga0070673_100155395 | 3300005364 | Bacteria | 1941 |
| 26 | Ga0070673_100230105 | 3300005364 | Bacteria | 1608 |
| 27 | Ga0070673_100279725 | 3300005364 | Bacteria | 1463 |
| 28 | Ga0070688_100244564 | 3300005365 | Bacteria | 1275 |
| 29 | Ga0070659_100025292 | 3300005366 | Bacteria | 4557 |
| 30 | Ga0070714_100189338 | 3300005435 | Unclassified | 1876 |
| 31 | Ga0070714_100566006 | 3300005435 | Bacteria | 1089 |
| 32 | Ga0070710_10035173 | 3300005437 | Bacteria | 2730 |
| 33 | Ga0070705_100001008 | 3300005440 | Bacteria | 15668 |
| 34 | Ga0070705_100004118 | 3300005440 | Bacteria | 7103 |
| 35 | Ga0070705_100109798 | 3300005440 | Bacteria | 1760 |
| 36 | Ga0070705_100357512 | 3300005440 | Bacteria | 1067 |
| 37 | Ga0070700_100000507 | 3300005441 | Bacteria | 19399 |
| 38 | Ga0070700_100000666 | 3300005441 | Bacteria | 16998 |
| 39 | Ga0070694_100001273 | 3300005444 | Bacteria | 14642 |
| 40 | Ga0070694_100025787 | 3300005444 | Bacteria | 3806 |
| 41 | Ga0070694_100091982 | 3300005444 | Bacteria | 2130 |
| 42 | Ga0070694_100127107 | 3300005444 | Bacteria | 1836 |
| 43 | Ga0070694_100264029 | 3300005444 | Bacteria | 1307 |
| 44 | Ga0070694_100334051 | 3300005444 | Bacteria | 1170 |
| 45 | Ga0070678_100208077 | 3300005456 | Bacteria | 1619 |
| 46 | Ga0070681_10000235 | 3300005458 | Bacteria | 43570 |
| 47 | Ga0070681_10023162 | 3300005458 | Bacteria | 6247 |
| 48 | Ga0068867_100000699 | 3300005459 | Bacteria | 22369 |
| 49 | Ga0068867_100001386 | 3300005459 | Bacteria | 16761 |
| 50 | Ga0070707_100380538 | 3300005468 | Bacteria | 1371 |
| 51 | Ga0070699_100002487 | 3300005518 | Bacteria | 16563 |
| 52 | Ga0070679_100014967 | 3300005530 | Bacteria | 7453 |
| 53 | Ga0070679_100034557 | 3300005530 | Bacteria | 5011 |
| 54 | Ga0070684_100027873 | 3300005535 | Bacteria | 4772 |
| 55 | Ga0070697_100001807 | 3300005536 | Bacteria | 16334 |
| 56 | Ga0070697_100003810 | 3300005536 | Bacteria | 11585 |
| 57 | Ga0070672_100209013 | 3300005543 | Bacteria | 1634 |
| 58 | Ga0070686_100002450 | 3300005544 | Bacteria | 10226 |
| 59 | Ga0070686_100029699 | 3300005544 | Bacteria | 3328 |
| 60 | Ga0070686_100036261 | 3300005544 | Bacteria | 3052 |
| 61 | Ga0070695_100000113 | 3300005545 | Bacteria | 35966 |
| 62 | Ga0070695_100037915 | 3300005545 | Bacteria | 3039 |
| 63 | Ga0070695_100103228 | 3300005545 | Bacteria | 1923 |
| 64 | Ga0070695_100125563 | 3300005545 | Bacteria | 1761 |
| 65 | Ga0070695_100179345 | 3300005545 | Bacteria | 1500 |
| 66 | Ga0070696_100000434 | 3300005546 | Bacteria | 26295 |
| 67 | Ga0070696_100002261 | 3300005546 | Bacteria | 12697 |
| 68 | Ga0070696_100002633 | 3300005546 | Bacteria | 11898 |
| 69 | Ga0070693_100000209 | 3300005547 | Bacteria | 27275 |
| 70 | Ga0070693_100025937 | 3300005547 | Bacteria | 3158 |
| 71 | Ga0070704_100001744 | 3300005549 | Bacteria | 11877 |
| 72 | Ga0070704_100062396 | 3300005549 | Bacteria | 2671 |
| 73 | Ga0070704_100283045 | 3300005549 | Bacteria | 1375 |
| 74 | Ga0070704_100417511 | 3300005549 | Bacteria | 1148 |
| 75 | Ga0068855_100014327 | 3300005563 | Bacteria | 9547 |
| 76 | Ga0068855_100268898 | 3300005563 | Bacteria | 1896 |
| 77 | Ga0068854_100001665 | 3300005578 | Bacteria | 13528 |
| 78 | Ga0068854_100197919 | 3300005578 | Bacteria | 1578 |
| 79 | Ga0068856_100070663 | 3300005614 | Bacteria | 3454 |
| 80 | Ga0068856_100123983 | 3300005614 | Bacteria | 2586 |
| 81 | Ga0068856_100493521 | 3300005614 | Unclassified | 1245 |
| 82 | Ga0068856_100630919 | 3300005614 | Bacteria | 1092 |
| 83 | Ga0070702_100000240 | 3300005615 | Bacteria | 18563 |
| 84 | Ga0070702_100104077 | 3300005615 | Bacteria | 1747 |
| 85 | Ga0068859_100004628 | 3300005617 | Bacteria | 14018 |
| 86 | Ga0068859_100030356 | 3300005617 | Bacteria | 5423 |
| 87 | Ga0068859_100438005 | 3300005617 | Unclassified | 1403 |
| 88 | Ga0068864_100020253 | 3300005618 | Bacteria | 5564 |
| 89 | Ga0068866_10000744 | 3300005718 | Bacteria | 14729 |
| 90 | Ga0068866_10139903 | 3300005718 | Bacteria | 1388 |
| 91 | Ga0068861_100000550 | 3300005719 | Bacteria | 22119 |
| 92 | Ga0068861_100005956 | 3300005719 | Bacteria | 8281 |
| 93 | Ga0068861_100289981 | 3300005719 | Bacteria | 1413 |
| 94 | Ga0068870_10125619 | 3300005840 | Bacteria | 1483 |
| 95 | Ga0068858_100019276 | 3300005842 | Bacteria | 6379 |
| 96 | Ga0068860_100004596 | 3300005843 | Bacteria | 14092 |
| 97 | Ga0068860_100142192 | 3300005843 | Bacteria | 2307 |
| 98 | Ga0068862_100001897 | 3300005844 | Bacteria | 18976 |
| 99 | Ga0068862_100011352 | 3300005844 | Bacteria | 7356 |
| 100 | Ga0068862_100059122 | 3300005844 | Bacteria | 3290 |
| 101 | Ga0081539_10000799 | 3300005985 | Bacteria | 61195 |
| 102 | Ga0070715_10022627 | 3300006163 | Bacteria | 2453 |
| 103 | Ga0070716_100115001 | 3300006173 | Bacteria | 1674 |
| 104 | Ga0070716_100199712 | 3300006173 | Bacteria | 1328 |
| 105 | Ga0097621_100003980 | 3300006237 | Bacteria | 10238 |
| 106 | Ga0097621_100004795 | 3300006237 | Bacteria | 9465 |
| 107 | Ga0068871_100000788 | 3300006358 | Bacteria | 21290 |
| 108 | Ga0068871_100001073 | 3300006358 | Bacteria | 18331 |
| 109 | Ga0075428_100001002 | 3300006844 | Bacteria | 29936 |
| 110 | Ga0075428_100015891 | 3300006844 | Bacteria | 8329 |
| 111 | Ga0075431_100100692 | 3300006847 | Bacteria | 2981 |
| 112 | Ga0075431_100156399 | 3300006847 | Bacteria | 2345 |
| 113 | Ga0075433_10003313 | 3300006852 | Bacteria | 12441 |
| 114 | Ga0075433_10031717 | 3300006852 | Bacteria | 4519 |
| 115 | Ga0075433_10232468 | 3300006852 | Bacteria | 1637 |
| 116 | Ga0075434_100000004 | 3300006871 | Bacteria | 112839 |
| 117 | Ga0075434_100001086 | 3300006871 | Bacteria | 22255 |
| 118 | Ga0075434_100003417 | 3300006871 | Bacteria | 14208 |
| 119 | Ga0075434_100133325 | 3300006871 | Bacteria | 2503 |
| 120 | Ga0075429_100000051 | 3300006880 | Bacteria | 55896 |
| 121 | Ga0075429_100004984 | 3300006880 | Bacteria | 11437 |
| 122 | Ga0075429_100009199 | 3300006880 | Bacteria | 8578 |
| 123 | Ga0068865_100001146 | 3300006881 | Bacteria | 15365 |
| 124 | Ga0068865_100028303 | 3300006881 | Bacteria | 3709 |
| 125 | Ga0075436_100000331 | 3300006914 | Bacteria | 30168 |
| 126 | Ga0075436_100006064 | 3300006914 | Bacteria | 8296 |
| 127 | Ga0075436_100026757 | 3300006914 | Bacteria | 3971 |
| 128 | Ga0075436_100027975 | 3300006914 | Bacteria | 3881 |
| 129 | Ga0075436_100101005 | 3300006914 | Unclassified | 2009 |
| 130 | Ga0097620_100004627 | 3300006931 | Bacteria | 14018 |
| 131 | Ga0097620_100030355 | 3300006931 | Bacteria | 5423 |
| 132 | Ga0097620_100437969 | 3300006931 | Unclassified | 1403 |
| 133 | Ga0075435_100000313 | 3300007076 | Bacteria | 29845 |
| 134 | Ga0075435_100001505 | 3300007076 | Bacteria | 14975 |
| 135 | Ga0075435_100016338 | 3300007076 | Bacteria | 5595 |
| 136 | Ga0075435_100034552 | 3300007076 | Bacteria | 4007 |
| 137 | Ga0075435_100060751 | 3300007076 | Bacteria | 3065 |
| 138 | Ga0099794_10014482 | 3300007265 | Bacteria | 3456 |
| 139 | Ga0111539_10010804 | 3300009094 | Bacteria | 11495 |
| 140 | Ga0111539_10029052 | 3300009094 | Bacteria | 6741 |
| 141 | Ga0111539_10345681 | 3300009094 | Bacteria | 1731 |
| 142 | Ga0105245_10002454 | 3300009098 | Bacteria | 16760 |
| 143 | Ga0114129_10000337 | 3300009147 | Bacteria | 54884 |
| 144 | Ga0114129_10050786 | 3300009147 | Bacteria | 5824 |
| 145 | Ga0114129_10758253 | 3300009147 | Bacteria | 1242 |
| 146 | Ga0114129_10955375 | 3300009147 | Bacteria | 1082 |
| 147 | Ga0105243_10000915 | 3300009148 | Bacteria | 27703 |
| 148 | Ga0105243_10057436 | 3300009148 | Bacteria | 3099 |
| 149 | Ga0105242_10000945 | 3300009176 | Bacteria | 22671 |
| 150 | Ga0105248_10050849 | 3300009177 | Bacteria | 4649 |
| 151 | Ga0105249_10000975 | 3300009553 | Bacteria | 25356 |
| 152 | Ga0105249_10006665 | 3300009553 | Bacteria | 10054 |
| 153 | Ga0105239_10090345 | 3300010375 | Bacteria | 3379 |
| 154 | Ga0157378_10000844 | 3300013297 | Bacteria | 28388 |
| 155 | Ga0157380_10002048 | 3300014326 | Bacteria | 13485 |
| 156 | Ga0157377_10021544 | 3300014745 | Bacteria | 3391 |
| 157 | Ga0157379_10048879 | 3300014968 | Bacteria | 3776 |
| 158 | Ga0157376_10033005 | 3300014969 | Bacteria | 4164 |
| 159 | Ga0207642_10003273 | 3300025899 | Bacteria | 5094 |
| 160 | Ga0207688_10142738 | 3300025901 | Bacteria | 1410 |
| 161 | Ga0207645_10068706 | 3300025907 | Bacteria | 2266 |
| 162 | Ga0207643_10124455 | 3300025908 | Bacteria | 1530 |
| 163 | Ga0207705_10238455 | 3300025909 | Bacteria | 1385 |
| 164 | Ga0207654_10024587 | 3300025911 | Bacteria | 3240 |
| 165 | Ga0207707_10060845 | 3300025912 | Bacteria | 3285 |
| 166 | Ga0207663_10274654 | 3300025916 | Bacteria | 1250 |
| 167 | Ga0207660_10035411 | 3300025917 | Bacteria | 3466 |
| 168 | Ga0207660_10096010 | 3300025917 | Bacteria | 2206 |
| 169 | Ga0207662_10000233 | 3300025918 | Bacteria | 25755 |
| 170 | Ga0207662_10070071 | 3300025918 | Bacteria | 2120 |
| 171 | Ga0207662_10091796 | 3300025918 | Bacteria | 1869 |
| 172 | Ga0207662_10240421 | 3300025918 | Bacteria | 1185 |
| 173 | Ga0207652_10167337 | 3300025921 | Bacteria | 1972 |
| 174 | Ga0207681_10001251 | 3300025923 | Bacteria | 16395 |
| 175 | Ga0207681_10129300 | 3300025923 | Bacteria | 1865 |
| 176 | Ga0207681_10229693 | 3300025923 | Bacteria | 1440 |
| 177 | Ga0207659_10141849 | 3300025926 | Bacteria | 1866 |
| 178 | Ga0207687_10002722 | 3300025927 | Bacteria | 11964 |
| 179 | Ga0207664_10097382 | 3300025929 | Bacteria | 2423 |
| 180 | Ga0207690_10134065 | 3300025932 | Bacteria | 1816 |
| 181 | Ga0207686_10001496 | 3300025934 | Bacteria | 13174 |
| 182 | Ga0207709_10003455 | 3300025935 | Bacteria | 9382 |
| 183 | Ga0207709_10033946 | 3300025935 | Bacteria | 3002 |
| 184 | Ga0207670_10003031 | 3300025936 | Bacteria | 8859 |
| 185 | Ga0207670_10101953 | 3300025936 | Unclassified | 2051 |
| 186 | Ga0207704_10000745 | 3300025938 | Bacteria | 14317 |
| 187 | Ga0207704_10002119 | 3300025938 | Bacteria | 8893 |
| 188 | Ga0207704_10125860 | 3300025938 | Bacteria | 1764 |
| 189 | Ga0207665_10108036 | 3300025939 | Bacteria | 1952 |
| 190 | Ga0207691_10167530 | 3300025940 | Bacteria | 1925 |
| 191 | Ga0207689_10002282 | 3300025942 | Bacteria | 17945 |
| 192 | Ga0207689_10087091 | 3300025942 | Bacteria | 2566 |
| 193 | Ga0207667_10013499 | 3300025949 | Bacteria | 9341 |
| 194 | Ga0207712_10002814 | 3300025961 | Bacteria | 11139 |
| 195 | Ga0207712_10009194 | 3300025961 | Bacteria | 6259 |
| 196 | Ga0207668_10010738 | 3300025972 | Bacteria | 5543 |
| 197 | Ga0207640_10087042 | 3300025981 | Bacteria | 2153 |
| 198 | Ga0207677_10006472 | 3300026023 | Bacteria | 6430 |
| 199 | Ga0207703_10004183 | 3300026035 | Bacteria | 11897 |
| 200 | Ga0207708_10000625 | 3300026075 | Bacteria | 27213 |
| 201 | Ga0207708_10007988 | 3300026075 | Bacteria | 7838 |
| 202 | Ga0207708_10017293 | 3300026075 | Bacteria | 5428 |
| 203 | Ga0207708_10278861 | 3300026075 | Bacteria | 1354 |
| 204 | Ga0207702_10115507 | 3300026078 | Bacteria | 2394 |
| 205 | Ga0207702_10151914 | 3300026078 | Bacteria | 2107 |
| 206 | Ga0207648_10002355 | 3300026089 | Bacteria | 20391 |
| 207 | Ga0207648_10004982 | 3300026089 | Bacteria | 13500 |
| 208 | Ga0207648_10042404 | 3300026089 | Bacteria | 3994 |
| 209 | Ga0207676_10010920 | 3300026095 | Bacteria | 6480 |
| 210 | Ga0207674_10287042 | 3300026116 | Bacteria | 1594 |
| 211 | Ga0207674_10358849 | 3300026116 | Bacteria | 1409 |
| 212 | Ga0207675_100001604 | 3300026118 | Bacteria | 22664 |
| 213 | Ga0207675_100003839 | 3300026118 | Bacteria | 14619 |
| 214 | Ga0207675_100055101 | 3300026118 | Bacteria | 3709 |
| 215 | Ga0207683_10084047 | 3300026121 | Bacteria | 2829 |
| 216 | Ga0207683_10130387 | 3300026121 | Bacteria | 2261 |
| 217 | Ga0209969_1009078 | 3300027360 | Bacteria | 1413 |
| 218 | Ga0209970_1014334 | 3300027614 | Bacteria | 1317 |
| 219 | Ga0209588_1031534 | 3300027671 | Bacteria | 1696 |
| 220 | Ga0209588_1045292 | 3300027671 | Bacteria | 1423 |
| 221 | Ga0209974_10012266 | 3300027876 | Bacteria | 2868 |
| 222 | Ga0207428_10000610 | 3300027907 | Bacteria | 42207 |
| 223 | Ga0207428_10218888 | 3300027907 | Bacteria | 1428 |
| 224 | Ga0268265_10001521 | 3300028380 | Bacteria | 19348 |
| 225 | Ga0268265_10003807 | 3300028380 | Bacteria | 10690 |
| 226 | Ga0268265_10248679 | 3300028380 | Bacteria | 1573 |
| 227 | Ga0268264_10004412 | 3300028381 | Bacteria | 12005 |
| 228 | Ga0268264_10489059 | 3300028381 | Unclassified | 1198 |
| 229 | Ga0307405_10165382 | 3300031731 | Bacteria | 1572 |
| 230 | Ga0307407_10002261 | 3300031903 | Bacteria | 7453 |
| 231 | Ga0307416_100385910 | 3300032002 | Bacteria | 1433 |
| 232 | Ga0373930_0008326 | 3300034816 | Bacteria | 1814 |
| 233 | Ga0373948_0001182 | 3300034817 | Bacteria | 3541 |
| 234 | Ga0373938_0018517 | 3300034957 | Bacteria | 1382 |
| 235 | Ga0373926_0006970 | 3300035083 | Bacteria | 3758 |
| 236 | Ga0373928_0011654 | 3300035084 | Bacteria | 1744 |
| 237 | Ga0373949_0009810 | 3300035090 | Bacteria | 2096 |
| 238 | Ga0373923_0029072 | 3300035111 | Bacteria | 2215 |
| 239 | Ga0373923_0103521 | 3300035111 | Bacteria | 1258 |
| 240 | Ga0373941_0088460 | 3300035115 | Bacteria | 1058 |
| 241 | Ga0373945_0004344 | 3300035116 | Bacteria | 4500 |
| 242 | Ga0373954_0000965 | 3300035118 | Bacteria | 11269 |
| 243 | Ga0373943_0011505 | 3300035170 | Bacteria | 3982 |
| 244 | Ga0373955_0068010 | 3300035172 | Bacteria | 1984 |
| 245 | Ga0373942_0005937 | 3300035207 | Bacteria | 2823 |
| 246 | Ga0373942_0007956 | 3300035207 | Bacteria | 2465 |
| 247 | Ga0373961_0004471 | 3300035241 | Bacteria | 3380 |
| 248 | Ga0373924_0004096 | 3300035410 | Bacteria | 5072 |
| 249 | Ga0373924_0058051 | 3300035410 | Bacteria | 1615 |
| 250 | Ga0373931_0000627 | 3300035691 | Bacteria | 14664 |
| 251 | Ga0373931_0022311 | 3300035691 | Bacteria | 3185 |
| 252 | Ga0373931_0045002 | 3300035691 | Bacteria | 2329 |
| 253 | Ga0373935_0027855 | 3300035692 | Bacteria | 3492 |
| 254 | Ga0373935_0059590 | 3300035692 | Bacteria | 2440 |
| 255 | Ga0373933_0034162 | 3300035724 | Bacteria | 2962 |
| 256 | Ga0373933_0078639 | 3300035724 | Bacteria | 2018 |
| 257 | Ga0373937_0001198 | 3300036401 | Bacteria | 21774 |
| 258 | Ga0373937_0019305 | 3300036401 | Bacteria | 6100 |
| 259 | Ga0439439_0011395 | 3300041406 | Bacteria | 2139 |
| 260 | Ga0439461_0001994 | 3300041410 | Bacteria | 3229 |
| 261 | Ga0451807_0724457 | 3300041486 | Bacteria | 2998 |
| 262 | Ga0451853_1635946 | 3300041512 | Bacteria | 826 |
| 263 | Ga0439446_0008907 | 3300042156 | Bacteria | 2676 |
| 264 | Ga0439434_0002340 | 3300042435 | Bacteria | 5514 |
| 265 | Ga0439435_0000298 | 3300042436 | Bacteria | 7381 |
| 266 | Ga0439435_0003881 | 3300042436 | Bacteria | 3163 |
| 267 | Ga0439444_0003491 | 3300042437 | Bacteria | 2224 |
| 268 | Ga0439460_0000925 | 3300042461 | Bacteria | 6709 |
| 269 | Ga0439460_0007765 | 3300042461 | Bacteria | 2692 |
| 270 | Ga0451576_0008492 | 3300045051 | Bacteria | 12050 |
| 271 | Ga0451576_0015696 | 3300045051 | Bacteria | 8384 |
| 272 | Ga0451576_0208169 | 3300045051 | Bacteria | 2042 |
| 273 | Ga0495592_0078922 | 3300046454 | Bacteria | 2384 |
| 274 | Ga0495629_0097763 | 3300046459 | Bacteria | 2048 |
| 275 | Ga0495580_0065502 | 3300046472 | Bacteria | 2544 |
| 276 | Ga0495662_0002396 | 3300046476 | Bacteria | 9424 |
| 277 | Ga0495594_0037288 | 3300046499 | Bacteria | 2652 |
| 278 | Ga0495630_0355330 | 3300046517 | Bacteria | 1121 |
| 279 | Ga0495586_0134130 | 3300046535 | Bacteria | 1387 |
| 280 | Ga0495587_0127898 | 3300046536 | Bacteria | 1453 |
| 281 | Ga0495656_0080564 | 3300046615 | Bacteria | 1468 |
| 282 | Ga0495635_0054819 | 3300046663 | Bacteria | 2746 |
| 283 | Ga0495635_0118892 | 3300046663 | Bacteria | 1803 |
| 284 | Ga0495659_0094249 | 3300046664 | Bacteria | 1153 |
| 285 | Ga0495647_0007364 | 3300046681 | Bacteria | 3683 |
| 286 | Ga0495658_0002184 | 3300046683 | Bacteria | 9894 |
| 287 | Ga0495669_0031323 | 3300046684 | Bacteria | 2336 |
| 288 | Ga0495669_0056823 | 3300046684 | Bacteria | 1764 |
| 289 | Ga0495581_0072641 | 3300047315 | Bacteria | 1991 |
| 290 | Ga0495581_0249769 | 3300047315 | Bacteria | 1037 |
| 291 | Ga0495680_0081836 | 3300047322 | Bacteria | 2437 |
| 292 | Ga0495677_0046570 | 3300047445 | Bacteria | 1592 |
| 293 | Ga0495593_0148868 | 3300047673 | Bacteria | 1184 |
| 294 | Ga0501036_0015984 | 3300049572 | Bacteria | 6268 |
| 295 | Ga0501036_0188526 | 3300049572 | Bacteria | 1735 |
| 296 | Ga0501038_0023765 | 3300049574 | Bacteria | 5476 |
| 297 | Ga0501039_0001773 | 3300049575 | Bacteria | 15943 |
| 298 | Ga0501040_0007299 | 3300049576 | Bacteria | 7160 |
| 299 | Ga0501040_0039258 | 3300049576 | Bacteria | 3219 |
| 300 | Ga0501040_0061178 | 3300049576 | Bacteria | 2589 |
| 301 | Ga0501040_0094727 | 3300049576 | Bacteria | 2078 |
| 302 | Ga0501041_0005336 | 3300049577 | Bacteria | 7521 |
| 303 | Ga0501041_0032680 | 3300049577 | Bacteria | 3145 |
| 304 | Ga0501042_0119476 | 3300049578 | Bacteria | 1897 |
| 305 | Ga0501043_0024926 | 3300049579 | Bacteria | 4693 |
| 306 | Ga0501046_0010010 | 3300049580 | Bacteria | 8167 |
| 307 | Ga0501047_0105949 | 3300049581 | Bacteria | 2692 |
| 308 | Ga0501048_0018634 | 3300049582 | Bacteria | 5103 |
| 309 | Ga0501048_0061189 | 3300049582 | Bacteria | 2667 |
| 310 | Ga0501048_0289370 | 3300049582 | Bacteria | 1165 |
| 311 | Ga0501048_0500855 | 3300049582 | Bacteria | 871 |
| 312 | Ga0501068_0015374 | 3300049584 | Bacteria | 4393 |
| 313 | Ga0501070_0036084 | 3300049586 | Bacteria | 4129 |
| 314 | Ga0501071_0088612 | 3300049587 | Bacteria | 2271 |
| 315 | Ga0501071_0302355 | 3300049587 | Bacteria | 1213 |
| 316 | Ga0501072_0010678 | 3300049588 | Bacteria | 6992 |
| 317 | Ga0501072_0041628 | 3300049588 | Bacteria | 3609 |
| 318 | Ga0501072_0072479 | 3300049588 | Bacteria | 2722 |
| 319 | Ga0501072_0162753 | 3300049588 | Bacteria | 1780 |
| 320 | Ga0501074_0026155 | 3300049590 | Bacteria | 4232 |
| 321 | Ga0501074_0046047 | 3300049590 | Bacteria | 3154 |
| 322 | Ga0501075_0021793 | 3300049591 | Bacteria | 4673 |
| 323 | Ga0501076_0008694 | 3300049592 | Bacteria | 7458 |
| 324 | Ga0501076_0204018 | 3300049592 | Bacteria | 1615 |
| 325 | Ga0501076_0429492 | 3300049592 | Bacteria | 1087 |
| 326 | Ga0501077_0007614 | 3300049593 | Bacteria | 6684 |
| 327 | Ga0501077_0131729 | 3300049593 | Bacteria | 1585 |
| 328 | Ga0501077_0132606 | 3300049593 | Bacteria | 1580 |
| 329 | Ga0501079_0006780 | 3300049741 | Bacteria | 8616 |
| 330 | Ga0501079_0105254 | 3300049741 | Bacteria | 2189 |
| 331 | Ga0501081_0008922 | 3300049743 | Bacteria | 6516 |
| 332 | Ga0501081_0033209 | 3300049743 | Bacteria | 3505 |
| 333 | Ga0501081_0146802 | 3300049743 | Bacteria | 1693 |
| 334 | Ga0501044_0101963 | 3300049823 | Bacteria | 2887 |
| 335 | Ga0501045_0002662 | 3300049824 | Bacteria | 12183 |
| 336 | Ga0501045_0007193 | 3300049824 | Bacteria | 7722 |
| 337 | nmdc:mga05p37_330310_c1 | 3300050507 | Bacteria | 1801 |
| 338 | nmdc:mga05p37_73183_c1 | 3300050507 | Bacteria | 4217 |
| 339 | nmdc:mga05p37_758_c1 | 3300050507 | Bacteria | 35839 |
| 340 | nmdc:mga09592_231218_c1 | 3300050508 | Bacteria | 1602 |
| 341 | nmdc:mga09592_27348_c1 | 3300050508 | Bacteria | 4733 |
| 342 | nmdc:mga0qj67_37322_c1 | 3300050509 | Bacteria | 3805 |
| 343 | nmdc:mga06r32_214799_c1 | 3300050510 | Bacteria | 1911 |
| 344 | nmdc:mga06r32_89292_c1 | 3300050510 | Bacteria | 3009 |
| 345 | nmdc:mga08y16_26065_c1 | 3300050511 | Bacteria | 6166 |
| 346 | nmdc:mga08y16_339465_c1 | 3300050511 | Bacteria | 1544 |
| 347 | nmdc:mga08y16_50051_c1 | 3300050511 | Bacteria | 4372 |
| 348 | nmdc:mga08y16_635099_c1 | 3300050511 | Bacteria | 1073 |
| 349 | nmdc:mga08y16_72387_c1 | 3300050511 | Bacteria | 3592 |
| 350 | nmdc:mga08y16_7868_c1 | 3300050511 | Bacteria | 11161 |
| 351 | nmdc:mga0n895_13715_c1 | 3300050512 | Bacteria | 7327 |
| 352 | nmdc:mga0n895_14002_c1 | 3300050512 | Bacteria | 7265 |
| 353 | nmdc:mga0n895_1569_c1 | 3300050512 | Bacteria | 17184 |
| 354 | nmdc:mga0n895_2878_c1 | 3300050512 | Bacteria | 13655 |
| 355 | nmdc:mga0rr50_133752_c1 | 3300050513 | Bacteria | 1988 |
| 356 | nmdc:mga0rr50_2095_c1 | 3300050513 | Bacteria | 11151 |
| 357 | nmdc:mga0rr50_29920_c1 | 3300050513 | Bacteria | 3848 |
| 358 | nmdc:mga0rr50_3552_c1 | 3300050513 | Bacteria | 9004 |
| 359 | nmdc:mga08x19_1254_c1 | 3300050514 | Bacteria | 15744 |
| 360 | nmdc:mga08x19_149793_c1 | 3300050514 | Bacteria | 1579 |
| 361 | nmdc:mga08x19_16751_c1 | 3300050514 | Bacteria | 4475 |
| 362 | nmdc:mga08x19_26490_c1 | 3300050514 | Bacteria | 3618 |
| 363 | nmdc:mga08x19_28357_c1 | 3300050514 | Bacteria | 3506 |
| 364 | nmdc:mga08x19_55223_c1 | 3300050514 | Bacteria | 2559 |
| 365 | nmdc:mga0a205_179852_c1 | 3300050515 | Bacteria | 2009 |
| 366 | nmdc:mga0a205_38169_c1 | 3300050515 | Bacteria | 4620 |
| 367 | nmdc:mga0a205_72711_c1 | 3300050515 | Bacteria | 1830 |
| 368 | nmdc:mga0a205_82665_c1 | 3300050515 | Bacteria | 3102 |
| 369 | Ga0501084_0012554 | 3300054114 | Bacteria | 7018 |
| 370 | Ga0501084_0093745 | 3300054114 | Bacteria | 2521 |
| 371 | Ga0501082_0011010 | 3300060353 | Bacteria | 7777 |
| 372 | Ga0501082_0126248 | 3300060353 | Bacteria | 2219 |
| 373 | Ga0530510_0009286 | 3300061734 | Bacteria | 6900 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005328 | Ga0070676_10295990 | Ga0070676_102959902 | 244 |
| 2 | 3300050514 | nmdc:mga08x19_55223_c1 | nmdc:mga08x19_55223_c1_933_1826 | 250 |
| 3 | 3300025908 | Ga0207643_10124455 | Ga0207643_101244552 | 251 |
| 4 | 3300009094 | Ga0111539_10345681 | Ga0111539_103456812 | 255 |
| 5 | 3300034816 | Ga0373930_0008326 | Ga0373930_0008326_193_1125 | 255 |
| 6 | 3300034817 | Ga0373948_0001182 | Ga0373948_0001182_2131_3063 | 255 |
| 7 | 3300035084 | Ga0373928_0011654 | Ga0373928_0011654_620_1552 | 255 |
| 8 | 3300035090 | Ga0373949_0009810 | Ga0373949_0009810_1116_2048 | 255 |
| 9 | 3300035207 | Ga0373942_0005937 | Ga0373942_0005937_26_958 | 255 |
| 10 | 3300035691 | Ga0373931_0000627 | Ga0373931_0000627_11104_12036 | 255 |
| 11 | 3300041512 | Ga0451853_1635946 | Ga0451853_1635946_13_816 | 266 |
| 12 | 3300049582 | Ga0501048_0500855 | Ga0501048_0500855_41_859 | 270 |
| 13 | 3300049588 | Ga0501072_0041628 | Ga0501072_0041628_1744_2562 | 270 |
| 14 | 3300049592 | Ga0501076_0429492 | Ga0501076_0429492_231_1049 | 270 |
| 15 | 3300049743 | Ga0501081_0146802 | Ga0501081_0146802_102_920 | 270 |
| 16 | 3300005444 | Ga0070694_100334051 | Ga0070694_1003340511 | 278 |
| 17 | 3300005549 | Ga0070704_100283045 | Ga0070704_1002830452 | 278 |
| 18 | 3300005440 | Ga0070705_100357512 | Ga0070705_1003575121 | 280 |
| 19 | 3300007076 | Ga0075435_100060751 | Ga0075435_1000607512 | 280 |
| 20 | 3300035118 | Ga0373954_0000965 | Ga0373954_0000965_6763_7653 | 280 |
| 21 | 3300035410 | Ga0373924_0058051 | Ga0373924_0058051_115_1005 | 280 |
| 22 | 3300035724 | Ga0373933_0034162 | Ga0373933_0034162_803_1693 | 280 |
| 23 | 3300036401 | Ga0373937_0001198 | Ga0373937_0001198_9404_10294 | 280 |
| 24 | 3300045051 | Ga0451576_0008492 | Ga0451576_0008492_5311_6225 | 280 |
| 25 | 3300050513 | nmdc:mga0rr50_133752_c1 | nmdc:mga0rr50_133752_c1_88_1002 | 280 |
| 26 | 3300005536 | Ga0070697_100001807 | Ga0070697_10000180714 | 281 |
| 27 | 3300049576 | Ga0501040_0061178 | Ga0501040_0061178_910_1821 | 281 |
| 28 | 3300049577 | Ga0501041_0032680 | Ga0501041_0032680_561_1472 | 281 |
| 29 | 3300049582 | Ga0501048_0289370 | Ga0501048_0289370_176_1087 | 281 |
| 30 | 3300049588 | Ga0501072_0072479 | Ga0501072_0072479_15_926 | 281 |
| 31 | 3300049590 | Ga0501074_0026155 | Ga0501074_0026155_1983_2894 | 281 |
| 32 | 3300049593 | Ga0501077_0131729 | Ga0501077_0131729_603_1514 | 281 |
| 33 | 3300049741 | Ga0501079_0105254 | Ga0501079_0105254_1118_2029 | 281 |
| 34 | 3300049743 | Ga0501081_0033209 | Ga0501081_0033209_1800_2711 | 281 |
| 35 | 3300049824 | Ga0501045_0002662 | Ga0501045_0002662_748_1659 | 281 |
| 36 | 3300054114 | Ga0501084_0093745 | Ga0501084_0093745_758_1669 | 281 |
| 37 | 3300060353 | Ga0501082_0126248 | Ga0501082_0126248_645_1556 | 281 |
| 38 | 3300035083 | Ga0373926_0006970 | Ga0373926_0006970_44_976 | 285 |
| 39 | 3300035170 | Ga0373943_0011505 | Ga0373943_0011505_187_1119 | 285 |
| 40 | 3300035692 | Ga0373935_0059590 | Ga0373935_0059590_798_1730 | 285 |
| 41 | 3300046472 | Ga0495580_0065502 | Ga0495580_0065502_561_1493 | 285 |
| 42 | 3300046499 | Ga0495594_0037288 | Ga0495594_0037288_985_1917 | 285 |
| 43 | 3300046681 | Ga0495647_0007364 | Ga0495647_0007364_1256_2188 | 285 |
| 44 | 3300046683 | Ga0495658_0002184 | Ga0495658_0002184_7235_8167 | 285 |
| 45 | 3300047315 | Ga0495581_0249769 | Ga0495581_0249769_77_1009 | 285 |
| 46 | 3300005355 | Ga0070671_100386060 | Ga0070671_1003860602 | 286 |
| 47 | 3300005544 | Ga0070686_100036261 | Ga0070686_1000362614 | 286 |
| 48 | 3300006358 | Ga0068871_100001073 | Ga0068871_10000107312 | 286 |
| 49 | 3300014969 | Ga0157376_10033005 | Ga0157376_100330052 | 286 |
| 50 | 3300025918 | Ga0207662_10240421 | Ga0207662_102404212 | 286 |
| 51 | 3300035207 | Ga0373942_0007956 | Ga0373942_0007956_808_1674 | 286 |
| 52 | 3300005366 | Ga0070659_100025292 | Ga0070659_1000252924 | 287 |
| 53 | 3300005435 | Ga0070714_100566006 | Ga0070714_1005660061 | 287 |
| 54 | 3300005543 | Ga0070672_100209013 | Ga0070672_1002090131 | 287 |
| 55 | 3300005578 | Ga0068854_100197919 | Ga0068854_1001979192 | 287 |
| 56 | 3300025901 | Ga0207688_10142738 | Ga0207688_101427382 | 287 |
| 57 | 3300025918 | Ga0207662_10070071 | Ga0207662_100700712 | 287 |
| 58 | 3300025932 | Ga0207690_10134065 | Ga0207690_101340652 | 287 |
| 59 | 3300025938 | Ga0207704_10125860 | Ga0207704_101258601 | 287 |
| 60 | 3300025940 | Ga0207691_10167530 | Ga0207691_101675302 | 287 |
| 61 | 3300026116 | Ga0207674_10358849 | Ga0207674_103588491 | 287 |
| 62 | 3300026121 | Ga0207683_10130387 | Ga0207683_101303874 | 287 |
| 63 | 3300032002 | Ga0307416_100385910 | Ga0307416_1003859102 | 287 |
| 64 | 3300006844 | Ga0075428_100015891 | Ga0075428_1000158913 | 288 |
| 65 | 3300006847 | Ga0075431_100156399 | Ga0075431_1001563992 | 288 |
| 66 | 3300006880 | Ga0075429_100009199 | Ga0075429_1000091996 | 288 |
| 67 | 3300009147 | Ga0114129_10050786 | Ga0114129_100507865 | 288 |
| 68 | 3300031903 | Ga0307407_10002261 | Ga0307407_100022612 | 288 |
| 69 | 3300041486 | Ga0451807_0724457 | Ga0451807_0724457_2111_2980 | 288 |
| 70 | 3300050507 | nmdc:mga05p37_73183_c1 | nmdc:mga05p37_73183_c1_2966_3880 | 288 |
| 71 | 3300050508 | nmdc:mga09592_27348_c1 | nmdc:mga09592_27348_c1_3092_4006 | 288 |
| 72 | 3300050510 | nmdc:mga06r32_89292_c1 | nmdc:mga06r32_89292_c1_1022_1936 | 288 |
| 73 | 3300005614 | Ga0068856_100123983 | Ga0068856_1001239834 | 289 |
| 74 | 3300026078 | Ga0207702_10115507 | Ga0207702_101155072 | 289 |
| 75 | 3300025918 | Ga0207662_10091796 | Ga0207662_100917962 | 291 |
| 76 | 3300050511 | nmdc:mga08y16_635099_c1 | nmdc:mga08y16_635099_c1_109_1014 | 293 |
| 77 | 3300006871 | Ga0075434_100003417 | Ga0075434_1000034175 | 295 |
| 78 | 3300050512 | nmdc:mga0n895_14002_c1 | nmdc:mga0n895_14002_c1_4851_5741 | 295 |
| 79 | 3300005440 | Ga0070705_100004118 | Ga0070705_1000041183 | 296 |
| 80 | 3300005440 | Ga0070705_100109798 | Ga0070705_1001097983 | 296 |
| 81 | 3300005444 | Ga0070694_100025787 | Ga0070694_1000257873 | 296 |
| 82 | 3300005444 | Ga0070694_100127107 | Ga0070694_1001271072 | 296 |
| 83 | 3300005458 | Ga0070681_10000235 | Ga0070681_1000023510 | 296 |
| 84 | 3300005468 | Ga0070707_100380538 | Ga0070707_1003805382 | 296 |
| 85 | 3300005518 | Ga0070699_100002487 | Ga0070699_10000248712 | 296 |
| 86 | 3300005530 | Ga0070679_100014967 | Ga0070679_1000149674 | 296 |
| 87 | 3300005536 | Ga0070697_100003810 | Ga0070697_1000038106 | 296 |
| 88 | 3300005545 | Ga0070695_100037915 | Ga0070695_1000379154 | 296 |
| 89 | 3300005545 | Ga0070695_100125563 | Ga0070695_1001255631 | 296 |
| 90 | 3300005545 | Ga0070695_100179345 | Ga0070695_1001793452 | 296 |
| 91 | 3300005546 | Ga0070696_100002633 | Ga0070696_1000026339 | 296 |
| 92 | 3300005549 | Ga0070704_100417511 | Ga0070704_1004175111 | 296 |
| 93 | 3300005985 | Ga0081539_10000799 | Ga0081539_1000079924 | 296 |
| 94 | 3300006847 | Ga0075431_100100692 | Ga0075431_1001006922 | 296 |
| 95 | 3300006852 | Ga0075433_10232468 | Ga0075433_102324682 | 296 |
| 96 | 3300006871 | Ga0075434_100000004 | Ga0075434_1000000047 | 296 |
| 97 | 3300006871 | Ga0075434_100133325 | Ga0075434_1001333254 | 296 |
| 98 | 3300006880 | Ga0075429_100004984 | Ga0075429_1000049849 | 296 |
| 99 | 3300006914 | Ga0075436_100026757 | Ga0075436_1000267572 | 296 |
| 100 | 3300006914 | Ga0075436_100027975 | Ga0075436_1000279752 | 296 |
| 101 | 3300006914 | Ga0075436_100101005 | Ga0075436_1001010054 | 296 |
| 102 | 3300007076 | Ga0075435_100016338 | Ga0075435_1000163386 | 296 |
| 103 | 3300007076 | Ga0075435_100034552 | Ga0075435_1000345524 | 296 |
| 104 | 3300007265 | Ga0099794_10014482 | Ga0099794_100144822 | 296 |
| 105 | 3300009147 | Ga0114129_10758253 | Ga0114129_107582532 | 296 |
| 106 | 3300009147 | Ga0114129_10955375 | Ga0114129_109553752 | 296 |
| 107 | 3300025939 | Ga0207665_10108036 | Ga0207665_101080362 | 296 |
| 108 | 3300027360 | Ga0209969_1009078 | Ga0209969_10090782 | 296 |
| 109 | 3300027614 | Ga0209970_1014334 | Ga0209970_10143342 | 296 |
| 110 | 3300027671 | Ga0209588_1045292 | Ga0209588_10452922 | 296 |
| 111 | 3300027876 | Ga0209974_10012266 | Ga0209974_100122663 | 296 |
| 112 | 3300035115 | Ga0373941_0088460 | Ga0373941_0088460_136_1029 | 296 |
| 113 | 3300035691 | Ga0373931_0045002 | Ga0373931_0045002_384_1277 | 296 |
| 114 | 3300042436 | Ga0439435_0003881 | Ga0439435_0003881_521_1414 | 296 |
| 115 | 3300042461 | Ga0439460_0007765 | Ga0439460_0007765_1520_2413 | 296 |
| 116 | 3300045051 | Ga0451576_0208169 | Ga0451576_0208169_442_1335 | 296 |
| 117 | 3300046454 | Ga0495592_0078922 | Ga0495592_0078922_417_1310 | 296 |
| 118 | 3300046459 | Ga0495629_0097763 | Ga0495629_0097763_991_1884 | 296 |
| 119 | 3300046476 | Ga0495662_0002396 | Ga0495662_0002396_8223_9116 | 296 |
| 120 | 3300046517 | Ga0495630_0355330 | Ga0495630_0355330_100_993 | 296 |
| 121 | 3300046535 | Ga0495586_0134130 | Ga0495586_0134130_348_1241 | 296 |
| 122 | 3300046663 | Ga0495635_0118892 | Ga0495635_0118892_764_1657 | 296 |
| 123 | 3300046684 | Ga0495669_0056823 | Ga0495669_0056823_424_1317 | 296 |
| 124 | 3300047315 | Ga0495581_0072641 | Ga0495581_0072641_686_1579 | 296 |
| 125 | 3300047673 | Ga0495593_0148868 | Ga0495593_0148868_50_943 | 296 |
| 126 | 3300049593 | Ga0501077_0132606 | Ga0501077_0132606_166_1059 | 296 |
| 127 | 3300050507 | nmdc:mga05p37_330310_c1 | nmdc:mga05p37_330310_c1_551_1444 | 296 |
| 128 | 3300050512 | nmdc:mga0n895_13715_c1 | nmdc:mga0n895_13715_c1_101_994 | 296 |
| 129 | 3300050512 | nmdc:mga0n895_1569_c1 | nmdc:mga0n895_1569_c1_5437_6330 | 296 |
| 130 | 3300050513 | nmdc:mga0rr50_2095_c1 | nmdc:mga0rr50_2095_c1_1699_2592 | 296 |
| 131 | 3300050514 | nmdc:mga08x19_149793_c1 | nmdc:mga08x19_149793_c1_335_1228 | 296 |
| 132 | 3300050514 | nmdc:mga08x19_16751_c1 | nmdc:mga08x19_16751_c1_24_917 | 296 |
| 133 | 3300050514 | nmdc:mga08x19_26490_c1 | nmdc:mga08x19_26490_c1_2616_3509 | 296 |
| 134 | 3300050515 | nmdc:mga0a205_72711_c1 | nmdc:mga0a205_72711_c1_789_1682 | 296 |
| 135 | 3300050515 | nmdc:mga0a205_82665_c1 | nmdc:mga0a205_82665_c1_783_1676 | 296 |
| 136 | 3300005330 | Ga0070690_100001754 | Ga0070690_1000017544 | 298 |
| 137 | 3300005330 | Ga0070690_100010245 | Ga0070690_1000102456 | 298 |
| 138 | 3300005334 | Ga0068869_100001435 | Ga0068869_10000143512 | 298 |
| 139 | 3300005336 | Ga0070680_100000789 | Ga0070680_10000078910 | 298 |
| 140 | 3300005337 | Ga0070682_100006636 | Ga0070682_1000066366 | 298 |
| 141 | 3300005340 | Ga0070689_100000776 | Ga0070689_1000007766 | 298 |
| 142 | 3300005340 | Ga0070689_100016468 | Ga0070689_1000164683 | 298 |
| 143 | 3300005341 | Ga0070691_10034785 | Ga0070691_100347852 | 298 |
| 144 | 3300005343 | Ga0070687_100000436 | Ga0070687_1000004366 | 298 |
| 145 | 3300005345 | Ga0070692_10000910 | Ga0070692_100009103 | 298 |
| 146 | 3300005353 | Ga0070669_100366050 | Ga0070669_1003660501 | 298 |
| 147 | 3300005364 | Ga0070673_100155395 | Ga0070673_1001553951 | 298 |
| 148 | 3300005364 | Ga0070673_100279725 | Ga0070673_1002797252 | 298 |
| 149 | 3300005435 | Ga0070714_100189338 | Ga0070714_1001893382 | 298 |
| 150 | 3300005440 | Ga0070705_100001008 | Ga0070705_10000100812 | 298 |
| 151 | 3300005444 | Ga0070694_100001273 | Ga0070694_1000012736 | 298 |
| 152 | 3300005444 | Ga0070694_100091982 | Ga0070694_1000919823 | 298 |
| 153 | 3300005458 | Ga0070681_10023162 | Ga0070681_100231624 | 298 |
| 154 | 3300005459 | Ga0068867_100001386 | Ga0068867_1000013866 | 298 |
| 155 | 3300005530 | Ga0070679_100034557 | Ga0070679_1000345572 | 298 |
| 156 | 3300005544 | Ga0070686_100002450 | Ga0070686_1000024504 | 298 |
| 157 | 3300005545 | Ga0070695_100000113 | Ga0070695_10000011316 | 298 |
| 158 | 3300005545 | Ga0070695_100103228 | Ga0070695_1001032283 | 298 |
| 159 | 3300005546 | Ga0070696_100002261 | Ga0070696_10000226110 | 298 |
| 160 | 3300005547 | Ga0070693_100000209 | Ga0070693_1000002096 | 298 |
| 161 | 3300005549 | Ga0070704_100001744 | Ga0070704_1000017449 | 298 |
| 162 | 3300005549 | Ga0070704_100062396 | Ga0070704_1000623961 | 298 |
| 163 | 3300005563 | Ga0068855_100014327 | Ga0068855_1000143274 | 298 |
| 164 | 3300005563 | Ga0068855_100268898 | Ga0068855_1002688982 | 298 |
| 165 | 3300005578 | Ga0068854_100001665 | Ga0068854_10000166515 | 298 |
| 166 | 3300005614 | Ga0068856_100070663 | Ga0068856_1000706633 | 298 |
| 167 | 3300005614 | Ga0068856_100493521 | Ga0068856_1004935212 | 298 |
| 168 | 3300005615 | Ga0070702_100000240 | Ga0070702_10000024013 | 298 |
| 169 | 3300005617 | Ga0068859_100004628 | Ga0068859_10000462811 | 298 |
| 170 | 3300005617 | Ga0068859_100438005 | Ga0068859_1004380052 | 298 |
| 171 | 3300005618 | Ga0068864_100020253 | Ga0068864_1000202534 | 298 |
| 172 | 3300005718 | Ga0068866_10000744 | Ga0068866_100007446 | 298 |
| 173 | 3300005719 | Ga0068861_100000550 | Ga0068861_10000055014 | 298 |
| 174 | 3300005840 | Ga0068870_10125619 | Ga0068870_101256192 | 298 |
| 175 | 3300005842 | Ga0068858_100019276 | Ga0068858_1000192766 | 298 |
| 176 | 3300005843 | Ga0068860_100004596 | Ga0068860_1000045966 | 298 |
| 177 | 3300005843 | Ga0068860_100142192 | Ga0068860_1001421923 | 298 |
| 178 | 3300005844 | Ga0068862_100001897 | Ga0068862_10000189712 | 298 |
| 179 | 3300006173 | Ga0070716_100199712 | Ga0070716_1001997122 | 298 |
| 180 | 3300006237 | Ga0097621_100003980 | Ga0097621_1000039805 | 298 |
| 181 | 3300006358 | Ga0068871_100000788 | Ga0068871_10000078819 | 298 |
| 182 | 3300006852 | Ga0075433_10003313 | Ga0075433_1000331311 | 298 |
| 183 | 3300006852 | Ga0075433_10031717 | Ga0075433_100317175 | 298 |
| 184 | 3300006871 | Ga0075434_100001086 | Ga0075434_1000010867 | 298 |
| 185 | 3300006881 | Ga0068865_100001146 | Ga0068865_10000114612 | 298 |
| 186 | 3300006914 | Ga0075436_100000331 | Ga0075436_10000033117 | 298 |
| 187 | 3300006914 | Ga0075436_100006064 | Ga0075436_1000060646 | 298 |
| 188 | 3300006931 | Ga0097620_100004627 | Ga0097620_1000046276 | 298 |
| 189 | 3300006931 | Ga0097620_100437969 | Ga0097620_1004379692 | 298 |
| 190 | 3300007076 | Ga0075435_100000313 | Ga0075435_10000031323 | 298 |
| 191 | 3300007076 | Ga0075435_100001505 | Ga0075435_1000015054 | 298 |
| 192 | 3300009094 | Ga0111539_10010804 | Ga0111539_100108049 | 298 |
| 193 | 3300009098 | Ga0105245_10002454 | Ga0105245_100024546 | 298 |
| 194 | 3300009148 | Ga0105243_10000915 | Ga0105243_1000091515 | 298 |
| 195 | 3300009176 | Ga0105242_10000945 | Ga0105242_1000094517 | 298 |
| 196 | 3300009177 | Ga0105248_10050849 | Ga0105248_100508492 | 298 |
| 197 | 3300009553 | Ga0105249_10006665 | Ga0105249_100066655 | 298 |
| 198 | 3300010375 | Ga0105239_10090345 | Ga0105239_100903454 | 298 |
| 199 | 3300013297 | Ga0157378_10000844 | Ga0157378_1000084418 | 298 |
| 200 | 3300014745 | Ga0157377_10021544 | Ga0157377_100215444 | 298 |
| 201 | 3300014968 | Ga0157379_10048879 | Ga0157379_100488794 | 298 |
| 202 | 3300025899 | Ga0207642_10003273 | Ga0207642_100032735 | 298 |
| 203 | 3300025911 | Ga0207654_10024587 | Ga0207654_100245875 | 298 |
| 204 | 3300025912 | Ga0207707_10060845 | Ga0207707_100608454 | 298 |
| 205 | 3300025917 | Ga0207660_10035411 | Ga0207660_100354114 | 298 |
| 206 | 3300025918 | Ga0207662_10000233 | Ga0207662_1000023315 | 298 |
| 207 | 3300025921 | Ga0207652_10167337 | Ga0207652_101673373 | 298 |
| 208 | 3300025923 | Ga0207681_10129300 | Ga0207681_101293004 | 298 |
| 209 | 3300025927 | Ga0207687_10002722 | Ga0207687_100027227 | 298 |
| 210 | 3300025929 | Ga0207664_10097382 | Ga0207664_100973822 | 298 |
| 211 | 3300025934 | Ga0207686_10001496 | Ga0207686_1000149611 | 298 |
| 212 | 3300025935 | Ga0207709_10003455 | Ga0207709_1000345511 | 298 |
| 213 | 3300025936 | Ga0207670_10003031 | Ga0207670_1000303110 | 298 |
| 214 | 3300025936 | Ga0207670_10101953 | Ga0207670_101019532 | 298 |
| 215 | 3300025938 | Ga0207704_10000745 | Ga0207704_1000074512 | 298 |
| 216 | 3300025942 | Ga0207689_10002282 | Ga0207689_1000228213 | 298 |
| 217 | 3300025949 | Ga0207667_10013499 | Ga0207667_100134999 | 298 |
| 218 | 3300025961 | Ga0207712_10009194 | Ga0207712_100091945 | 298 |
| 219 | 3300025981 | Ga0207640_10087042 | Ga0207640_100870423 | 298 |
| 220 | 3300026035 | Ga0207703_10004183 | Ga0207703_1000418312 | 298 |
| 221 | 3300026078 | Ga0207702_10151914 | Ga0207702_101519142 | 298 |
| 222 | 3300026089 | Ga0207648_10004982 | Ga0207648_100049826 | 298 |
| 223 | 3300026095 | Ga0207676_10010920 | Ga0207676_100109205 | 298 |
| 224 | 3300026118 | Ga0207675_100001604 | Ga0207675_10000160416 | 298 |
| 225 | 3300027671 | Ga0209588_1031534 | Ga0209588_10315342 | 298 |
| 226 | 3300028380 | Ga0268265_10001521 | Ga0268265_1000152112 | 298 |
| 227 | 3300028381 | Ga0268264_10004412 | Ga0268264_1000441212 | 298 |
| 228 | 3300028381 | Ga0268264_10489059 | Ga0268264_104890592 | 298 |
| 229 | 3300041406 | Ga0439439_0011395 | Ga0439439_0011395_824_1723 | 298 |
| 230 | 3300041410 | Ga0439461_0001994 | Ga0439461_0001994_983_1882 | 298 |
| 231 | 3300042156 | Ga0439446_0008907 | Ga0439446_0008907_593_1492 | 298 |
| 232 | 3300042435 | Ga0439434_0002340 | Ga0439434_0002340_884_1783 | 298 |
| 233 | 3300042436 | Ga0439435_0000298 | Ga0439435_0000298_2510_3409 | 298 |
| 234 | 3300049587 | Ga0501071_0302355 | Ga0501071_0302355_37_936 | 298 |
| 235 | 3300050511 | nmdc:mga08y16_26065_c1 | nmdc:mga08y16_26065_c1_3453_4355 | 298 |
| 236 | 3300050512 | nmdc:mga0n895_2878_c1 | nmdc:mga0n895_2878_c1_6898_7800 | 298 |
| 237 | 3300050513 | nmdc:mga0rr50_29920_c1 | nmdc:mga0rr50_29920_c1_1469_2368 | 298 |
| 238 | 3300050513 | nmdc:mga0rr50_3552_c1 | nmdc:mga0rr50_3552_c1_2273_3175 | 298 |
| 239 | 3300050514 | nmdc:mga08x19_1254_c1 | nmdc:mga08x19_1254_c1_10680_11579 | 298 |
| 240 | 3300050514 | nmdc:mga08x19_28357_c1 | nmdc:mga08x19_28357_c1_1071_1973 | 298 |
| 241 | 3300050515 | nmdc:mga0a205_38169_c1 | nmdc:mga0a205_38169_c1_1456_2355 | 298 |
| 242 | 3300005356 | Ga0070674_100082759 | Ga0070674_1000827594 | 299 |
| 243 | 3300005547 | Ga0070693_100025937 | Ga0070693_1000259372 | 299 |
| 244 | 3300005614 | Ga0068856_100630919 | Ga0068856_1006309192 | 299 |
| 245 | 3300005719 | Ga0068861_100289981 | Ga0068861_1002899812 | 299 |
| 246 | 3300025909 | Ga0207705_10238455 | Ga0207705_102384552 | 299 |
| 247 | 3300025923 | Ga0207681_10229693 | Ga0207681_102296932 | 299 |
| 248 | 3300026075 | Ga0207708_10017293 | Ga0207708_100172936 | 299 |
| 249 | 3300026089 | Ga0207648_10042404 | Ga0207648_100424043 | 299 |
| 250 | 3300026118 | Ga0207675_100055101 | Ga0207675_1000551013 | 299 |
| 251 | 3300046615 | Ga0495656_0080564 | Ga0495656_0080564_259_1167 | 300 |
| 252 | 3300047445 | Ga0495677_0046570 | Ga0495677_0046570_219_1127 | 300 |
| 253 | 3300005345 | Ga0070692_10064389 | Ga0070692_100643892 | 301 |
| 254 | 3300005365 | Ga0070688_100244564 | Ga0070688_1002445642 | 301 |
| 255 | 3300005437 | Ga0070710_10035173 | Ga0070710_100351734 | 301 |
| 256 | 3300005546 | Ga0070696_100000434 | Ga0070696_10000043419 | 301 |
| 257 | 3300005617 | Ga0068859_100030356 | Ga0068859_1000303564 | 301 |
| 258 | 3300006163 | Ga0070715_10022627 | Ga0070715_100226272 | 301 |
| 259 | 3300006173 | Ga0070716_100115001 | Ga0070716_1001150012 | 301 |
| 260 | 3300006931 | Ga0097620_100030355 | Ga0097620_1000303554 | 301 |
| 261 | 3300009094 | Ga0111539_10029052 | Ga0111539_100290523 | 301 |
| 262 | 3300026075 | Ga0207708_10278861 | Ga0207708_102788611 | 301 |
| 263 | 3300026116 | Ga0207674_10287042 | Ga0207674_102870422 | 301 |
| 264 | 3300031731 | Ga0307405_10165382 | Ga0307405_101653822 | 301 |
| 265 | 3300035111 | Ga0373923_0103521 | Ga0373923_0103521_301_1212 | 301 |
| 266 | 3300035172 | Ga0373955_0068010 | Ga0373955_0068010_635_1546 | 301 |
| 267 | 3300035410 | Ga0373924_0004096 | Ga0373924_0004096_1725_2636 | 301 |
| 268 | 3300035692 | Ga0373935_0027855 | Ga0373935_0027855_1407_2333 | 301 |
| 269 | 3300035724 | Ga0373933_0078639 | Ga0373933_0078639_234_1145 | 301 |
| 270 | 3300036401 | Ga0373937_0019305 | Ga0373937_0019305_4650_5561 | 301 |
| 271 | 3300042437 | Ga0439444_0003491 | Ga0439444_0003491_1005_1913 | 301 |
| 272 | 3300042461 | Ga0439460_0000925 | Ga0439460_0000925_5719_6627 | 301 |
| 273 | 3300046536 | Ga0495587_0127898 | Ga0495587_0127898_282_1193 | 301 |
| 274 | 3300046663 | Ga0495635_0054819 | Ga0495635_0054819_216_1127 | 301 |
| 275 | 3300046684 | Ga0495669_0031323 | Ga0495669_0031323_18_926 | 301 |
| 276 | 3300047322 | Ga0495680_0081836 | Ga0495680_0081836_269_1180 | 301 |
| 277 | 3300049572 | Ga0501036_0015984 | Ga0501036_0015984_1337_2248 | 301 |
| 278 | 3300049572 | Ga0501036_0188526 | Ga0501036_0188526_42_950 | 301 |
| 279 | 3300049574 | Ga0501038_0023765 | Ga0501038_0023765_4550_5461 | 301 |
| 280 | 3300049575 | Ga0501039_0001773 | Ga0501039_0001773_819_1730 | 301 |
| 281 | 3300049576 | Ga0501040_0007299 | Ga0501040_0007299_782_1693 | 301 |
| 282 | 3300049576 | Ga0501040_0039258 | Ga0501040_0039258_13_921 | 301 |
| 283 | 3300049576 | Ga0501040_0094727 | Ga0501040_0094727_930_1838 | 301 |
| 284 | 3300049577 | Ga0501041_0005336 | Ga0501041_0005336_5425_6336 | 301 |
| 285 | 3300049578 | Ga0501042_0119476 | Ga0501042_0119476_589_1500 | 301 |
| 286 | 3300049579 | Ga0501043_0024926 | Ga0501043_0024926_1258_2169 | 301 |
| 287 | 3300049580 | Ga0501046_0010010 | Ga0501046_0010010_6492_7403 | 301 |
| 288 | 3300049581 | Ga0501047_0105949 | Ga0501047_0105949_502_1413 | 301 |
| 289 | 3300049582 | Ga0501048_0018634 | Ga0501048_0018634_3466_4377 | 301 |
| 290 | 3300049582 | Ga0501048_0061189 | Ga0501048_0061189_93_1001 | 301 |
| 291 | 3300049584 | Ga0501068_0015374 | Ga0501068_0015374_745_1656 | 301 |
| 292 | 3300049586 | Ga0501070_0036084 | Ga0501070_0036084_2330_3241 | 301 |
| 293 | 3300049587 | Ga0501071_0088612 | Ga0501071_0088612_149_1060 | 301 |
| 294 | 3300049588 | Ga0501072_0010678 | Ga0501072_0010678_5341_6252 | 301 |
| 295 | 3300049588 | Ga0501072_0162753 | Ga0501072_0162753_74_982 | 301 |
| 296 | 3300049590 | Ga0501074_0046047 | Ga0501074_0046047_1035_1946 | 301 |
| 297 | 3300049591 | Ga0501075_0021793 | Ga0501075_0021793_1335_2246 | 301 |
| 298 | 3300049592 | Ga0501076_0008694 | Ga0501076_0008694_4722_5633 | 301 |
| 299 | 3300049592 | Ga0501076_0204018 | Ga0501076_0204018_184_1092 | 301 |
| 300 | 3300049593 | Ga0501077_0007614 | Ga0501077_0007614_582_1493 | 301 |
| 301 | 3300049741 | Ga0501079_0006780 | Ga0501079_0006780_2220_3131 | 301 |
| 302 | 3300049743 | Ga0501081_0008922 | Ga0501081_0008922_1032_1943 | 301 |
| 303 | 3300049823 | Ga0501044_0101963 | Ga0501044_0101963_938_1849 | 301 |
| 304 | 3300049824 | Ga0501045_0007193 | Ga0501045_0007193_6676_7587 | 301 |
| 305 | 3300050508 | nmdc:mga09592_231218_c1 | nmdc:mga09592_231218_c1_107_1015 | 301 |
| 306 | 3300050509 | nmdc:mga0qj67_37322_c1 | nmdc:mga0qj67_37322_c1_682_1590 | 301 |
| 307 | 3300050510 | nmdc:mga06r32_214799_c1 | nmdc:mga06r32_214799_c1_427_1335 | 301 |
| 308 | 3300050511 | nmdc:mga08y16_339465_c1 | nmdc:mga08y16_339465_c1_149_1057 | 301 |
| 309 | 3300050511 | nmdc:mga08y16_50051_c1 | nmdc:mga08y16_50051_c1_1556_2464 | 301 |
| 310 | 3300054114 | Ga0501084_0012554 | Ga0501084_0012554_4360_5271 | 301 |
| 311 | 3300060353 | Ga0501082_0011010 | Ga0501082_0011010_4540_5451 | 301 |
| 312 | 3300061734 | Ga0530510_0009286 | Ga0530510_0009286_4335_5246 | 301 |
| 313 | 3300005329 | Ga0070683_100061448 | Ga0070683_1000614483 | 302 |
| 314 | 3300005336 | Ga0070680_100187069 | Ga0070680_1001870692 | 302 |
| 315 | 3300005345 | Ga0070692_10133733 | Ga0070692_101337332 | 302 |
| 316 | 3300005347 | Ga0070668_100016473 | Ga0070668_1000164732 | 302 |
| 317 | 3300005353 | Ga0070669_100000706 | Ga0070669_10000070613 | 302 |
| 318 | 3300005441 | Ga0070700_100000507 | Ga0070700_10000050713 | 302 |
| 319 | 3300005444 | Ga0070694_100264029 | Ga0070694_1002640292 | 302 |
| 320 | 3300005459 | Ga0068867_100000699 | Ga0068867_1000006996 | 302 |
| 321 | 3300005535 | Ga0070684_100027873 | Ga0070684_1000278734 | 302 |
| 322 | 3300005544 | Ga0070686_100029699 | Ga0070686_1000296992 | 302 |
| 323 | 3300005615 | Ga0070702_100104077 | Ga0070702_1001040772 | 302 |
| 324 | 3300005718 | Ga0068866_10139903 | Ga0068866_101399031 | 302 |
| 325 | 3300005719 | Ga0068861_100005956 | Ga0068861_1000059567 | 302 |
| 326 | 3300005844 | Ga0068862_100011352 | Ga0068862_1000113529 | 302 |
| 327 | 3300005844 | Ga0068862_100059122 | Ga0068862_1000591224 | 302 |
| 328 | 3300006237 | Ga0097621_100004795 | Ga0097621_1000047954 | 302 |
| 329 | 3300006881 | Ga0068865_100028303 | Ga0068865_1000283035 | 302 |
| 330 | 3300009148 | Ga0105243_10057436 | Ga0105243_100574363 | 302 |
| 331 | 3300009553 | Ga0105249_10000975 | Ga0105249_1000097513 | 302 |
| 332 | 3300014326 | Ga0157380_10002048 | Ga0157380_100020482 | 302 |
| 333 | 3300025907 | Ga0207645_10068706 | Ga0207645_100687062 | 302 |
| 334 | 3300025917 | Ga0207660_10096010 | Ga0207660_100960102 | 302 |
| 335 | 3300025923 | Ga0207681_10001251 | Ga0207681_100012516 | 302 |
| 336 | 3300025935 | Ga0207709_10033946 | Ga0207709_100339464 | 302 |
| 337 | 3300025938 | Ga0207704_10002119 | Ga0207704_100021198 | 302 |
| 338 | 3300025961 | Ga0207712_10002814 | Ga0207712_1000281410 | 302 |
| 339 | 3300025972 | Ga0207668_10010738 | Ga0207668_100107382 | 302 |
| 340 | 3300026075 | Ga0207708_10007988 | Ga0207708_100079887 | 302 |
| 341 | 3300026089 | Ga0207648_10002355 | Ga0207648_1000235512 | 302 |
| 342 | 3300026118 | Ga0207675_100003839 | Ga0207675_1000038397 | 302 |
| 343 | 3300027907 | Ga0207428_10218888 | Ga0207428_102188882 | 302 |
| 344 | 3300028380 | Ga0268265_10003807 | Ga0268265_100038077 | 302 |
| 345 | 3300028380 | Ga0268265_10248679 | Ga0268265_102486791 | 302 |
| 346 | 3300034957 | Ga0373938_0018517 | Ga0373938_0018517_439_1353 | 302 |
| 347 | 3300035241 | Ga0373961_0004471 | Ga0373961_0004471_1372_2286 | 302 |
| 348 | 3300050511 | nmdc:mga08y16_72387_c1 | nmdc:mga08y16_72387_c1_2113_3021 | 302 |
| 349 | 3300046664 | Ga0495659_0094249 | Ga0495659_0094249_54_968 | 303 |
| 350 | 3300005328 | Ga0070676_10025548 | Ga0070676_100255484 | 304 |
| 351 | 3300005338 | Ga0068868_100001331 | Ga0068868_1000013316 | 304 |
| 352 | 3300005354 | Ga0070675_100006313 | Ga0070675_1000063132 | 304 |
| 353 | 3300005354 | Ga0070675_100135561 | Ga0070675_1001355612 | 304 |
| 354 | 3300005364 | Ga0070673_100230105 | Ga0070673_1002301052 | 304 |
| 355 | 3300005441 | Ga0070700_100000666 | Ga0070700_1000006666 | 304 |
| 356 | 3300005456 | Ga0070678_100208077 | Ga0070678_1002080772 | 304 |
| 357 | 3300006844 | Ga0075428_100001002 | Ga0075428_10000100225 | 304 |
| 358 | 3300006880 | Ga0075429_100000051 | Ga0075429_10000005128 | 304 |
| 359 | 3300009147 | Ga0114129_10000337 | Ga0114129_1000033731 | 304 |
| 360 | 3300025916 | Ga0207663_10274654 | Ga0207663_102746542 | 304 |
| 361 | 3300025926 | Ga0207659_10141849 | Ga0207659_101418492 | 304 |
| 362 | 3300025942 | Ga0207689_10087091 | Ga0207689_100870913 | 304 |
| 363 | 3300026023 | Ga0207677_10006472 | Ga0207677_100064726 | 304 |
| 364 | 3300026075 | Ga0207708_10000625 | Ga0207708_100006256 | 304 |
| 365 | 3300026121 | Ga0207683_10084047 | Ga0207683_100840473 | 304 |
| 366 | 3300027907 | Ga0207428_10000610 | Ga0207428_1000061024 | 304 |
| 367 | 3300035111 | Ga0373923_0029072 | Ga0373923_0029072_1047_1979 | 304 |
| 368 | 3300035116 | Ga0373945_0004344 | Ga0373945_0004344_3352_4284 | 304 |
| 369 | 3300035691 | Ga0373931_0022311 | Ga0373931_0022311_622_1554 | 304 |
| 370 | 3300045051 | Ga0451576_0015696 | Ga0451576_0015696_2354_3286 | 304 |
| 371 | 3300050507 | nmdc:mga05p37_758_c1 | nmdc:mga05p37_758_c1_20850_21782 | 304 |
| 372 | 3300050511 | nmdc:mga08y16_7868_c1 | nmdc:mga08y16_7868_c1_4408_5340 | 304 |
| 373 | 3300050515 | nmdc:mga0a205_179852_c1 | nmdc:mga0a205_179852_c1_878_1810 | 304 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3byp-assembly1.cif.gz_B | mode of action of a putative zinc transporter czrb | 0.8999 | 213 | 290 |
| 6vda-assembly1.cif.gz_A-2 | metal-bound c-terminal domain of czcd transporter from thermotoga maritima | 0.8864 | 216 | 294 |
| 3byr-assembly1.cif.gz_A-2 | mode of action of a putative zinc transporter czrb (zn form) | 0.8712 | 212 | 293 |
| 6qfj-assembly4.cif.gz_D | mamb ctd magnetosome protein [desulfamplus magnetovallimortis bw-1] | 0.857 | 219 | 293 |
| 3byp-assembly1.cif.gz_B | mode of action of a putative zinc transporter czrb | 0.8498 | 213 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bypB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain | 0.8999 | 213 | 290 | 3.30.70.1350 |
| af_H2KZN1_58_251_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.8929 | 13 | 205 | 1.20.1510.10 |
| 3h90D02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain | 0.8888 | 210 | 292 | 3.30.70.1350 |
| af_Q9SAJ7_113_306_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.8774 | 14 | 205 | 1.20.1510.10 |
| af_I1L2V9_320_399_3.30.70.1350 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain | 0.8757 | 235 | 293 | 3.30.70.1350 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A842YK29-F1-model_v4 | Cation diffusion facilitator family transporter | 0.9504 | 9 | 147 |
GO:0005886
GO:0006882 GO:0015086 GO:0015093 GO:0015341 |
| AF-A0A842YK29-F1-model_v4 | Cation diffusion facilitator family transporter | 0.9374 | 9 | 147 |
GO:0005886
GO:0006882 GO:0015086 GO:0015093 GO:0015341 |
| AF-A0A350KBH1-F1-model_v4 | deleted | 0.9194 | 8 | 205 |
|
| AF-A0A6J4HL08-F1-model_v4 | Cobalt-zinc-cadmium resistance protein | 0.9188 | 158 | 299 |
GO:0005886
GO:0006882 GO:0015086 GO:0015093 GO:0015341 |
| AF-A0A2W4K2G7-F1-model_v4 | Cation-efflux pump | 0.9168 | 192 | 304 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar