F426177

General Info

Members Datasets Scaffolds Average Seq Length
372 196 744 503

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_111443_c1|nmdc:mga0k408_111443_c1_10_1332
Length 440
Sequence MAAHLAQVERVNPRVNAIVTLVAERALADAARADEAMARGGAVGRLHGLPVAHKDLVATAGIRTTYGSPFYKDFVPTADAPIVTRIRAAGAITVGKTNTPEFGAGSQTFNTVFGATKNPYDLSRTCGGSSGGAAVSLACGFVPIADGSDTGGSLRNPAAFCNVVGLRPSPGRVVRDGASWSPLSVSGPMARSVADVALFLSAIAGPDGGPLAIAEEGSRFASPLEALPKGARVAWWKDLGGVPVEPAVRAAVDANRRVFEDLGCRIEEAEPDFAGVADAFATLRFLDNYARYAPLVREKPEWVKDTIRYEVAEAEKLTAAQISKAHTRQSRLYDDSRHFFERFDYFVLPVTQVVPFDVTTPYPTRIGDVALGTYIDWMRSCTYVSLMANPAISVPAGFTPEGLPVGLQIVGRHRGEWPLLQMAHAFEQATRHGRRRPPVV

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 2.69
Rhizosphere 94.09
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_111443_c1 3300050493 Bacteria 1617
2 Ga0065712_10000274 3300005290 Bacteria 18860
3 Ga0065712_10007381 3300005290 Bacteria 3794
4 Ga0065715_10007515 3300005293 Bacteria 3602
5 Ga0070676_10003563 3300005328 Bacteria 8141
6 Ga0070676_10007332 3300005328 Bacteria 5918
7 Ga0070683_100041474 3300005329 Bacteria 4234
8 Ga0070683_100051916 3300005329 Bacteria 3798
9 Ga0070690_100008565 3300005330 Bacteria 5898
10 Ga0070690_100091845 3300005330 Bacteria 2001
11 Ga0070670_100001742 3300005331 Bacteria 17720
12 Ga0070670_100002923 3300005331 Bacteria 14147
13 Ga0070670_100011940 3300005331 Bacteria 7429
14 Ga0070670_100025261 3300005331 Bacteria 5111
15 Ga0070670_100185505 3300005331 Bacteria 1806
16 Ga0068869_100001167 3300005334 Bacteria 15387
17 Ga0068869_100155197 3300005334 Bacteria 1778
18 Ga0070666_10011743 3300005335 Bacteria 5508
19 Ga0070666_10019722 3300005335 Bacteria 4356
20 Ga0070680_100025055 3300005336 Bacteria 4768
21 Ga0070682_100001097 3300005337 Bacteria 15535
22 Ga0068868_100016585 3300005338 Bacteria 5475
23 Ga0068868_100033014 3300005338 Bacteria 3987
24 Ga0068868_100059509 3300005338 Bacteria 3022
25 Ga0070660_100024406 3300005339 Bacteria 4484
26 Ga0070689_100030716 3300005340 Bacteria 4079
27 Ga0070687_100003615 3300005343 Bacteria 6035
28 Ga0070661_100022993 3300005344 Bacteria 4466
29 Ga0070692_10007058 3300005345 Bacteria 4928
30 Ga0070668_100010694 3300005347 Bacteria 6825
31 Ga0070668_100090839 3300005347 Unclassified 2406
32 Ga0070669_100043859 3300005353 Bacteria 3258
33 Ga0070669_100085269 3300005353 Bacteria 2358
34 Ga0070669_100144739 3300005353 Bacteria 1835
35 Ga0070675_100000348 3300005354 Bacteria 31263
36 Ga0070675_100005000 3300005354 Bacteria 10123
37 Ga0070675_100017594 3300005354 Bacteria 5682
38 Ga0070675_100046861 3300005354 Bacteria 3541
39 Ga0070674_100007821 3300005356 Bacteria 6321
40 Ga0070688_100030000 3300005365 Bacteria 3260
41 Ga0070688_100073137 3300005365 Bacteria 2198
42 Ga0070688_100093401 3300005365 Bacteria 1970
43 Ga0070659_100009099 3300005366 Bacteria 7285
44 Ga0070659_100072959 3300005366 Bacteria 2732
45 Ga0070659_100182941 3300005366 Bacteria 1720
46 Ga0070667_100009305 3300005367 Bacteria 8142
47 Ga0070667_100139272 3300005367 Bacteria 2123
48 Ga0070711_100005421 3300005439 Bacteria 7624
49 Ga0070700_100051235 3300005441 Bacteria 2570
50 Ga0070694_100120826 3300005444 Bacteria 1880
51 Ga0070708_100000004 3300005445 Bacteria 168041
52 Ga0070678_100041826 3300005456 Bacteria 3252
53 Ga0070678_100104312 3300005456 Bacteria 2204
54 Ga0070662_100001472 3300005457 Bacteria 14509
55 Ga0070662_100011344 3300005457 Bacteria 5880
56 Ga0070662_100046260 3300005457 Bacteria 3127
57 Ga0070681_10016679 3300005458 Bacteria 7333
58 Ga0070681_10019978 3300005458 Bacteria 6711
59 Ga0070681_10143868 3300005458 Unclassified 2314
60 Ga0070698_100000263 3300005471 Bacteria 53073
61 Ga0070699_100003817 3300005518 Bacteria 13317
62 Ga0070679_100010037 3300005530 Bacteria 8968
63 Ga0070679_100014823 3300005530 Bacteria 7489
64 Ga0070684_100000238 3300005535 Bacteria 38130
65 Ga0070684_100045671 3300005535 Bacteria 3793
66 Ga0070684_100058896 3300005535 Bacteria 3357
67 Ga0070672_100003205 3300005543 Bacteria 10591
68 Ga0070672_100027770 3300005543 Bacteria 4224
69 Ga0070672_100174321 3300005543 Bacteria 1790
70 Ga0070686_100025643 3300005544 Bacteria 3549
71 Ga0070695_100028590 3300005545 Bacteria 3460
72 Ga0070696_100001619 3300005546 Bacteria 14782
73 Ga0070665_100028716 3300005548 Bacteria 5601
74 Ga0068855_100036141 3300005563 Bacteria 5881
75 Ga0068855_100101064 3300005563 Bacteria 3320
76 Ga0070664_100000156 3300005564 Bacteria 47186
77 Ga0070664_100002504 3300005564 Bacteria 14812
78 Ga0070664_100009859 3300005564 Bacteria 7741
79 Ga0068857_100010501 3300005577 Bacteria 8048
80 Ga0068857_100019884 3300005577 Bacteria 5902
81 Ga0068857_100196744 3300005577 Bacteria 1837
82 Ga0068856_100009659 3300005614 Bacteria 9368
83 Ga0070702_100020949 3300005615 Bacteria 3433
84 Ga0068852_100056192 3300005616 Bacteria 3400
85 Ga0068852_100081338 3300005616 Bacteria 2875
86 Ga0068859_100008517 3300005617 Bacteria 10376
87 Ga0068864_100022514 3300005618 Bacteria 5284
88 Ga0068864_100030299 3300005618 Bacteria 4585
89 Ga0068864_100078974 3300005618 Bacteria 2880
90 Ga0068861_100010106 3300005719 Bacteria 6542
91 Ga0068863_100013215 3300005841 Bacteria 7963
92 Ga0068858_100021413 3300005842 Bacteria 6040
93 Ga0068858_100056105 3300005842 Unclassified 3642
94 Ga0068860_100041943 3300005843 Bacteria 4372
95 Ga0068860_100080177 3300005843 Bacteria 3104
96 Ga0068860_100234209 3300005843 Bacteria 1785
97 Ga0068862_100008289 3300005844 Bacteria 8599
98 Ga0075364_10047294 3300006051 Bacteria 2802
99 Ga0068871_100070246 3300006358 Bacteria 2878
100 Ga0075428_100008522 3300006844 Bacteria 11374
101 Ga0075428_100010039 3300006844 Bacteria 10517
102 Ga0075428_100013736 3300006844 Bacteria 9017
103 Ga0075428_100028497 3300006844 Bacteria 6179
104 Ga0075428_100030536 3300006844 Bacteria 5959
105 Ga0075428_100034635 3300006844 Bacteria 5568
106 Ga0075428_100069404 3300006844 Unclassified 3853
107 Ga0075428_100095011 3300006844 Bacteria 3250
108 Ga0075430_100000804 3300006846 Bacteria 24406
109 Ga0075430_100001135 3300006846 Bacteria 21233
110 Ga0075430_100003851 3300006846 Bacteria 12636
111 Ga0075430_100015583 3300006846 Bacteria 6471
112 Ga0075430_100018260 3300006846 Bacteria 5971
113 Ga0075430_100045131 3300006846 Unclassified 3724
114 Ga0075431_100000707 3300006847 Bacteria 28789
115 Ga0075431_100006399 3300006847 Bacteria 11689
116 Ga0075431_100011151 3300006847 Bacteria 9047
117 Ga0075431_100017853 3300006847 Bacteria 7215
118 Ga0075431_100030570 3300006847 Bacteria 5548
119 Ga0075431_100054763 3300006847 Bacteria 4113
120 Ga0075431_100057039 3300006847 Bacteria 4028
121 Ga0075431_100113692 3300006847 Bacteria 2794
122 Ga0075431_100290891 3300006847 Bacteria 1653
123 Ga0075433_10018869 3300006852 Bacteria 5740
124 Ga0075433_10039747 3300006852 Bacteria 4069
125 Ga0075434_100006343 3300006871 Bacteria 10843
126 Ga0075434_100042559 3300006871 Bacteria 4503
127 Ga0075434_100126101 3300006871 Bacteria 2577
128 Ga0075434_100195256 3300006871 Bacteria 2044
129 Ga0075429_100006737 3300006880 Bacteria 9961
130 Ga0075429_100031658 3300006880 Bacteria 4597
131 Ga0075429_100053111 3300006880 Bacteria 3526
132 Ga0075429_100084018 3300006880 Bacteria 2775
133 Ga0068865_100130034 3300006881 Bacteria 1885
134 Ga0097620_100008517 3300006931 Bacteria 10376
135 Ga0111539_10000040 3300009094 Bacteria 136085
136 Ga0111539_10005315 3300009094 Bacteria 16664
137 Ga0111539_10025587 3300009094 Bacteria 7234
138 Ga0111539_10045755 3300009094 Bacteria 5238
139 Ga0111539_10089816 3300009094 Bacteria 3611
140 Ga0111539_10147566 3300009094 Bacteria 2754
141 Ga0111539_10178218 3300009094 Bacteria 2483
142 Ga0111539_10190474 3300009094 Bacteria 2393
143 Ga0105245_10005268 3300009098 Bacteria 11360
144 Ga0114129_10006123 3300009147 Archaea 17055
145 Ga0114129_10014298 3300009147 Bacteria 11310
146 Ga0114129_10024381 3300009147 Bacteria 8572
147 Ga0114129_10188080 3300009147 Bacteria 2806
148 Ga0114129_10271523 3300009147 Bacteria 2268
149 Ga0114129_10545317 3300009147 Bacteria 1509
150 Ga0105242_10013037 3300009176 Bacteria 6415
151 Ga0105242_10062113 3300009176 Bacteria 3074
152 Ga0105242_10065967 3300009176 Bacteria 2988
153 Ga0105248_10061517 3300009177 Bacteria 4216
154 Ga0105249_10004373 3300009553 Bacteria 12219
155 Ga0105249_10006108 3300009553 Bacteria 10445
156 Ga0105239_10057433 3300010375 Bacteria 4268
157 Ga0157371_10020432 3300013102 Bacteria 4873
158 Ga0157371_10025583 3300013102 Bacteria 4298
159 Ga0157369_10022113 3300013105 Bacteria 7104
160 Ga0157378_10079178 3300013297 Bacteria 2966
161 Ga0157378_10195719 3300013297 Bacteria 1909
162 Ga0163162_10221218 3300013306 Bacteria 2023
163 Ga0157372_10001820 3300013307 Bacteria 23134
164 Ga0157372_10019397 3300013307 Bacteria 7329
165 Ga0157372_10261304 3300013307 Bacteria 2010
166 Ga0157375_10099295 3300013308 Bacteria 2990
167 Ga0163163_10014609 3300014325 Bacteria 7223
168 Ga0163163_10016467 3300014325 Bacteria 6873
169 Ga0163163_10027613 3300014325 Bacteria 5439
170 Ga0163163_10032491 3300014325 Bacteria 5040
171 Ga0157380_10003829 3300014326 Bacteria 10363
172 Ga0157380_10007406 3300014326 Bacteria 7792
173 Ga0157380_10010727 3300014326 Bacteria 6603
174 Ga0157380_10092542 3300014326 Bacteria 2498
175 Ga0157380_10097324 3300014326 Bacteria 2442
176 Ga0157377_10022476 3300014745 Bacteria 3330
177 Ga0157376_10008148 3300014969 Bacteria 7536
178 Ga0157376_10159602 3300014969 Bacteria 2042
179 Ga0163161_10047257 3300017792 Bacteria 3109
180 Ga0207682_10001088 3300025893 Bacteria 12555
181 Ga0207688_10009873 3300025901 Bacteria 5195
182 Ga0207688_10013787 3300025901 Bacteria 4393
183 Ga0207680_10004774 3300025903 Bacteria 6453
184 Ga0207645_10001751 3300025907 Bacteria 17605
185 Ga0207643_10001718 3300025908 Bacteria 12282
186 Ga0207643_10005668 3300025908 Bacteria 6681
187 Ga0207643_10016037 3300025908 Bacteria 4081
188 Ga0207707_10019304 3300025912 Bacteria 5949
189 Ga0207707_10157315 3300025912 Bacteria 1987
190 Ga0207663_10003317 3300025916 Bacteria 7855
191 Ga0207662_10009958 3300025918 Bacteria 5245
192 Ga0207662_10069673 3300025918 Bacteria 2125
193 Ga0207657_10008429 3300025919 Bacteria 10460
194 Ga0207657_10028927 3300025919 Bacteria 5048
195 Ga0207649_10008549 3300025920 Bacteria 5584
196 Ga0207649_10034614 3300025920 Bacteria 3028
197 Ga0207681_10033825 3300025923 Bacteria 3355
198 Ga0207650_10004110 3300025925 Bacteria 9944
199 Ga0207650_10008975 3300025925 Bacteria 6833
200 Ga0207659_10000365 3300025926 Bacteria 27137
201 Ga0207659_10012668 3300025926 Bacteria 5377
202 Ga0207659_10020365 3300025926 Bacteria 4383
203 Ga0207659_10032672 3300025926 Bacteria 3574
204 Ga0207659_10049193 3300025926 Bacteria 2989
205 Ga0207659_10072524 3300025926 Bacteria 2518
206 Ga0207687_10056839 3300025927 Bacteria 2746
207 Ga0207700_10015925 3300025928 Bacteria 4979
208 Ga0207644_10163114 3300025931 Bacteria 1734
209 Ga0207690_10002601 3300025932 Bacteria 10886
210 Ga0207690_10051661 3300025932 Bacteria 2750
211 Ga0207690_10066699 3300025932 Bacteria 2466
212 Ga0207706_10001216 3300025933 Bacteria 26019
213 Ga0207706_10002011 3300025933 Bacteria 19910
214 Ga0207706_10021115 3300025933 Bacteria 5849
215 Ga0207706_10022087 3300025933 Bacteria 5711
216 Ga0207706_10071314 3300025933 Bacteria 3056
217 Ga0207670_10045926 3300025936 Bacteria 2899
218 Ga0207670_10054615 3300025936 Bacteria 2696
219 Ga0207669_10004646 3300025937 Bacteria 6066
220 Ga0207669_10023233 3300025937 Bacteria 3309
221 Ga0207691_10002077 3300025940 Bacteria 19544
222 Ga0207691_10005392 3300025940 Bacteria 12349
223 Ga0207711_10061921 3300025941 Bacteria 3227
224 Ga0207689_10002755 3300025942 Bacteria 16250
225 Ga0207689_10003979 3300025942 Bacteria 13438
226 Ga0207689_10016399 3300025942 Bacteria 6272
227 Ga0207661_10011881 3300025944 Bacteria 6323
228 Ga0207661_10035480 3300025944 Bacteria 3886
229 Ga0207661_10047001 3300025944 Bacteria 3425
230 Ga0207661_10054576 3300025944 Bacteria 3201
231 Ga0207679_10001853 3300025945 Bacteria 13139
232 Ga0207679_10007865 3300025945 Bacteria 6774
233 Ga0207679_10017520 3300025945 Bacteria 4781
234 Ga0207679_10021229 3300025945 Bacteria 4398
235 Ga0207679_10031014 3300025945 Bacteria 3739
236 Ga0207679_10031134 3300025945 Bacteria 3732
237 Ga0207679_10078693 3300025945 Bacteria 2512
238 Ga0207679_10181669 3300025945 Bacteria 1741
239 Ga0207667_10161499 3300025949 Bacteria 2304
240 Ga0207651_10004775 3300025960 Bacteria 6890
241 Ga0207712_10086456 3300025961 Bacteria 2297
242 Ga0207668_10013793 3300025972 Bacteria 4987
243 Ga0207668_10059315 3300025972 Bacteria 2681
244 Ga0207668_10139105 3300025972 Bacteria 1864
245 Ga0207658_10066347 3300025986 Bacteria 2714
246 Ga0207677_10078543 3300026023 Bacteria 2357
247 Ga0207639_10126795 3300026041 Bacteria 2106
248 Ga0207678_10038206 3300026067 Bacteria 4172
249 Ga0207708_10019725 3300026075 Bacteria 5085
250 Ga0207702_10049821 3300026078 Bacteria 3535
251 Ga0207641_10013336 3300026088 Bacteria 6740
252 Ga0207641_10052037 3300026088 Bacteria 3467
253 Ga0207648_10011024 3300026089 Bacteria 8532
254 Ga0207648_10085839 3300026089 Bacteria 2745
255 Ga0207676_10001510 3300026095 Bacteria 17171
256 Ga0207674_10001037 3300026116 Bacteria 36136
257 Ga0207674_10001105 3300026116 Bacteria 35054
258 Ga0207674_10004579 3300026116 Bacteria 16602
259 Ga0207675_100005848 3300026118 Bacteria 11751
260 Ga0207675_100043133 3300026118 Bacteria 4212
261 Ga0207683_10009648 3300026121 Bacteria 8227
262 Ga0207428_10002682 3300027907 Bacteria 17733
263 Ga0207428_10009273 3300027907 Bacteria 8833
264 Ga0207428_10010055 3300027907 Bacteria 8468
265 Ga0207428_10036543 3300027907 Bacteria 4005
266 Ga0207428_10093998 3300027907 Bacteria 2325
267 Ga0207428_10099861 3300027907 Bacteria 2243
268 Ga0268265_10016894 3300028380 Bacteria 5023
269 Ga0268265_10150409 3300028380 Bacteria 1962
270 Ga0265327_10028794 3300031251 Bacteria 3169
271 Ga0307408_100003677 3300031548 Bacteria 10454
272 Ga0307408_100010376 3300031548 Bacteria 6143
273 Ga0307405_10060475 3300031731 Bacteria 2391
274 Ga0307413_10016559 3300031824 Bacteria 3812
275 Ga0307406_10103521 3300031901 Bacteria 1944
276 Ga0307407_10007355 3300031903 Bacteria 4983
277 Ga0307407_10055000 3300031903 Bacteria 2298
278 Ga0307412_10013513 3300031911 Bacteria 4789
279 Ga0307409_100004775 3300031995 Bacteria 7683
280 Ga0307416_100003209 3300032002 Bacteria 9583
281 Ga0307411_10003053 3300032005 Bacteria 7649
282 Ga0307411_10012813 3300032005 Bacteria 4596
283 Ga0307415_100018184 3300032126 Bacteria 4237
284 Ga0373934_0012501 3300035086 Bacteria 3204
285 Ga0373957_0002509 3300035120 Bacteria 5254
286 Ga0373955_0129038 3300035172 Bacteria 1475
287 Ga0373927_0002470 3300035695 Bacteria 13491
288 Ga0373937_0003005 3300036401 Bacteria 14142
289 Ga0395899_0033840 3300037312 Bacteria 3838
290 Ga0395905_0015461 3300037471 Bacteria 7255
291 Ga0395901_0017792 3300038443 Bacteria 7253
292 Ga0436365_1464468 3300039437 Bacteria 1667
293 Ga0439453_0003379 3300041408 Bacteria 2293
294 Ga0451576_0141991 3300045051 Bacteria 2504
295 Ga0495603_0062109 3300046455 Bacteria 2206
296 Ga0495629_0002248 3300046459 Bacteria 14886
297 Ga0495638_0003656 3300046460 Bacteria 11997
298 Ga0495580_0004490 3300046472 Bacteria 11726
299 Ga0495582_0008019 3300046473 Bacteria 5830
300 Ga0495664_0058473 3300046477 Bacteria 2294
301 Ga0495594_0009714 3300046499 Bacteria 4978
302 Ga0495643_0003257 3300046522 Bacteria 12009
303 Ga0495665_0084078 3300046531 Bacteria 1673
304 Ga0495587_0004902 3300046536 Bacteria 8778
305 Ga0495588_0084241 3300046674 Bacteria 1661
306 Ga0495623_0010799 3300046679 Bacteria 5912
307 Ga0495647_0003356 3300046681 Bacteria 5129
308 Ga0495658_0009221 3300046683 Bacteria 4907
309 Ga0495669_0004344 3300046684 Bacteria 5851
310 Ga0495581_0027302 3300047315 Bacteria 3310
311 Ga0495672_0010108 3300047320 Bacteria 6752
312 Ga0495675_0003299 3300047444 Bacteria 9705
313 Ga0495684_0014519 3300047471 Bacteria 6063
314 Ga0496100_0112209 3300048903 Bacteria 1896
315 Ga0496101_0003757 3300048904 Bacteria 9480
316 Ga0496102_0010134 3300048905 Bacteria 8105
317 Ga0496105_0032677 3300048908 Bacteria 4272
318 Ga0496108_0004421 3300048911 Bacteria 11311
319 Ga0496108_0170284 3300048911 Bacteria 1884
320 Ga0496109_0033267 3300048912 Bacteria 4637
321 Ga0496110_0002837 3300048913 Bacteria 13082
322 Ga0496111_0001065 3300048914 Bacteria 15132
323 Ga0496112_0000271 3300048915 Bacteria 33508
324 Ga0501036_0058410 3300049572 Bacteria 3268
325 Ga0501039_0037279 3300049575 Bacteria 3752
326 Ga0501042_0020124 3300049578 Bacteria 4641
327 Ga0501046_0096913 3300049580 Bacteria 2266
328 Ga0501076_0091290 3300049592 Bacteria 2450
329 nmdc:mga00v17_123801_c1 3300050491 Bacteria 1648
330 nmdc:mga00v17_79764_c1 3300050491 Bacteria 2042
331 nmdc:mga06z11_15883_c1 3300050494 Bacteria 3374
332 nmdc:mga05p37_155463_c1 3300050507 Bacteria 2795
333 nmdc:mga05p37_16_c1 3300050507 Bacteria 130728
334 nmdc:mga05p37_54062_c1 3300050507 Bacteria 4940
335 nmdc:mga05p37_92062_c1 3300050507 Bacteria 3736
336 nmdc:mga05p37_9653_c1 3300050507 Bacteria 11435
337 nmdc:mga09592_186106_c1 3300050508 Bacteria 1797
338 nmdc:mga09592_2033_c1 3300050508 Bacteria 16320
339 nmdc:mga09592_22784_c1 3300050508 Bacteria 5168
340 nmdc:mga09592_38757_c1 3300050508 Bacteria 4001
341 nmdc:mga09592_90714_c1 3300050508 Unclassified 2611
342 nmdc:mga0qj67_10364_c1 3300050509 Bacteria 6961
343 nmdc:mga0qj67_13956_c1 3300050509 Bacteria 6067
344 nmdc:mga0qj67_15616_c1 3300050509 Bacteria 5750
345 nmdc:mga0qj67_433_c1 3300050509 Bacteria 28644
346 nmdc:mga0qj67_63486_c1 3300050509 Bacteria 2937
347 nmdc:mga06r32_11073_c1 3300050510 Bacteria 8120
348 nmdc:mga06r32_151173_c1 3300050510 Bacteria 2300
349 nmdc:mga06r32_18814_c1 3300050510 Bacteria 6330
350 nmdc:mga06r32_45187_c1 3300050510 Bacteria 4197
351 nmdc:mga06r32_487_c1 3300050510 Bacteria 34252
352 nmdc:mga06r32_51588_c1 3300050510 Bacteria 3937
353 nmdc:mga08y16_1391_c1 3300050511 Bacteria 24210
354 nmdc:mga08y16_26917_c1 3300050511 Bacteria 6060
355 nmdc:mga08y16_3597_c1 3300050511 Bacteria 16098
356 nmdc:mga08y16_39210_c1 3300050511 Bacteria 4970
357 nmdc:mga08y16_6865_c1 3300050511 Bacteria 11938
358 nmdc:mga08y16_8570_c1 3300050511 Bacteria 10715
359 nmdc:mga0n895_133479_c1 3300050512 Bacteria 2508
360 nmdc:mga0n895_58127_c1 3300050512 Bacteria 3813
361 nmdc:mga0n895_69514_c1 3300050512 Bacteria 3489
362 nmdc:mga0a205_56289_c1 3300050515 Bacteria 3797
363 nmdc:mga0a205_62079_c1 3300050515 Bacteria 3610
364 nmdc:mga0a205_66861_c2 3300050515 Bacteria 1896
365 Ga0495595_0074153 3300053084 Bacteria 1613
366 Ga0500641_0000524 3300053096 Bacteria 13797
367 Ga0500555_000269 3300053103 Bacteria 22364
368 Ga0500592_000470 3300053116 Bacteria 6712
369 Ga0500568_0014149 3300053139 Bacteria 3612
370 Ga0500616_0000276 3300053153 Bacteria 76619
371 Ga0500645_000076 3300053730 Bacteria 78006
372 Ga0530510_0005242 3300061734 Bacteria 8950
373 nmdc:mga0k408_111443_c1
374 Ga0065712_10000274
375 Ga0065712_10007381
376 Ga0065715_10007515
377 Ga0070676_10003563
378 Ga0070676_10007332
379 Ga0070683_100041474
380 Ga0070683_100051916
381 Ga0070690_100008565
382 Ga0070690_100091845
383 Ga0070670_100001742
384 Ga0070670_100002923
385 Ga0070670_100011940
386 Ga0070670_100025261
387 Ga0070670_100185505
388 Ga0068869_100001167
389 Ga0068869_100155197
390 Ga0070666_10011743
391 Ga0070666_10019722
392 Ga0070680_100025055
393 Ga0070682_100001097
394 Ga0068868_100016585
395 Ga0068868_100033014
396 Ga0068868_100059509
397 Ga0070660_100024406
398 Ga0070689_100030716
399 Ga0070687_100003615
400 Ga0070661_100022993
401 Ga0070692_10007058
402 Ga0070668_100010694
403 Ga0070668_100090839
404 Ga0070669_100043859
405 Ga0070669_100085269
406 Ga0070669_100144739
407 Ga0070675_100000348
408 Ga0070675_100005000
409 Ga0070675_100017594
410 Ga0070675_100046861
411 Ga0070674_100007821
412 Ga0070688_100030000
413 Ga0070688_100073137
414 Ga0070688_100093401
415 Ga0070659_100009099
416 Ga0070659_100072959
417 Ga0070659_100182941
418 Ga0070667_100009305
419 Ga0070667_100139272
420 Ga0070711_100005421
421 Ga0070700_100051235
422 Ga0070694_100120826
423 Ga0070708_100000004
424 Ga0070678_100041826
425 Ga0070678_100104312
426 Ga0070662_100001472
427 Ga0070662_100011344
428 Ga0070662_100046260
429 Ga0070681_10016679
430 Ga0070681_10019978
431 Ga0070681_10143868
432 Ga0070698_100000263
433 Ga0070699_100003817
434 Ga0070679_100010037
435 Ga0070679_100014823
436 Ga0070684_100000238
437 Ga0070684_100045671
438 Ga0070684_100058896
439 Ga0070672_100003205
440 Ga0070672_100027770
441 Ga0070672_100174321
442 Ga0070686_100025643
443 Ga0070695_100028590
444 Ga0070696_100001619
445 Ga0070665_100028716
446 Ga0068855_100036141
447 Ga0068855_100101064
448 Ga0070664_100000156
449 Ga0070664_100002504
450 Ga0070664_100009859
451 Ga0068857_100010501
452 Ga0068857_100019884
453 Ga0068857_100196744
454 Ga0068856_100009659
455 Ga0070702_100020949
456 Ga0068852_100056192
457 Ga0068852_100081338
458 Ga0068859_100008517
459 Ga0068864_100022514
460 Ga0068864_100030299
461 Ga0068864_100078974
462 Ga0068861_100010106
463 Ga0068863_100013215
464 Ga0068858_100021413
465 Ga0068858_100056105
466 Ga0068860_100041943
467 Ga0068860_100080177
468 Ga0068860_100234209
469 Ga0068862_100008289
470 Ga0075364_10047294
471 Ga0068871_100070246
472 Ga0075428_100008522
473 Ga0075428_100010039
474 Ga0075428_100013736
475 Ga0075428_100028497
476 Ga0075428_100030536
477 Ga0075428_100034635
478 Ga0075428_100069404
479 Ga0075428_100095011
480 Ga0075430_100000804
481 Ga0075430_100001135
482 Ga0075430_100003851
483 Ga0075430_100015583
484 Ga0075430_100018260
485 Ga0075430_100045131
486 Ga0075431_100000707
487 Ga0075431_100006399
488 Ga0075431_100011151
489 Ga0075431_100017853
490 Ga0075431_100030570
491 Ga0075431_100054763
492 Ga0075431_100057039
493 Ga0075431_100113692
494 Ga0075431_100290891
495 Ga0075433_10018869
496 Ga0075433_10039747
497 Ga0075434_100006343
498 Ga0075434_100042559
499 Ga0075434_100126101
500 Ga0075434_100195256
501 Ga0075429_100006737
502 Ga0075429_100031658
503 Ga0075429_100053111
504 Ga0075429_100084018
505 Ga0068865_100130034
506 Ga0097620_100008517
507 Ga0111539_10000040
508 Ga0111539_10005315
509 Ga0111539_10025587
510 Ga0111539_10045755
511 Ga0111539_10089816
512 Ga0111539_10147566
513 Ga0111539_10178218
514 Ga0111539_10190474
515 Ga0105245_10005268
516 Ga0114129_10006123
517 Ga0114129_10014298
518 Ga0114129_10024381
519 Ga0114129_10188080
520 Ga0114129_10271523
521 Ga0114129_10545317
522 Ga0105242_10013037
523 Ga0105242_10062113
524 Ga0105242_10065967
525 Ga0105248_10061517
526 Ga0105249_10004373
527 Ga0105249_10006108
528 Ga0105239_10057433
529 Ga0157371_10020432
530 Ga0157371_10025583
531 Ga0157369_10022113
532 Ga0157378_10079178
533 Ga0157378_10195719
534 Ga0163162_10221218
535 Ga0157372_10001820
536 Ga0157372_10019397
537 Ga0157372_10261304
538 Ga0157375_10099295
539 Ga0163163_10014609
540 Ga0163163_10016467
541 Ga0163163_10027613
542 Ga0163163_10032491
543 Ga0157380_10003829
544 Ga0157380_10007406
545 Ga0157380_10010727
546 Ga0157380_10092542
547 Ga0157380_10097324
548 Ga0157377_10022476
549 Ga0157376_10008148
550 Ga0157376_10159602
551 Ga0163161_10047257
552 Ga0207682_10001088
553 Ga0207688_10009873
554 Ga0207688_10013787
555 Ga0207680_10004774
556 Ga0207645_10001751
557 Ga0207643_10001718
558 Ga0207643_10005668
559 Ga0207643_10016037
560 Ga0207707_10019304
561 Ga0207707_10157315
562 Ga0207663_10003317
563 Ga0207662_10009958
564 Ga0207662_10069673
565 Ga0207657_10008429
566 Ga0207657_10028927
567 Ga0207649_10008549
568 Ga0207649_10034614
569 Ga0207681_10033825
570 Ga0207650_10004110
571 Ga0207650_10008975
572 Ga0207659_10000365
573 Ga0207659_10012668
574 Ga0207659_10020365
575 Ga0207659_10032672
576 Ga0207659_10049193
577 Ga0207659_10072524
578 Ga0207687_10056839
579 Ga0207700_10015925
580 Ga0207644_10163114
581 Ga0207690_10002601
582 Ga0207690_10051661
583 Ga0207690_10066699
584 Ga0207706_10001216
585 Ga0207706_10002011
586 Ga0207706_10021115
587 Ga0207706_10022087
588 Ga0207706_10071314
589 Ga0207670_10045926
590 Ga0207670_10054615
591 Ga0207669_10004646
592 Ga0207669_10023233
593 Ga0207691_10002077
594 Ga0207691_10005392
595 Ga0207711_10061921
596 Ga0207689_10002755
597 Ga0207689_10003979
598 Ga0207689_10016399
599 Ga0207661_10011881
600 Ga0207661_10035480
601 Ga0207661_10047001
602 Ga0207661_10054576
603 Ga0207679_10001853
604 Ga0207679_10007865
605 Ga0207679_10017520
606 Ga0207679_10021229
607 Ga0207679_10031014
608 Ga0207679_10031134
609 Ga0207679_10078693
610 Ga0207679_10181669
611 Ga0207667_10161499
612 Ga0207651_10004775
613 Ga0207712_10086456
614 Ga0207668_10013793
615 Ga0207668_10059315
616 Ga0207668_10139105
617 Ga0207658_10066347
618 Ga0207677_10078543
619 Ga0207639_10126795
620 Ga0207678_10038206
621 Ga0207708_10019725
622 Ga0207702_10049821
623 Ga0207641_10013336
624 Ga0207641_10052037
625 Ga0207648_10011024
626 Ga0207648_10085839
627 Ga0207676_10001510
628 Ga0207674_10001037
629 Ga0207674_10001105
630 Ga0207674_10004579
631 Ga0207675_100005848
632 Ga0207675_100043133
633 Ga0207683_10009648
634 Ga0207428_10002682
635 Ga0207428_10009273
636 Ga0207428_10010055
637 Ga0207428_10036543
638 Ga0207428_10093998
639 Ga0207428_10099861
640 Ga0268265_10016894
641 Ga0268265_10150409
642 Ga0265327_10028794
643 Ga0307408_100003677
644 Ga0307408_100010376
645 Ga0307405_10060475
646 Ga0307413_10016559
647 Ga0307406_10103521
648 Ga0307407_10007355
649 Ga0307407_10055000
650 Ga0307412_10013513
651 Ga0307409_100004775
652 Ga0307416_100003209
653 Ga0307411_10003053
654 Ga0307411_10012813
655 Ga0307415_100018184
656 Ga0373934_0012501
657 Ga0373957_0002509
658 Ga0373955_0129038
659 Ga0373927_0002470
660 Ga0373937_0003005
661 Ga0395899_0033840
662 Ga0395905_0015461
663 Ga0395901_0017792
664 Ga0436365_1464468
665 Ga0439453_0003379
666 Ga0451576_0141991
667 Ga0495603_0062109
668 Ga0495629_0002248
669 Ga0495638_0003656
670 Ga0495580_0004490
671 Ga0495582_0008019
672 Ga0495664_0058473
673 Ga0495594_0009714
674 Ga0495643_0003257
675 Ga0495665_0084078
676 Ga0495587_0004902
677 Ga0495588_0084241
678 Ga0495623_0010799
679 Ga0495647_0003356
680 Ga0495658_0009221
681 Ga0495669_0004344
682 Ga0495581_0027302
683 Ga0495672_0010108
684 Ga0495675_0003299
685 Ga0495684_0014519
686 Ga0496100_0112209
687 Ga0496101_0003757
688 Ga0496102_0010134
689 Ga0496105_0032677
690 Ga0496108_0004421
691 Ga0496108_0170284
692 Ga0496109_0033267
693 Ga0496110_0002837
694 Ga0496111_0001065
695 Ga0496112_0000271
696 Ga0501036_0058410
697 Ga0501039_0037279
698 Ga0501042_0020124
699 Ga0501046_0096913
700 Ga0501076_0091290
701 nmdc:mga00v17_123801_c1
702 nmdc:mga00v17_79764_c1
703 nmdc:mga06z11_15883_c1
704 nmdc:mga05p37_155463_c1
705 nmdc:mga05p37_16_c1
706 nmdc:mga05p37_54062_c1
707 nmdc:mga05p37_92062_c1
708 nmdc:mga05p37_9653_c1
709 nmdc:mga09592_186106_c1
710 nmdc:mga09592_2033_c1
711 nmdc:mga09592_22784_c1
712 nmdc:mga09592_38757_c1
713 nmdc:mga09592_90714_c1
714 nmdc:mga0qj67_10364_c1
715 nmdc:mga0qj67_13956_c1
716 nmdc:mga0qj67_15616_c1
717 nmdc:mga0qj67_433_c1
718 nmdc:mga0qj67_63486_c1
719 nmdc:mga06r32_11073_c1
720 nmdc:mga06r32_151173_c1
721 nmdc:mga06r32_18814_c1
722 nmdc:mga06r32_45187_c1
723 nmdc:mga06r32_487_c1
724 nmdc:mga06r32_51588_c1
725 nmdc:mga08y16_1391_c1
726 nmdc:mga08y16_26917_c1
727 nmdc:mga08y16_3597_c1
728 nmdc:mga08y16_39210_c1
729 nmdc:mga08y16_6865_c1
730 nmdc:mga08y16_8570_c1
731 nmdc:mga0n895_133479_c1
732 nmdc:mga0n895_58127_c1
733 nmdc:mga0n895_69514_c1
734 nmdc:mga0a205_56289_c1
735 nmdc:mga0a205_62079_c1
736 nmdc:mga0a205_66861_c2
737 Ga0495595_0074153
738 Ga0500641_0000524
739 Ga0500555_000269
740 Ga0500592_000470
741 Ga0500568_0014149
742 Ga0500616_0000276
743 Ga0500645_000076
744 Ga0530510_0005242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

1

420

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wj3-assembly2.cif.gz_D crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8659 42 476
4yji-assembly1.cif.gz_A the crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family 0.8645 42 471
3ip4-assembly1.cif.gz_A the high resolution structure of gatcab 0.8637 41 472
4yj6-assembly1.cif.gz_A the crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family 0.8589 42 471
3h0r-assembly7.cif.gz_S structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.8381 42 476
ID Description Score Start End Superfamily
4wj3D00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8659 42 476 3.90.1300.10
2dqnA00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.865 41 472 3.90.1300.10
af_Q9LI77_43_527_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8519 53 465 3.90.1300.10
af_Q5FWT5_3_499_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8415 45 468 3.90.1300.10
af_P9WQ93_21_468_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8402 47 466 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A3S1E0Z4-F1-model_v4 Amidase 0.9612 41 163 GO:0012505
AF-A0A7V2XB70-F1-model_v4 Amidase 0.9418 39 398 GO:0003824
AF-A0A7Y9LHQ1-F1-model_v4 deleted 0.9414 42 164
AF-A0A355AYG4-F1-model_v4 Amidase domain-containing protein 0.9392 40 229 GO:0003824
AF-A0A7C2G498-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A 0.9387 59 163 GO:0003824

Map