F426252

General Info

Members Datasets Scaffolds Average Seq Length
373 205 373 298

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100001331|Ga0068868_1000013316
Length 310
Sequence MESRPPPGLSRSTYLERFAWLSIAAALATIALKTLAWWLTGSVGLLSDALESLVNLVAAVLALSMLRLAATPPDDEYPHGLSKAEYLSAGIEGALIVLAAAGILYTAIPRLVSPQPIDAPFLGLGISFAASLINLGAALVLIRAGKRYDSITLEADGKHLMTDVWTSAGVIVGVALVFLTGWLRLDPLVALAVALHIVWTGVGLVRRSVAGLLDAAIVPGEQAEVTKIFSEYGQRYAVKFHAFRTRRAGVRRFISFHLLVPDEWSVQRAHQLSEEIEERIRELVPSSAILVHIEPISDPASYDDETLDRM

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
145 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 99.46
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10025548 3300005328 Bacteria 3339
2 Ga0070676_10295990 3300005328 Bacteria 1095
3 Ga0070683_100061448 3300005329 Bacteria 3494
4 Ga0070690_100001754 3300005330 Bacteria 11471
5 Ga0070690_100010245 3300005330 Bacteria 5449
6 Ga0068869_100001435 3300005334 Bacteria 14129
7 Ga0070680_100000789 3300005336 Bacteria 22263
8 Ga0070680_100187069 3300005336 Bacteria 1745
9 Ga0070682_100006636 3300005337 Bacteria 6490
10 Ga0068868_100001331 3300005338 Bacteria 17036
11 Ga0070689_100000776 3300005340 Bacteria 19580
12 Ga0070689_100016468 3300005340 Bacteria 5411
13 Ga0070691_10034785 3300005341 Bacteria 2372
14 Ga0070687_100000436 3300005343 Bacteria 14119
15 Ga0070692_10000910 3300005345 Bacteria 10019
16 Ga0070692_10064389 3300005345 Bacteria 1939
17 Ga0070692_10133733 3300005345 Bacteria 1397
18 Ga0070668_100016473 3300005347 Bacteria 5527
19 Ga0070669_100000706 3300005353 Bacteria 24466
20 Ga0070669_100366050 3300005353 Bacteria 1173
21 Ga0070675_100006313 3300005354 Bacteria 9098
22 Ga0070675_100135561 3300005354 Bacteria 2101
23 Ga0070671_100386060 3300005355 Bacteria 1197
24 Ga0070674_100082759 3300005356 Bacteria 2297
25 Ga0070673_100155395 3300005364 Bacteria 1941
26 Ga0070673_100230105 3300005364 Bacteria 1608
27 Ga0070673_100279725 3300005364 Bacteria 1463
28 Ga0070688_100244564 3300005365 Bacteria 1275
29 Ga0070659_100025292 3300005366 Bacteria 4557
30 Ga0070714_100189338 3300005435 Unclassified 1876
31 Ga0070714_100566006 3300005435 Bacteria 1089
32 Ga0070710_10035173 3300005437 Bacteria 2730
33 Ga0070705_100001008 3300005440 Bacteria 15668
34 Ga0070705_100004118 3300005440 Bacteria 7103
35 Ga0070705_100109798 3300005440 Bacteria 1760
36 Ga0070705_100357512 3300005440 Bacteria 1067
37 Ga0070700_100000507 3300005441 Bacteria 19399
38 Ga0070700_100000666 3300005441 Bacteria 16998
39 Ga0070694_100001273 3300005444 Bacteria 14642
40 Ga0070694_100025787 3300005444 Bacteria 3806
41 Ga0070694_100091982 3300005444 Bacteria 2130
42 Ga0070694_100127107 3300005444 Bacteria 1836
43 Ga0070694_100264029 3300005444 Bacteria 1307
44 Ga0070694_100334051 3300005444 Bacteria 1170
45 Ga0070678_100208077 3300005456 Bacteria 1619
46 Ga0070681_10000235 3300005458 Bacteria 43570
47 Ga0070681_10023162 3300005458 Bacteria 6247
48 Ga0068867_100000699 3300005459 Bacteria 22369
49 Ga0068867_100001386 3300005459 Bacteria 16761
50 Ga0070707_100380538 3300005468 Bacteria 1371
51 Ga0070699_100002487 3300005518 Bacteria 16563
52 Ga0070679_100014967 3300005530 Bacteria 7453
53 Ga0070679_100034557 3300005530 Bacteria 5011
54 Ga0070684_100027873 3300005535 Bacteria 4772
55 Ga0070697_100001807 3300005536 Bacteria 16334
56 Ga0070697_100003810 3300005536 Bacteria 11585
57 Ga0070672_100209013 3300005543 Bacteria 1634
58 Ga0070686_100002450 3300005544 Bacteria 10226
59 Ga0070686_100029699 3300005544 Bacteria 3328
60 Ga0070686_100036261 3300005544 Bacteria 3052
61 Ga0070695_100000113 3300005545 Bacteria 35966
62 Ga0070695_100037915 3300005545 Bacteria 3039
63 Ga0070695_100103228 3300005545 Bacteria 1923
64 Ga0070695_100125563 3300005545 Bacteria 1761
65 Ga0070695_100179345 3300005545 Bacteria 1500
66 Ga0070696_100000434 3300005546 Bacteria 26295
67 Ga0070696_100002261 3300005546 Bacteria 12697
68 Ga0070696_100002633 3300005546 Bacteria 11898
69 Ga0070693_100000209 3300005547 Bacteria 27275
70 Ga0070693_100025937 3300005547 Bacteria 3158
71 Ga0070704_100001744 3300005549 Bacteria 11877
72 Ga0070704_100062396 3300005549 Bacteria 2671
73 Ga0070704_100283045 3300005549 Bacteria 1375
74 Ga0070704_100417511 3300005549 Bacteria 1148
75 Ga0068855_100014327 3300005563 Bacteria 9547
76 Ga0068855_100268898 3300005563 Bacteria 1896
77 Ga0068854_100001665 3300005578 Bacteria 13528
78 Ga0068854_100197919 3300005578 Bacteria 1578
79 Ga0068856_100070663 3300005614 Bacteria 3454
80 Ga0068856_100123983 3300005614 Bacteria 2586
81 Ga0068856_100493521 3300005614 Unclassified 1245
82 Ga0068856_100630919 3300005614 Bacteria 1092
83 Ga0070702_100000240 3300005615 Bacteria 18563
84 Ga0070702_100104077 3300005615 Bacteria 1747
85 Ga0068859_100004628 3300005617 Bacteria 14018
86 Ga0068859_100030356 3300005617 Bacteria 5423
87 Ga0068859_100438005 3300005617 Unclassified 1403
88 Ga0068864_100020253 3300005618 Bacteria 5564
89 Ga0068866_10000744 3300005718 Bacteria 14729
90 Ga0068866_10139903 3300005718 Bacteria 1388
91 Ga0068861_100000550 3300005719 Bacteria 22119
92 Ga0068861_100005956 3300005719 Bacteria 8281
93 Ga0068861_100289981 3300005719 Bacteria 1413
94 Ga0068870_10125619 3300005840 Bacteria 1483
95 Ga0068858_100019276 3300005842 Bacteria 6379
96 Ga0068860_100004596 3300005843 Bacteria 14092
97 Ga0068860_100142192 3300005843 Bacteria 2307
98 Ga0068862_100001897 3300005844 Bacteria 18976
99 Ga0068862_100011352 3300005844 Bacteria 7356
100 Ga0068862_100059122 3300005844 Bacteria 3290
101 Ga0081539_10000799 3300005985 Bacteria 61195
102 Ga0070715_10022627 3300006163 Bacteria 2453
103 Ga0070716_100115001 3300006173 Bacteria 1674
104 Ga0070716_100199712 3300006173 Bacteria 1328
105 Ga0097621_100003980 3300006237 Bacteria 10238
106 Ga0097621_100004795 3300006237 Bacteria 9465
107 Ga0068871_100000788 3300006358 Bacteria 21290
108 Ga0068871_100001073 3300006358 Bacteria 18331
109 Ga0075428_100001002 3300006844 Bacteria 29936
110 Ga0075428_100015891 3300006844 Bacteria 8329
111 Ga0075431_100100692 3300006847 Bacteria 2981
112 Ga0075431_100156399 3300006847 Bacteria 2345
113 Ga0075433_10003313 3300006852 Bacteria 12441
114 Ga0075433_10031717 3300006852 Bacteria 4519
115 Ga0075433_10232468 3300006852 Bacteria 1637
116 Ga0075434_100000004 3300006871 Bacteria 112839
117 Ga0075434_100001086 3300006871 Bacteria 22255
118 Ga0075434_100003417 3300006871 Bacteria 14208
119 Ga0075434_100133325 3300006871 Bacteria 2503
120 Ga0075429_100000051 3300006880 Bacteria 55896
121 Ga0075429_100004984 3300006880 Bacteria 11437
122 Ga0075429_100009199 3300006880 Bacteria 8578
123 Ga0068865_100001146 3300006881 Bacteria 15365
124 Ga0068865_100028303 3300006881 Bacteria 3709
125 Ga0075436_100000331 3300006914 Bacteria 30168
126 Ga0075436_100006064 3300006914 Bacteria 8296
127 Ga0075436_100026757 3300006914 Bacteria 3971
128 Ga0075436_100027975 3300006914 Bacteria 3881
129 Ga0075436_100101005 3300006914 Unclassified 2009
130 Ga0097620_100004627 3300006931 Bacteria 14018
131 Ga0097620_100030355 3300006931 Bacteria 5423
132 Ga0097620_100437969 3300006931 Unclassified 1403
133 Ga0075435_100000313 3300007076 Bacteria 29845
134 Ga0075435_100001505 3300007076 Bacteria 14975
135 Ga0075435_100016338 3300007076 Bacteria 5595
136 Ga0075435_100034552 3300007076 Bacteria 4007
137 Ga0075435_100060751 3300007076 Bacteria 3065
138 Ga0099794_10014482 3300007265 Bacteria 3456
139 Ga0111539_10010804 3300009094 Bacteria 11495
140 Ga0111539_10029052 3300009094 Bacteria 6741
141 Ga0111539_10345681 3300009094 Bacteria 1731
142 Ga0105245_10002454 3300009098 Bacteria 16760
143 Ga0114129_10000337 3300009147 Bacteria 54884
144 Ga0114129_10050786 3300009147 Bacteria 5824
145 Ga0114129_10758253 3300009147 Bacteria 1242
146 Ga0114129_10955375 3300009147 Bacteria 1082
147 Ga0105243_10000915 3300009148 Bacteria 27703
148 Ga0105243_10057436 3300009148 Bacteria 3099
149 Ga0105242_10000945 3300009176 Bacteria 22671
150 Ga0105248_10050849 3300009177 Bacteria 4649
151 Ga0105249_10000975 3300009553 Bacteria 25356
152 Ga0105249_10006665 3300009553 Bacteria 10054
153 Ga0105239_10090345 3300010375 Bacteria 3379
154 Ga0157378_10000844 3300013297 Bacteria 28388
155 Ga0157380_10002048 3300014326 Bacteria 13485
156 Ga0157377_10021544 3300014745 Bacteria 3391
157 Ga0157379_10048879 3300014968 Bacteria 3776
158 Ga0157376_10033005 3300014969 Bacteria 4164
159 Ga0207642_10003273 3300025899 Bacteria 5094
160 Ga0207688_10142738 3300025901 Bacteria 1410
161 Ga0207645_10068706 3300025907 Bacteria 2266
162 Ga0207643_10124455 3300025908 Bacteria 1530
163 Ga0207705_10238455 3300025909 Bacteria 1385
164 Ga0207654_10024587 3300025911 Bacteria 3240
165 Ga0207707_10060845 3300025912 Bacteria 3285
166 Ga0207663_10274654 3300025916 Bacteria 1250
167 Ga0207660_10035411 3300025917 Bacteria 3466
168 Ga0207660_10096010 3300025917 Bacteria 2206
169 Ga0207662_10000233 3300025918 Bacteria 25755
170 Ga0207662_10070071 3300025918 Bacteria 2120
171 Ga0207662_10091796 3300025918 Bacteria 1869
172 Ga0207662_10240421 3300025918 Bacteria 1185
173 Ga0207652_10167337 3300025921 Bacteria 1972
174 Ga0207681_10001251 3300025923 Bacteria 16395
175 Ga0207681_10129300 3300025923 Bacteria 1865
176 Ga0207681_10229693 3300025923 Bacteria 1440
177 Ga0207659_10141849 3300025926 Bacteria 1866
178 Ga0207687_10002722 3300025927 Bacteria 11964
179 Ga0207664_10097382 3300025929 Bacteria 2423
180 Ga0207690_10134065 3300025932 Bacteria 1816
181 Ga0207686_10001496 3300025934 Bacteria 13174
182 Ga0207709_10003455 3300025935 Bacteria 9382
183 Ga0207709_10033946 3300025935 Bacteria 3002
184 Ga0207670_10003031 3300025936 Bacteria 8859
185 Ga0207670_10101953 3300025936 Unclassified 2051
186 Ga0207704_10000745 3300025938 Bacteria 14317
187 Ga0207704_10002119 3300025938 Bacteria 8893
188 Ga0207704_10125860 3300025938 Bacteria 1764
189 Ga0207665_10108036 3300025939 Bacteria 1952
190 Ga0207691_10167530 3300025940 Bacteria 1925
191 Ga0207689_10002282 3300025942 Bacteria 17945
192 Ga0207689_10087091 3300025942 Bacteria 2566
193 Ga0207667_10013499 3300025949 Bacteria 9341
194 Ga0207712_10002814 3300025961 Bacteria 11139
195 Ga0207712_10009194 3300025961 Bacteria 6259
196 Ga0207668_10010738 3300025972 Bacteria 5543
197 Ga0207640_10087042 3300025981 Bacteria 2153
198 Ga0207677_10006472 3300026023 Bacteria 6430
199 Ga0207703_10004183 3300026035 Bacteria 11897
200 Ga0207708_10000625 3300026075 Bacteria 27213
201 Ga0207708_10007988 3300026075 Bacteria 7838
202 Ga0207708_10017293 3300026075 Bacteria 5428
203 Ga0207708_10278861 3300026075 Bacteria 1354
204 Ga0207702_10115507 3300026078 Bacteria 2394
205 Ga0207702_10151914 3300026078 Bacteria 2107
206 Ga0207648_10002355 3300026089 Bacteria 20391
207 Ga0207648_10004982 3300026089 Bacteria 13500
208 Ga0207648_10042404 3300026089 Bacteria 3994
209 Ga0207676_10010920 3300026095 Bacteria 6480
210 Ga0207674_10287042 3300026116 Bacteria 1594
211 Ga0207674_10358849 3300026116 Bacteria 1409
212 Ga0207675_100001604 3300026118 Bacteria 22664
213 Ga0207675_100003839 3300026118 Bacteria 14619
214 Ga0207675_100055101 3300026118 Bacteria 3709
215 Ga0207683_10084047 3300026121 Bacteria 2829
216 Ga0207683_10130387 3300026121 Bacteria 2261
217 Ga0209969_1009078 3300027360 Bacteria 1413
218 Ga0209970_1014334 3300027614 Bacteria 1317
219 Ga0209588_1031534 3300027671 Bacteria 1696
220 Ga0209588_1045292 3300027671 Bacteria 1423
221 Ga0209974_10012266 3300027876 Bacteria 2868
222 Ga0207428_10000610 3300027907 Bacteria 42207
223 Ga0207428_10218888 3300027907 Bacteria 1428
224 Ga0268265_10001521 3300028380 Bacteria 19348
225 Ga0268265_10003807 3300028380 Bacteria 10690
226 Ga0268265_10248679 3300028380 Bacteria 1573
227 Ga0268264_10004412 3300028381 Bacteria 12005
228 Ga0268264_10489059 3300028381 Unclassified 1198
229 Ga0307405_10165382 3300031731 Bacteria 1572
230 Ga0307407_10002261 3300031903 Bacteria 7453
231 Ga0307416_100385910 3300032002 Bacteria 1433
232 Ga0373930_0008326 3300034816 Bacteria 1814
233 Ga0373948_0001182 3300034817 Bacteria 3541
234 Ga0373938_0018517 3300034957 Bacteria 1382
235 Ga0373926_0006970 3300035083 Bacteria 3758
236 Ga0373928_0011654 3300035084 Bacteria 1744
237 Ga0373949_0009810 3300035090 Bacteria 2096
238 Ga0373923_0029072 3300035111 Bacteria 2215
239 Ga0373923_0103521 3300035111 Bacteria 1258
240 Ga0373941_0088460 3300035115 Bacteria 1058
241 Ga0373945_0004344 3300035116 Bacteria 4500
242 Ga0373954_0000965 3300035118 Bacteria 11269
243 Ga0373943_0011505 3300035170 Bacteria 3982
244 Ga0373955_0068010 3300035172 Bacteria 1984
245 Ga0373942_0005937 3300035207 Bacteria 2823
246 Ga0373942_0007956 3300035207 Bacteria 2465
247 Ga0373961_0004471 3300035241 Bacteria 3380
248 Ga0373924_0004096 3300035410 Bacteria 5072
249 Ga0373924_0058051 3300035410 Bacteria 1615
250 Ga0373931_0000627 3300035691 Bacteria 14664
251 Ga0373931_0022311 3300035691 Bacteria 3185
252 Ga0373931_0045002 3300035691 Bacteria 2329
253 Ga0373935_0027855 3300035692 Bacteria 3492
254 Ga0373935_0059590 3300035692 Bacteria 2440
255 Ga0373933_0034162 3300035724 Bacteria 2962
256 Ga0373933_0078639 3300035724 Bacteria 2018
257 Ga0373937_0001198 3300036401 Bacteria 21774
258 Ga0373937_0019305 3300036401 Bacteria 6100
259 Ga0439439_0011395 3300041406 Bacteria 2139
260 Ga0439461_0001994 3300041410 Bacteria 3229
261 Ga0451807_0724457 3300041486 Bacteria 2998
262 Ga0451853_1635946 3300041512 Bacteria 826
263 Ga0439446_0008907 3300042156 Bacteria 2676
264 Ga0439434_0002340 3300042435 Bacteria 5514
265 Ga0439435_0000298 3300042436 Bacteria 7381
266 Ga0439435_0003881 3300042436 Bacteria 3163
267 Ga0439444_0003491 3300042437 Bacteria 2224
268 Ga0439460_0000925 3300042461 Bacteria 6709
269 Ga0439460_0007765 3300042461 Bacteria 2692
270 Ga0451576_0008492 3300045051 Bacteria 12050
271 Ga0451576_0015696 3300045051 Bacteria 8384
272 Ga0451576_0208169 3300045051 Bacteria 2042
273 Ga0495592_0078922 3300046454 Bacteria 2384
274 Ga0495629_0097763 3300046459 Bacteria 2048
275 Ga0495580_0065502 3300046472 Bacteria 2544
276 Ga0495662_0002396 3300046476 Bacteria 9424
277 Ga0495594_0037288 3300046499 Bacteria 2652
278 Ga0495630_0355330 3300046517 Bacteria 1121
279 Ga0495586_0134130 3300046535 Bacteria 1387
280 Ga0495587_0127898 3300046536 Bacteria 1453
281 Ga0495656_0080564 3300046615 Bacteria 1468
282 Ga0495635_0054819 3300046663 Bacteria 2746
283 Ga0495635_0118892 3300046663 Bacteria 1803
284 Ga0495659_0094249 3300046664 Bacteria 1153
285 Ga0495647_0007364 3300046681 Bacteria 3683
286 Ga0495658_0002184 3300046683 Bacteria 9894
287 Ga0495669_0031323 3300046684 Bacteria 2336
288 Ga0495669_0056823 3300046684 Bacteria 1764
289 Ga0495581_0072641 3300047315 Bacteria 1991
290 Ga0495581_0249769 3300047315 Bacteria 1037
291 Ga0495680_0081836 3300047322 Bacteria 2437
292 Ga0495677_0046570 3300047445 Bacteria 1592
293 Ga0495593_0148868 3300047673 Bacteria 1184
294 Ga0501036_0015984 3300049572 Bacteria 6268
295 Ga0501036_0188526 3300049572 Bacteria 1735
296 Ga0501038_0023765 3300049574 Bacteria 5476
297 Ga0501039_0001773 3300049575 Bacteria 15943
298 Ga0501040_0007299 3300049576 Bacteria 7160
299 Ga0501040_0039258 3300049576 Bacteria 3219
300 Ga0501040_0061178 3300049576 Bacteria 2589
301 Ga0501040_0094727 3300049576 Bacteria 2078
302 Ga0501041_0005336 3300049577 Bacteria 7521
303 Ga0501041_0032680 3300049577 Bacteria 3145
304 Ga0501042_0119476 3300049578 Bacteria 1897
305 Ga0501043_0024926 3300049579 Bacteria 4693
306 Ga0501046_0010010 3300049580 Bacteria 8167
307 Ga0501047_0105949 3300049581 Bacteria 2692
308 Ga0501048_0018634 3300049582 Bacteria 5103
309 Ga0501048_0061189 3300049582 Bacteria 2667
310 Ga0501048_0289370 3300049582 Bacteria 1165
311 Ga0501048_0500855 3300049582 Bacteria 871
312 Ga0501068_0015374 3300049584 Bacteria 4393
313 Ga0501070_0036084 3300049586 Bacteria 4129
314 Ga0501071_0088612 3300049587 Bacteria 2271
315 Ga0501071_0302355 3300049587 Bacteria 1213
316 Ga0501072_0010678 3300049588 Bacteria 6992
317 Ga0501072_0041628 3300049588 Bacteria 3609
318 Ga0501072_0072479 3300049588 Bacteria 2722
319 Ga0501072_0162753 3300049588 Bacteria 1780
320 Ga0501074_0026155 3300049590 Bacteria 4232
321 Ga0501074_0046047 3300049590 Bacteria 3154
322 Ga0501075_0021793 3300049591 Bacteria 4673
323 Ga0501076_0008694 3300049592 Bacteria 7458
324 Ga0501076_0204018 3300049592 Bacteria 1615
325 Ga0501076_0429492 3300049592 Bacteria 1087
326 Ga0501077_0007614 3300049593 Bacteria 6684
327 Ga0501077_0131729 3300049593 Bacteria 1585
328 Ga0501077_0132606 3300049593 Bacteria 1580
329 Ga0501079_0006780 3300049741 Bacteria 8616
330 Ga0501079_0105254 3300049741 Bacteria 2189
331 Ga0501081_0008922 3300049743 Bacteria 6516
332 Ga0501081_0033209 3300049743 Bacteria 3505
333 Ga0501081_0146802 3300049743 Bacteria 1693
334 Ga0501044_0101963 3300049823 Bacteria 2887
335 Ga0501045_0002662 3300049824 Bacteria 12183
336 Ga0501045_0007193 3300049824 Bacteria 7722
337 nmdc:mga05p37_330310_c1 3300050507 Bacteria 1801
338 nmdc:mga05p37_73183_c1 3300050507 Bacteria 4217
339 nmdc:mga05p37_758_c1 3300050507 Bacteria 35839
340 nmdc:mga09592_231218_c1 3300050508 Bacteria 1602
341 nmdc:mga09592_27348_c1 3300050508 Bacteria 4733
342 nmdc:mga0qj67_37322_c1 3300050509 Bacteria 3805
343 nmdc:mga06r32_214799_c1 3300050510 Bacteria 1911
344 nmdc:mga06r32_89292_c1 3300050510 Bacteria 3009
345 nmdc:mga08y16_26065_c1 3300050511 Bacteria 6166
346 nmdc:mga08y16_339465_c1 3300050511 Bacteria 1544
347 nmdc:mga08y16_50051_c1 3300050511 Bacteria 4372
348 nmdc:mga08y16_635099_c1 3300050511 Bacteria 1073
349 nmdc:mga08y16_72387_c1 3300050511 Bacteria 3592
350 nmdc:mga08y16_7868_c1 3300050511 Bacteria 11161
351 nmdc:mga0n895_13715_c1 3300050512 Bacteria 7327
352 nmdc:mga0n895_14002_c1 3300050512 Bacteria 7265
353 nmdc:mga0n895_1569_c1 3300050512 Bacteria 17184
354 nmdc:mga0n895_2878_c1 3300050512 Bacteria 13655
355 nmdc:mga0rr50_133752_c1 3300050513 Bacteria 1988
356 nmdc:mga0rr50_2095_c1 3300050513 Bacteria 11151
357 nmdc:mga0rr50_29920_c1 3300050513 Bacteria 3848
358 nmdc:mga0rr50_3552_c1 3300050513 Bacteria 9004
359 nmdc:mga08x19_1254_c1 3300050514 Bacteria 15744
360 nmdc:mga08x19_149793_c1 3300050514 Bacteria 1579
361 nmdc:mga08x19_16751_c1 3300050514 Bacteria 4475
362 nmdc:mga08x19_26490_c1 3300050514 Bacteria 3618
363 nmdc:mga08x19_28357_c1 3300050514 Bacteria 3506
364 nmdc:mga08x19_55223_c1 3300050514 Bacteria 2559
365 nmdc:mga0a205_179852_c1 3300050515 Bacteria 2009
366 nmdc:mga0a205_38169_c1 3300050515 Bacteria 4620
367 nmdc:mga0a205_72711_c1 3300050515 Bacteria 1830
368 nmdc:mga0a205_82665_c1 3300050515 Bacteria 3102
369 Ga0501084_0012554 3300054114 Bacteria 7018
370 Ga0501084_0093745 3300054114 Bacteria 2521
371 Ga0501082_0011010 3300060353 Bacteria 7777
372 Ga0501082_0126248 3300060353 Bacteria 2219
373 Ga0530510_0009286 3300061734 Bacteria 6900

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10295990 Ga0070676_102959902 244
2 3300050514 nmdc:mga08x19_55223_c1 nmdc:mga08x19_55223_c1_933_1826 250
3 3300025908 Ga0207643_10124455 Ga0207643_101244552 251
4 3300009094 Ga0111539_10345681 Ga0111539_103456812 255
5 3300034816 Ga0373930_0008326 Ga0373930_0008326_193_1125 255
6 3300034817 Ga0373948_0001182 Ga0373948_0001182_2131_3063 255
7 3300035084 Ga0373928_0011654 Ga0373928_0011654_620_1552 255
8 3300035090 Ga0373949_0009810 Ga0373949_0009810_1116_2048 255
9 3300035207 Ga0373942_0005937 Ga0373942_0005937_26_958 255
10 3300035691 Ga0373931_0000627 Ga0373931_0000627_11104_12036 255
11 3300041512 Ga0451853_1635946 Ga0451853_1635946_13_816 266
12 3300049582 Ga0501048_0500855 Ga0501048_0500855_41_859 270
13 3300049588 Ga0501072_0041628 Ga0501072_0041628_1744_2562 270
14 3300049592 Ga0501076_0429492 Ga0501076_0429492_231_1049 270
15 3300049743 Ga0501081_0146802 Ga0501081_0146802_102_920 270
16 3300005444 Ga0070694_100334051 Ga0070694_1003340511 278
17 3300005549 Ga0070704_100283045 Ga0070704_1002830452 278
18 3300005440 Ga0070705_100357512 Ga0070705_1003575121 280
19 3300007076 Ga0075435_100060751 Ga0075435_1000607512 280
20 3300035118 Ga0373954_0000965 Ga0373954_0000965_6763_7653 280
21 3300035410 Ga0373924_0058051 Ga0373924_0058051_115_1005 280
22 3300035724 Ga0373933_0034162 Ga0373933_0034162_803_1693 280
23 3300036401 Ga0373937_0001198 Ga0373937_0001198_9404_10294 280
24 3300045051 Ga0451576_0008492 Ga0451576_0008492_5311_6225 280
25 3300050513 nmdc:mga0rr50_133752_c1 nmdc:mga0rr50_133752_c1_88_1002 280
26 3300005536 Ga0070697_100001807 Ga0070697_10000180714 281
27 3300049576 Ga0501040_0061178 Ga0501040_0061178_910_1821 281
28 3300049577 Ga0501041_0032680 Ga0501041_0032680_561_1472 281
29 3300049582 Ga0501048_0289370 Ga0501048_0289370_176_1087 281
30 3300049588 Ga0501072_0072479 Ga0501072_0072479_15_926 281
31 3300049590 Ga0501074_0026155 Ga0501074_0026155_1983_2894 281
32 3300049593 Ga0501077_0131729 Ga0501077_0131729_603_1514 281
33 3300049741 Ga0501079_0105254 Ga0501079_0105254_1118_2029 281
34 3300049743 Ga0501081_0033209 Ga0501081_0033209_1800_2711 281
35 3300049824 Ga0501045_0002662 Ga0501045_0002662_748_1659 281
36 3300054114 Ga0501084_0093745 Ga0501084_0093745_758_1669 281
37 3300060353 Ga0501082_0126248 Ga0501082_0126248_645_1556 281
38 3300035083 Ga0373926_0006970 Ga0373926_0006970_44_976 285
39 3300035170 Ga0373943_0011505 Ga0373943_0011505_187_1119 285
40 3300035692 Ga0373935_0059590 Ga0373935_0059590_798_1730 285
41 3300046472 Ga0495580_0065502 Ga0495580_0065502_561_1493 285
42 3300046499 Ga0495594_0037288 Ga0495594_0037288_985_1917 285
43 3300046681 Ga0495647_0007364 Ga0495647_0007364_1256_2188 285
44 3300046683 Ga0495658_0002184 Ga0495658_0002184_7235_8167 285
45 3300047315 Ga0495581_0249769 Ga0495581_0249769_77_1009 285
46 3300005355 Ga0070671_100386060 Ga0070671_1003860602 286
47 3300005544 Ga0070686_100036261 Ga0070686_1000362614 286
48 3300006358 Ga0068871_100001073 Ga0068871_10000107312 286
49 3300014969 Ga0157376_10033005 Ga0157376_100330052 286
50 3300025918 Ga0207662_10240421 Ga0207662_102404212 286
51 3300035207 Ga0373942_0007956 Ga0373942_0007956_808_1674 286
52 3300005366 Ga0070659_100025292 Ga0070659_1000252924 287
53 3300005435 Ga0070714_100566006 Ga0070714_1005660061 287
54 3300005543 Ga0070672_100209013 Ga0070672_1002090131 287
55 3300005578 Ga0068854_100197919 Ga0068854_1001979192 287
56 3300025901 Ga0207688_10142738 Ga0207688_101427382 287
57 3300025918 Ga0207662_10070071 Ga0207662_100700712 287
58 3300025932 Ga0207690_10134065 Ga0207690_101340652 287
59 3300025938 Ga0207704_10125860 Ga0207704_101258601 287
60 3300025940 Ga0207691_10167530 Ga0207691_101675302 287
61 3300026116 Ga0207674_10358849 Ga0207674_103588491 287
62 3300026121 Ga0207683_10130387 Ga0207683_101303874 287
63 3300032002 Ga0307416_100385910 Ga0307416_1003859102 287
64 3300006844 Ga0075428_100015891 Ga0075428_1000158913 288
65 3300006847 Ga0075431_100156399 Ga0075431_1001563992 288
66 3300006880 Ga0075429_100009199 Ga0075429_1000091996 288
67 3300009147 Ga0114129_10050786 Ga0114129_100507865 288
68 3300031903 Ga0307407_10002261 Ga0307407_100022612 288
69 3300041486 Ga0451807_0724457 Ga0451807_0724457_2111_2980 288
70 3300050507 nmdc:mga05p37_73183_c1 nmdc:mga05p37_73183_c1_2966_3880 288
71 3300050508 nmdc:mga09592_27348_c1 nmdc:mga09592_27348_c1_3092_4006 288
72 3300050510 nmdc:mga06r32_89292_c1 nmdc:mga06r32_89292_c1_1022_1936 288
73 3300005614 Ga0068856_100123983 Ga0068856_1001239834 289
74 3300026078 Ga0207702_10115507 Ga0207702_101155072 289
75 3300025918 Ga0207662_10091796 Ga0207662_100917962 291
76 3300050511 nmdc:mga08y16_635099_c1 nmdc:mga08y16_635099_c1_109_1014 293
77 3300006871 Ga0075434_100003417 Ga0075434_1000034175 295
78 3300050512 nmdc:mga0n895_14002_c1 nmdc:mga0n895_14002_c1_4851_5741 295
79 3300005440 Ga0070705_100004118 Ga0070705_1000041183 296
80 3300005440 Ga0070705_100109798 Ga0070705_1001097983 296
81 3300005444 Ga0070694_100025787 Ga0070694_1000257873 296
82 3300005444 Ga0070694_100127107 Ga0070694_1001271072 296
83 3300005458 Ga0070681_10000235 Ga0070681_1000023510 296
84 3300005468 Ga0070707_100380538 Ga0070707_1003805382 296
85 3300005518 Ga0070699_100002487 Ga0070699_10000248712 296
86 3300005530 Ga0070679_100014967 Ga0070679_1000149674 296
87 3300005536 Ga0070697_100003810 Ga0070697_1000038106 296
88 3300005545 Ga0070695_100037915 Ga0070695_1000379154 296
89 3300005545 Ga0070695_100125563 Ga0070695_1001255631 296
90 3300005545 Ga0070695_100179345 Ga0070695_1001793452 296
91 3300005546 Ga0070696_100002633 Ga0070696_1000026339 296
92 3300005549 Ga0070704_100417511 Ga0070704_1004175111 296
93 3300005985 Ga0081539_10000799 Ga0081539_1000079924 296
94 3300006847 Ga0075431_100100692 Ga0075431_1001006922 296
95 3300006852 Ga0075433_10232468 Ga0075433_102324682 296
96 3300006871 Ga0075434_100000004 Ga0075434_1000000047 296
97 3300006871 Ga0075434_100133325 Ga0075434_1001333254 296
98 3300006880 Ga0075429_100004984 Ga0075429_1000049849 296
99 3300006914 Ga0075436_100026757 Ga0075436_1000267572 296
100 3300006914 Ga0075436_100027975 Ga0075436_1000279752 296
101 3300006914 Ga0075436_100101005 Ga0075436_1001010054 296
102 3300007076 Ga0075435_100016338 Ga0075435_1000163386 296
103 3300007076 Ga0075435_100034552 Ga0075435_1000345524 296
104 3300007265 Ga0099794_10014482 Ga0099794_100144822 296
105 3300009147 Ga0114129_10758253 Ga0114129_107582532 296
106 3300009147 Ga0114129_10955375 Ga0114129_109553752 296
107 3300025939 Ga0207665_10108036 Ga0207665_101080362 296
108 3300027360 Ga0209969_1009078 Ga0209969_10090782 296
109 3300027614 Ga0209970_1014334 Ga0209970_10143342 296
110 3300027671 Ga0209588_1045292 Ga0209588_10452922 296
111 3300027876 Ga0209974_10012266 Ga0209974_100122663 296
112 3300035115 Ga0373941_0088460 Ga0373941_0088460_136_1029 296
113 3300035691 Ga0373931_0045002 Ga0373931_0045002_384_1277 296
114 3300042436 Ga0439435_0003881 Ga0439435_0003881_521_1414 296
115 3300042461 Ga0439460_0007765 Ga0439460_0007765_1520_2413 296
116 3300045051 Ga0451576_0208169 Ga0451576_0208169_442_1335 296
117 3300046454 Ga0495592_0078922 Ga0495592_0078922_417_1310 296
118 3300046459 Ga0495629_0097763 Ga0495629_0097763_991_1884 296
119 3300046476 Ga0495662_0002396 Ga0495662_0002396_8223_9116 296
120 3300046517 Ga0495630_0355330 Ga0495630_0355330_100_993 296
121 3300046535 Ga0495586_0134130 Ga0495586_0134130_348_1241 296
122 3300046663 Ga0495635_0118892 Ga0495635_0118892_764_1657 296
123 3300046684 Ga0495669_0056823 Ga0495669_0056823_424_1317 296
124 3300047315 Ga0495581_0072641 Ga0495581_0072641_686_1579 296
125 3300047673 Ga0495593_0148868 Ga0495593_0148868_50_943 296
126 3300049593 Ga0501077_0132606 Ga0501077_0132606_166_1059 296
127 3300050507 nmdc:mga05p37_330310_c1 nmdc:mga05p37_330310_c1_551_1444 296
128 3300050512 nmdc:mga0n895_13715_c1 nmdc:mga0n895_13715_c1_101_994 296
129 3300050512 nmdc:mga0n895_1569_c1 nmdc:mga0n895_1569_c1_5437_6330 296
130 3300050513 nmdc:mga0rr50_2095_c1 nmdc:mga0rr50_2095_c1_1699_2592 296
131 3300050514 nmdc:mga08x19_149793_c1 nmdc:mga08x19_149793_c1_335_1228 296
132 3300050514 nmdc:mga08x19_16751_c1 nmdc:mga08x19_16751_c1_24_917 296
133 3300050514 nmdc:mga08x19_26490_c1 nmdc:mga08x19_26490_c1_2616_3509 296
134 3300050515 nmdc:mga0a205_72711_c1 nmdc:mga0a205_72711_c1_789_1682 296
135 3300050515 nmdc:mga0a205_82665_c1 nmdc:mga0a205_82665_c1_783_1676 296
136 3300005330 Ga0070690_100001754 Ga0070690_1000017544 298
137 3300005330 Ga0070690_100010245 Ga0070690_1000102456 298
138 3300005334 Ga0068869_100001435 Ga0068869_10000143512 298
139 3300005336 Ga0070680_100000789 Ga0070680_10000078910 298
140 3300005337 Ga0070682_100006636 Ga0070682_1000066366 298
141 3300005340 Ga0070689_100000776 Ga0070689_1000007766 298
142 3300005340 Ga0070689_100016468 Ga0070689_1000164683 298
143 3300005341 Ga0070691_10034785 Ga0070691_100347852 298
144 3300005343 Ga0070687_100000436 Ga0070687_1000004366 298
145 3300005345 Ga0070692_10000910 Ga0070692_100009103 298
146 3300005353 Ga0070669_100366050 Ga0070669_1003660501 298
147 3300005364 Ga0070673_100155395 Ga0070673_1001553951 298
148 3300005364 Ga0070673_100279725 Ga0070673_1002797252 298
149 3300005435 Ga0070714_100189338 Ga0070714_1001893382 298
150 3300005440 Ga0070705_100001008 Ga0070705_10000100812 298
151 3300005444 Ga0070694_100001273 Ga0070694_1000012736 298
152 3300005444 Ga0070694_100091982 Ga0070694_1000919823 298
153 3300005458 Ga0070681_10023162 Ga0070681_100231624 298
154 3300005459 Ga0068867_100001386 Ga0068867_1000013866 298
155 3300005530 Ga0070679_100034557 Ga0070679_1000345572 298
156 3300005544 Ga0070686_100002450 Ga0070686_1000024504 298
157 3300005545 Ga0070695_100000113 Ga0070695_10000011316 298
158 3300005545 Ga0070695_100103228 Ga0070695_1001032283 298
159 3300005546 Ga0070696_100002261 Ga0070696_10000226110 298
160 3300005547 Ga0070693_100000209 Ga0070693_1000002096 298
161 3300005549 Ga0070704_100001744 Ga0070704_1000017449 298
162 3300005549 Ga0070704_100062396 Ga0070704_1000623961 298
163 3300005563 Ga0068855_100014327 Ga0068855_1000143274 298
164 3300005563 Ga0068855_100268898 Ga0068855_1002688982 298
165 3300005578 Ga0068854_100001665 Ga0068854_10000166515 298
166 3300005614 Ga0068856_100070663 Ga0068856_1000706633 298
167 3300005614 Ga0068856_100493521 Ga0068856_1004935212 298
168 3300005615 Ga0070702_100000240 Ga0070702_10000024013 298
169 3300005617 Ga0068859_100004628 Ga0068859_10000462811 298
170 3300005617 Ga0068859_100438005 Ga0068859_1004380052 298
171 3300005618 Ga0068864_100020253 Ga0068864_1000202534 298
172 3300005718 Ga0068866_10000744 Ga0068866_100007446 298
173 3300005719 Ga0068861_100000550 Ga0068861_10000055014 298
174 3300005840 Ga0068870_10125619 Ga0068870_101256192 298
175 3300005842 Ga0068858_100019276 Ga0068858_1000192766 298
176 3300005843 Ga0068860_100004596 Ga0068860_1000045966 298
177 3300005843 Ga0068860_100142192 Ga0068860_1001421923 298
178 3300005844 Ga0068862_100001897 Ga0068862_10000189712 298
179 3300006173 Ga0070716_100199712 Ga0070716_1001997122 298
180 3300006237 Ga0097621_100003980 Ga0097621_1000039805 298
181 3300006358 Ga0068871_100000788 Ga0068871_10000078819 298
182 3300006852 Ga0075433_10003313 Ga0075433_1000331311 298
183 3300006852 Ga0075433_10031717 Ga0075433_100317175 298
184 3300006871 Ga0075434_100001086 Ga0075434_1000010867 298
185 3300006881 Ga0068865_100001146 Ga0068865_10000114612 298
186 3300006914 Ga0075436_100000331 Ga0075436_10000033117 298
187 3300006914 Ga0075436_100006064 Ga0075436_1000060646 298
188 3300006931 Ga0097620_100004627 Ga0097620_1000046276 298
189 3300006931 Ga0097620_100437969 Ga0097620_1004379692 298
190 3300007076 Ga0075435_100000313 Ga0075435_10000031323 298
191 3300007076 Ga0075435_100001505 Ga0075435_1000015054 298
192 3300009094 Ga0111539_10010804 Ga0111539_100108049 298
193 3300009098 Ga0105245_10002454 Ga0105245_100024546 298
194 3300009148 Ga0105243_10000915 Ga0105243_1000091515 298
195 3300009176 Ga0105242_10000945 Ga0105242_1000094517 298
196 3300009177 Ga0105248_10050849 Ga0105248_100508492 298
197 3300009553 Ga0105249_10006665 Ga0105249_100066655 298
198 3300010375 Ga0105239_10090345 Ga0105239_100903454 298
199 3300013297 Ga0157378_10000844 Ga0157378_1000084418 298
200 3300014745 Ga0157377_10021544 Ga0157377_100215444 298
201 3300014968 Ga0157379_10048879 Ga0157379_100488794 298
202 3300025899 Ga0207642_10003273 Ga0207642_100032735 298
203 3300025911 Ga0207654_10024587 Ga0207654_100245875 298
204 3300025912 Ga0207707_10060845 Ga0207707_100608454 298
205 3300025917 Ga0207660_10035411 Ga0207660_100354114 298
206 3300025918 Ga0207662_10000233 Ga0207662_1000023315 298
207 3300025921 Ga0207652_10167337 Ga0207652_101673373 298
208 3300025923 Ga0207681_10129300 Ga0207681_101293004 298
209 3300025927 Ga0207687_10002722 Ga0207687_100027227 298
210 3300025929 Ga0207664_10097382 Ga0207664_100973822 298
211 3300025934 Ga0207686_10001496 Ga0207686_1000149611 298
212 3300025935 Ga0207709_10003455 Ga0207709_1000345511 298
213 3300025936 Ga0207670_10003031 Ga0207670_1000303110 298
214 3300025936 Ga0207670_10101953 Ga0207670_101019532 298
215 3300025938 Ga0207704_10000745 Ga0207704_1000074512 298
216 3300025942 Ga0207689_10002282 Ga0207689_1000228213 298
217 3300025949 Ga0207667_10013499 Ga0207667_100134999 298
218 3300025961 Ga0207712_10009194 Ga0207712_100091945 298
219 3300025981 Ga0207640_10087042 Ga0207640_100870423 298
220 3300026035 Ga0207703_10004183 Ga0207703_1000418312 298
221 3300026078 Ga0207702_10151914 Ga0207702_101519142 298
222 3300026089 Ga0207648_10004982 Ga0207648_100049826 298
223 3300026095 Ga0207676_10010920 Ga0207676_100109205 298
224 3300026118 Ga0207675_100001604 Ga0207675_10000160416 298
225 3300027671 Ga0209588_1031534 Ga0209588_10315342 298
226 3300028380 Ga0268265_10001521 Ga0268265_1000152112 298
227 3300028381 Ga0268264_10004412 Ga0268264_1000441212 298
228 3300028381 Ga0268264_10489059 Ga0268264_104890592 298
229 3300041406 Ga0439439_0011395 Ga0439439_0011395_824_1723 298
230 3300041410 Ga0439461_0001994 Ga0439461_0001994_983_1882 298
231 3300042156 Ga0439446_0008907 Ga0439446_0008907_593_1492 298
232 3300042435 Ga0439434_0002340 Ga0439434_0002340_884_1783 298
233 3300042436 Ga0439435_0000298 Ga0439435_0000298_2510_3409 298
234 3300049587 Ga0501071_0302355 Ga0501071_0302355_37_936 298
235 3300050511 nmdc:mga08y16_26065_c1 nmdc:mga08y16_26065_c1_3453_4355 298
236 3300050512 nmdc:mga0n895_2878_c1 nmdc:mga0n895_2878_c1_6898_7800 298
237 3300050513 nmdc:mga0rr50_29920_c1 nmdc:mga0rr50_29920_c1_1469_2368 298
238 3300050513 nmdc:mga0rr50_3552_c1 nmdc:mga0rr50_3552_c1_2273_3175 298
239 3300050514 nmdc:mga08x19_1254_c1 nmdc:mga08x19_1254_c1_10680_11579 298
240 3300050514 nmdc:mga08x19_28357_c1 nmdc:mga08x19_28357_c1_1071_1973 298
241 3300050515 nmdc:mga0a205_38169_c1 nmdc:mga0a205_38169_c1_1456_2355 298
242 3300005356 Ga0070674_100082759 Ga0070674_1000827594 299
243 3300005547 Ga0070693_100025937 Ga0070693_1000259372 299
244 3300005614 Ga0068856_100630919 Ga0068856_1006309192 299
245 3300005719 Ga0068861_100289981 Ga0068861_1002899812 299
246 3300025909 Ga0207705_10238455 Ga0207705_102384552 299
247 3300025923 Ga0207681_10229693 Ga0207681_102296932 299
248 3300026075 Ga0207708_10017293 Ga0207708_100172936 299
249 3300026089 Ga0207648_10042404 Ga0207648_100424043 299
250 3300026118 Ga0207675_100055101 Ga0207675_1000551013 299
251 3300046615 Ga0495656_0080564 Ga0495656_0080564_259_1167 300
252 3300047445 Ga0495677_0046570 Ga0495677_0046570_219_1127 300
253 3300005345 Ga0070692_10064389 Ga0070692_100643892 301
254 3300005365 Ga0070688_100244564 Ga0070688_1002445642 301
255 3300005437 Ga0070710_10035173 Ga0070710_100351734 301
256 3300005546 Ga0070696_100000434 Ga0070696_10000043419 301
257 3300005617 Ga0068859_100030356 Ga0068859_1000303564 301
258 3300006163 Ga0070715_10022627 Ga0070715_100226272 301
259 3300006173 Ga0070716_100115001 Ga0070716_1001150012 301
260 3300006931 Ga0097620_100030355 Ga0097620_1000303554 301
261 3300009094 Ga0111539_10029052 Ga0111539_100290523 301
262 3300026075 Ga0207708_10278861 Ga0207708_102788611 301
263 3300026116 Ga0207674_10287042 Ga0207674_102870422 301
264 3300031731 Ga0307405_10165382 Ga0307405_101653822 301
265 3300035111 Ga0373923_0103521 Ga0373923_0103521_301_1212 301
266 3300035172 Ga0373955_0068010 Ga0373955_0068010_635_1546 301
267 3300035410 Ga0373924_0004096 Ga0373924_0004096_1725_2636 301
268 3300035692 Ga0373935_0027855 Ga0373935_0027855_1407_2333 301
269 3300035724 Ga0373933_0078639 Ga0373933_0078639_234_1145 301
270 3300036401 Ga0373937_0019305 Ga0373937_0019305_4650_5561 301
271 3300042437 Ga0439444_0003491 Ga0439444_0003491_1005_1913 301
272 3300042461 Ga0439460_0000925 Ga0439460_0000925_5719_6627 301
273 3300046536 Ga0495587_0127898 Ga0495587_0127898_282_1193 301
274 3300046663 Ga0495635_0054819 Ga0495635_0054819_216_1127 301
275 3300046684 Ga0495669_0031323 Ga0495669_0031323_18_926 301
276 3300047322 Ga0495680_0081836 Ga0495680_0081836_269_1180 301
277 3300049572 Ga0501036_0015984 Ga0501036_0015984_1337_2248 301
278 3300049572 Ga0501036_0188526 Ga0501036_0188526_42_950 301
279 3300049574 Ga0501038_0023765 Ga0501038_0023765_4550_5461 301
280 3300049575 Ga0501039_0001773 Ga0501039_0001773_819_1730 301
281 3300049576 Ga0501040_0007299 Ga0501040_0007299_782_1693 301
282 3300049576 Ga0501040_0039258 Ga0501040_0039258_13_921 301
283 3300049576 Ga0501040_0094727 Ga0501040_0094727_930_1838 301
284 3300049577 Ga0501041_0005336 Ga0501041_0005336_5425_6336 301
285 3300049578 Ga0501042_0119476 Ga0501042_0119476_589_1500 301
286 3300049579 Ga0501043_0024926 Ga0501043_0024926_1258_2169 301
287 3300049580 Ga0501046_0010010 Ga0501046_0010010_6492_7403 301
288 3300049581 Ga0501047_0105949 Ga0501047_0105949_502_1413 301
289 3300049582 Ga0501048_0018634 Ga0501048_0018634_3466_4377 301
290 3300049582 Ga0501048_0061189 Ga0501048_0061189_93_1001 301
291 3300049584 Ga0501068_0015374 Ga0501068_0015374_745_1656 301
292 3300049586 Ga0501070_0036084 Ga0501070_0036084_2330_3241 301
293 3300049587 Ga0501071_0088612 Ga0501071_0088612_149_1060 301
294 3300049588 Ga0501072_0010678 Ga0501072_0010678_5341_6252 301
295 3300049588 Ga0501072_0162753 Ga0501072_0162753_74_982 301
296 3300049590 Ga0501074_0046047 Ga0501074_0046047_1035_1946 301
297 3300049591 Ga0501075_0021793 Ga0501075_0021793_1335_2246 301
298 3300049592 Ga0501076_0008694 Ga0501076_0008694_4722_5633 301
299 3300049592 Ga0501076_0204018 Ga0501076_0204018_184_1092 301
300 3300049593 Ga0501077_0007614 Ga0501077_0007614_582_1493 301
301 3300049741 Ga0501079_0006780 Ga0501079_0006780_2220_3131 301
302 3300049743 Ga0501081_0008922 Ga0501081_0008922_1032_1943 301
303 3300049823 Ga0501044_0101963 Ga0501044_0101963_938_1849 301
304 3300049824 Ga0501045_0007193 Ga0501045_0007193_6676_7587 301
305 3300050508 nmdc:mga09592_231218_c1 nmdc:mga09592_231218_c1_107_1015 301
306 3300050509 nmdc:mga0qj67_37322_c1 nmdc:mga0qj67_37322_c1_682_1590 301
307 3300050510 nmdc:mga06r32_214799_c1 nmdc:mga06r32_214799_c1_427_1335 301
308 3300050511 nmdc:mga08y16_339465_c1 nmdc:mga08y16_339465_c1_149_1057 301
309 3300050511 nmdc:mga08y16_50051_c1 nmdc:mga08y16_50051_c1_1556_2464 301
310 3300054114 Ga0501084_0012554 Ga0501084_0012554_4360_5271 301
311 3300060353 Ga0501082_0011010 Ga0501082_0011010_4540_5451 301
312 3300061734 Ga0530510_0009286 Ga0530510_0009286_4335_5246 301
313 3300005329 Ga0070683_100061448 Ga0070683_1000614483 302
314 3300005336 Ga0070680_100187069 Ga0070680_1001870692 302
315 3300005345 Ga0070692_10133733 Ga0070692_101337332 302
316 3300005347 Ga0070668_100016473 Ga0070668_1000164732 302
317 3300005353 Ga0070669_100000706 Ga0070669_10000070613 302
318 3300005441 Ga0070700_100000507 Ga0070700_10000050713 302
319 3300005444 Ga0070694_100264029 Ga0070694_1002640292 302
320 3300005459 Ga0068867_100000699 Ga0068867_1000006996 302
321 3300005535 Ga0070684_100027873 Ga0070684_1000278734 302
322 3300005544 Ga0070686_100029699 Ga0070686_1000296992 302
323 3300005615 Ga0070702_100104077 Ga0070702_1001040772 302
324 3300005718 Ga0068866_10139903 Ga0068866_101399031 302
325 3300005719 Ga0068861_100005956 Ga0068861_1000059567 302
326 3300005844 Ga0068862_100011352 Ga0068862_1000113529 302
327 3300005844 Ga0068862_100059122 Ga0068862_1000591224 302
328 3300006237 Ga0097621_100004795 Ga0097621_1000047954 302
329 3300006881 Ga0068865_100028303 Ga0068865_1000283035 302
330 3300009148 Ga0105243_10057436 Ga0105243_100574363 302
331 3300009553 Ga0105249_10000975 Ga0105249_1000097513 302
332 3300014326 Ga0157380_10002048 Ga0157380_100020482 302
333 3300025907 Ga0207645_10068706 Ga0207645_100687062 302
334 3300025917 Ga0207660_10096010 Ga0207660_100960102 302
335 3300025923 Ga0207681_10001251 Ga0207681_100012516 302
336 3300025935 Ga0207709_10033946 Ga0207709_100339464 302
337 3300025938 Ga0207704_10002119 Ga0207704_100021198 302
338 3300025961 Ga0207712_10002814 Ga0207712_1000281410 302
339 3300025972 Ga0207668_10010738 Ga0207668_100107382 302
340 3300026075 Ga0207708_10007988 Ga0207708_100079887 302
341 3300026089 Ga0207648_10002355 Ga0207648_1000235512 302
342 3300026118 Ga0207675_100003839 Ga0207675_1000038397 302
343 3300027907 Ga0207428_10218888 Ga0207428_102188882 302
344 3300028380 Ga0268265_10003807 Ga0268265_100038077 302
345 3300028380 Ga0268265_10248679 Ga0268265_102486791 302
346 3300034957 Ga0373938_0018517 Ga0373938_0018517_439_1353 302
347 3300035241 Ga0373961_0004471 Ga0373961_0004471_1372_2286 302
348 3300050511 nmdc:mga08y16_72387_c1 nmdc:mga08y16_72387_c1_2113_3021 302
349 3300046664 Ga0495659_0094249 Ga0495659_0094249_54_968 303
350 3300005328 Ga0070676_10025548 Ga0070676_100255484 304
351 3300005338 Ga0068868_100001331 Ga0068868_1000013316 304
352 3300005354 Ga0070675_100006313 Ga0070675_1000063132 304
353 3300005354 Ga0070675_100135561 Ga0070675_1001355612 304
354 3300005364 Ga0070673_100230105 Ga0070673_1002301052 304
355 3300005441 Ga0070700_100000666 Ga0070700_1000006666 304
356 3300005456 Ga0070678_100208077 Ga0070678_1002080772 304
357 3300006844 Ga0075428_100001002 Ga0075428_10000100225 304
358 3300006880 Ga0075429_100000051 Ga0075429_10000005128 304
359 3300009147 Ga0114129_10000337 Ga0114129_1000033731 304
360 3300025916 Ga0207663_10274654 Ga0207663_102746542 304
361 3300025926 Ga0207659_10141849 Ga0207659_101418492 304
362 3300025942 Ga0207689_10087091 Ga0207689_100870913 304
363 3300026023 Ga0207677_10006472 Ga0207677_100064726 304
364 3300026075 Ga0207708_10000625 Ga0207708_100006256 304
365 3300026121 Ga0207683_10084047 Ga0207683_100840473 304
366 3300027907 Ga0207428_10000610 Ga0207428_1000061024 304
367 3300035111 Ga0373923_0029072 Ga0373923_0029072_1047_1979 304
368 3300035116 Ga0373945_0004344 Ga0373945_0004344_3352_4284 304
369 3300035691 Ga0373931_0022311 Ga0373931_0022311_622_1554 304
370 3300045051 Ga0451576_0015696 Ga0451576_0015696_2354_3286 304
371 3300050507 nmdc:mga05p37_758_c1 nmdc:mga05p37_758_c1_20850_21782 304
372 3300050511 nmdc:mga08y16_7868_c1 nmdc:mga08y16_7868_c1_4408_5340 304
373 3300050515 nmdc:mga0a205_179852_c1 nmdc:mga0a205_179852_c1_878_1810 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

19

213

0.98

PF16916

ZT_dimer

Dimerisation domain of Zinc Transporter

218

296

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3byp-assembly1.cif.gz_B mode of action of a putative zinc transporter czrb 0.8999 213 290
6vda-assembly1.cif.gz_A-2 metal-bound c-terminal domain of czcd transporter from thermotoga maritima 0.8864 216 294
3byr-assembly1.cif.gz_A-2 mode of action of a putative zinc transporter czrb (zn form) 0.8712 212 293
6qfj-assembly4.cif.gz_D mamb ctd magnetosome protein [desulfamplus magnetovallimortis bw-1] 0.857 219 293
3byp-assembly1.cif.gz_B mode of action of a putative zinc transporter czrb 0.8498 213 290
ID Description Score Start End Superfamily
3bypB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.8999 213 290 3.30.70.1350
af_H2KZN1_58_251_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8929 13 205 1.20.1510.10
3h90D02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.8888 210 292 3.30.70.1350
af_Q9SAJ7_113_306_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.8774 14 205 1.20.1510.10
af_I1L2V9_320_399_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.8757 235 293 3.30.70.1350
ID Description Score Start End GO Terms
AF-A0A842YK29-F1-model_v4 Cation diffusion facilitator family transporter 0.9504 9 147 GO:0005886
GO:0006882
GO:0015086
GO:0015093
GO:0015341
AF-A0A842YK29-F1-model_v4 Cation diffusion facilitator family transporter 0.9374 9 147 GO:0005886
GO:0006882
GO:0015086
GO:0015093
GO:0015341
AF-A0A350KBH1-F1-model_v4 deleted 0.9194 8 205
AF-A0A6J4HL08-F1-model_v4 Cobalt-zinc-cadmium resistance protein 0.9188 158 299 GO:0005886
GO:0006882
GO:0015086
GO:0015093
GO:0015341
AF-A0A2W4K2G7-F1-model_v4 Cation-efflux pump 0.9168 192 304

Feature Viewer

pLDDT pTM Quality
84.99 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map