F426117

General Info

Members Datasets Scaffolds Average Seq Length
372 171 369 282

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000765|Ga0451577_0000765_14957_15898
Length 313
Sequence MKVCAQLSSFAVEFLNNKPMLKTERPILGLDIGGTNIKAGVLVGSDLVDIRMIETPSQESQEFILETIADLIGTYLHHEFFAIGIGIPGLIDTELGIVLNLENIPSFKRVHLREFLELRFGKPVYINNDANCFALGEYKFGAAKIYKHVVGITLGTGLGAGIIANGHLYCGFNCAAGEWCSAPYLDQDFEFYCSSKFFHSKYHAKAKSLARRAKEGDPIALKAYAEFGHHLGELIKNILYTLAPQAIVLGGSIRKAYPFFRESMLANIATFKYPSVSANLKILISELDETGIHGAVALVDEYAVPAEPVEKSI

Samples

Sample ID Description Type Environment
1 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
2 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
3 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
130 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
164 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
165 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 0.54
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004231 3300001904 Bacteria 2461
2 JGI25162J39368_1000516 3300002737 Bacteria 28941
3 JGI25165J46597_1000420 3300003214 Bacteria 43968
4 rootH1_10047188 3300003323 Bacteria 30688
5 rootH1_10119243 3300003323 Bacteria 3182
6 Ga0070658_10071653 3300005327 Bacteria 2838
7 Ga0070676_10002454 3300005328 Bacteria 9494
8 Ga0070683_100002970 3300005329 Bacteria 13601
9 Ga0070683_100006527 3300005329 Bacteria 9796
10 Ga0070683_100246005 3300005329 Bacteria 1701
11 Ga0070683_100385818 3300005329 Bacteria 1335
12 Ga0070670_100027147 3300005331 Bacteria 4925
13 Ga0070670_100121447 3300005331 Bacteria 2254
14 Ga0068869_100002555 3300005334 Bacteria 10982
15 Ga0068869_100020238 3300005334 Bacteria 4561
16 Ga0068869_100083184 3300005334 Bacteria 2393
17 Ga0070666_10053679 3300005335 Unclassified 2719
18 Ga0070666_10254926 3300005335 Unclassified 1243
19 Ga0070680_100002502 3300005336 Bacteria 13614
20 Ga0068868_100009438 3300005338 Bacteria 7022
21 Ga0068868_100060235 3300005338 Bacteria 3005
22 Ga0070660_100000327 3300005339 Bacteria 31340
23 Ga0070660_100250442 3300005339 Bacteria 1444
24 Ga0070660_100259383 3300005339 Bacteria 1419
25 Ga0070689_100001988 3300005340 Bacteria 13242
26 Ga0070689_100024836 3300005340 Bacteria 4499
27 Ga0070661_100002053 3300005344 Bacteria 13879
28 Ga0070675_100013233 3300005354 Bacteria 6484
29 Ga0070671_100057538 3300005355 Bacteria 3235
30 Ga0070673_100007731 3300005364 Bacteria 7112
31 Ga0070673_100273705 3300005364 Bacteria 1479
32 Ga0070688_100079945 3300005365 Bacteria 2113
33 Ga0070659_100008622 3300005366 Bacteria 7456
34 Ga0070659_100014368 3300005366 Bacteria 5916
35 Ga0070659_100059535 3300005366 Bacteria 3015
36 Ga0070659_100061614 3300005366 Bacteria 2964
37 Ga0070667_100054825 3300005367 Bacteria 3367
38 Ga0070663_100005240 3300005455 Bacteria 7682
39 Ga0070663_100295046 3300005455 Bacteria 1296
40 Ga0070662_100049885 3300005457 Bacteria 3019
41 Ga0070662_100108266 3300005457 Bacteria 2113
42 Ga0070681_10005612 3300005458 Bacteria 12126
43 Ga0070681_10033255 3300005458 Bacteria 5177
44 Ga0070681_10123933 3300005458 Bacteria 2517
45 Ga0070681_10229410 3300005458 Bacteria 1771
46 Ga0070681_10269682 3300005458 Bacteria 1613
47 Ga0068867_100004842 3300005459 Bacteria 9468
48 Ga0068867_100007722 3300005459 Bacteria 7607
49 Ga0068867_100076533 3300005459 Bacteria 2513
50 Ga0070685_10009297 3300005466 Bacteria 5071
51 Ga0070679_100001428 3300005530 Bacteria 21122
52 Ga0070679_100041884 3300005530 Bacteria 4559
53 Ga0070679_100152950 3300005530 Bacteria 2283
54 Ga0070679_100401049 3300005530 Bacteria 1317
55 Ga0070684_100000214 3300005535 Bacteria 40555
56 Ga0070684_100002052 3300005535 Bacteria 14826
57 Ga0068853_100008191 3300005539 Bacteria 8391
58 Ga0068853_100024786 3300005539 Bacteria 5033
59 Ga0068853_100254682 3300005539 Bacteria 1612
60 Ga0070686_100028274 3300005544 Bacteria 3399
61 Ga0070686_100158790 3300005544 Bacteria 1590
62 Ga0068855_100011365 3300005563 Bacteria 10748
63 Ga0068855_100090179 3300005563 Unclassified 3538
64 Ga0068855_100192776 3300005563 Bacteria 2297
65 Ga0068855_100295519 3300005563 Bacteria 1795
66 Ga0068855_100355692 3300005563 Bacteria 1612
67 Ga0068855_100549210 3300005563 Bacteria 1251
68 Ga0070664_100003687 3300005564 Bacteria 12351
69 Ga0070664_100046062 3300005564 Bacteria 3683
70 Ga0070664_100172889 3300005564 Bacteria 1917
71 Ga0068857_100010859 3300005577 Bacteria 7926
72 Ga0068857_100025798 3300005577 Bacteria 5175
73 Ga0068857_100076464 3300005577 Unclassified 2986
74 Ga0068854_100011059 3300005578 Bacteria 5859
75 Ga0068854_100078284 3300005578 Bacteria 2435
76 Ga0068854_100476144 3300005578 Bacteria 1048
77 Ga0068856_100183501 3300005614 Bacteria 2106
78 Ga0068856_100721011 3300005614 Bacteria 1017
79 Ga0068852_100000207 3300005616 Bacteria 39824
80 Ga0068852_100028921 3300005616 Bacteria 4544
81 Ga0068852_100059024 3300005616 Bacteria 3326
82 Ga0068852_100299658 3300005616 Bacteria 1556
83 Ga0068859_100020315 3300005617 Bacteria 6667
84 Ga0068859_100025646 3300005617 Bacteria 5912
85 Ga0068859_100173038 3300005617 Unclassified 2241
86 Ga0068864_100008092 3300005618 Bacteria 8672
87 Ga0068864_100065331 3300005618 Bacteria 3156
88 Ga0068864_100235374 3300005618 Bacteria 1695
89 Ga0068864_100741590 3300005618 Bacteria 962
90 Ga0068866_10047091 3300005718 Unclassified 2172
91 Ga0068866_10176911 3300005718 Bacteria 1257
92 Ga0068861_100282793 3300005719 Bacteria 1429
93 Ga0068863_100270999 3300005841 Bacteria 1643
94 Ga0068863_100280733 3300005841 Unclassified 1614
95 Ga0068858_100082685 3300005842 Bacteria 2985
96 Ga0068858_100265757 3300005842 Unclassified 1632
97 Ga0068860_100003295 3300005843 Bacteria 16613
98 Ga0068860_100040657 3300005843 Unclassified 4444
99 Ga0068860_100133844 3300005843 Bacteria 2380
100 Ga0068862_100014981 3300005844 Bacteria 6440
101 Ga0097621_100110577 3300006237 Bacteria 2321
102 Ga0068871_100020279 3300006358 Bacteria 5090
103 Ga0068871_100088767 3300006358 Bacteria 2573
104 Ga0097620_100020314 3300006931 Bacteria 6667
105 Ga0097620_100025648 3300006931 Bacteria 5912
106 Ga0097620_100173040 3300006931 Unclassified 2241
107 Ga0105244_10000025 3300009036 Bacteria 217877
108 Ga0111539_10010793 3300009094 Bacteria 11502
109 Ga0114129_10042230 3300009147 Bacteria 6419
110 Ga0105242_10078253 3300009176 Bacteria 2760
111 Ga0105242_10331152 3300009176 Bacteria 1400
112 Ga0105242_10475042 3300009176 Bacteria 1184
113 Ga0105248_10144634 3300009177 Bacteria 2683
114 Ga0105248_10300728 3300009177 Bacteria 1807
115 Ga0105237_10024841 3300009545 Bacteria 6131
116 Ga0105237_10159866 3300009545 Bacteria 2251
117 Ga0105249_10042631 3300009553 Bacteria 4129
118 Ga0105249_10092083 3300009553 Bacteria 2838
119 Ga0105249_10195544 3300009553 Bacteria 1976
120 Ga0105249_10601945 3300009553 Bacteria 1154
121 Ga0105239_10000006 3300010375 Bacteria 442319
122 Ga0105239_10084182 3300010375 Unclassified 3503
123 Ga0105246_10157335 3300011119 Bacteria 1727
124 Ga0157373_10006680 3300013100 Bacteria 8592
125 Ga0157373_10066670 3300013100 Bacteria 2546
126 Ga0157373_10171912 3300013100 Bacteria 1524
127 Ga0157371_10002360 3300013102 Bacteria 18064
128 Ga0157371_10002769 3300013102 Bacteria 16467
129 Ga0157371_10004304 3300013102 Bacteria 12492
130 Ga0157371_10006656 3300013102 Bacteria 9458
131 Ga0157371_10007582 3300013102 Bacteria 8757
132 Ga0157371_10008962 3300013102 Bacteria 7914
133 Ga0157371_10026677 3300013102 Bacteria 4195
134 Ga0157371_10054376 3300013102 Bacteria 2843
135 Ga0157371_10103091 3300013102 Bacteria 2025
136 Ga0157371_10173183 3300013102 Bacteria 1543
137 Ga0157371_10212237 3300013102 Bacteria 1389
138 Ga0157371_10213831 3300013102 Bacteria 1384
139 Ga0157371_10220403 3300013102 Unclassified 1362
140 Ga0157371_10448424 3300013102 Bacteria 948
141 Ga0157370_10001799 3300013104 Bacteria 26427
142 Ga0157370_10005301 3300013104 Bacteria 14485
143 Ga0157370_10128507 3300013104 Bacteria 2364
144 Ga0157370_10511004 3300013104 Bacteria 1103
145 Ga0157369_10035950 3300013105 Bacteria 5429
146 Ga0157369_10072294 3300013105 Bacteria 3702
147 Ga0157369_10084575 3300013105 Unclassified 3391
148 Ga0157369_10106014 3300013105 Bacteria 2991
149 Ga0157374_10000660 3300013296 Bacteria 30313
150 Ga0157374_10003316 3300013296 Bacteria 13520
151 Ga0157374_10017698 3300013296 Bacteria 6280
152 Ga0157378_10624400 3300013297 Unclassified 1091
153 Ga0163162_10002414 3300013306 Bacteria 17587
154 Ga0157372_10026894 3300013307 Bacteria 6262
155 Ga0157372_10032279 3300013307 Bacteria 5740
156 Ga0157372_10036773 3300013307 Bacteria 5398
157 Ga0157372_10098070 3300013307 Bacteria 3343
158 Ga0157372_10187933 3300013307 Bacteria 2392
159 Ga0157372_10230157 3300013307 Bacteria 2149
160 Ga0157372_10341038 3300013307 Bacteria 1745
161 Ga0157372_10485596 3300013307 Bacteria 1440
162 Ga0157372_10967443 3300013307 Unclassified 986
163 Ga0157375_10003088 3300013308 Bacteria 14452
164 Ga0157375_10006560 3300013308 Bacteria 10129
165 Ga0157375_10025379 3300013308 Bacteria 5506
166 Ga0157375_10132284 3300013308 Bacteria 2615
167 Ga0163163_10002002 3300014325 Bacteria 17218
168 Ga0163163_10053968 3300014325 Bacteria 3969
169 Ga0163163_10211383 3300014325 Bacteria 1989
170 Ga0157380_10188316 3300014326 Unclassified 1819
171 Ga0157377_10005810 3300014745 Bacteria 5826
172 Ga0157377_10142951 3300014745 Bacteria 1472
173 Ga0157377_10166997 3300014745 Bacteria 1373
174 Ga0157379_10029511 3300014968 Bacteria 4876
175 Ga0157379_10063697 3300014968 Unclassified 3296
176 Ga0157376_10025645 3300014969 Unclassified 4646
177 Ga0157376_10292580 3300014969 Bacteria 1538
178 Ga0157376_10489962 3300014969 Bacteria 1206
179 Ga0163161_10000014 3300017792 Bacteria 258440
180 Ga0163161_10006183 3300017792 Bacteria 8296
181 Ga0163161_10104189 3300017792 Unclassified 2115
182 Ga0207427_100043 3300025231 Bacteria 249595
183 Ga0209437_100008 3300025233 Bacteria 921142
184 Ga0209233_1000158 3300025261 Bacteria 162281
185 Ga0207655_1000003 3300025728 Bacteria 1081376
186 Ga0207642_10114369 3300025899 Bacteria 1380
187 Ga0207680_10053513 3300025903 Bacteria 2424
188 Ga0207680_10223112 3300025903 Unclassified 1293
189 Ga0207647_10000011 3300025904 Bacteria 156667
190 Ga0207647_10089413 3300025904 Bacteria 1838
191 Ga0207647_10166943 3300025904 Bacteria 1283
192 Ga0207645_10002079 3300025907 Bacteria 16016
193 Ga0207705_10010201 3300025909 Bacteria 6834
194 Ga0207705_10286281 3300025909 Bacteria 1262
195 Ga0207707_10158764 3300025912 Unclassified 1977
196 Ga0207707_10237044 3300025912 Bacteria 1587
197 Ga0207695_10445321 3300025913 Unclassified 1178
198 Ga0207671_10004001 3300025914 Bacteria 14319
199 Ga0207660_10252124 3300025917 Bacteria 1393
200 Ga0207657_10000716 3300025919 Bacteria 35235
201 Ga0207657_10047112 3300025919 Bacteria 3772
202 Ga0207657_10187243 3300025919 Bacteria 1671
203 Ga0207649_10004222 3300025920 Bacteria 7829
204 Ga0207649_10023932 3300025920 Bacteria 3543
205 Ga0207652_10000013 3300025921 Bacteria 222247
206 Ga0207652_10000890 3300025921 Bacteria 28278
207 Ga0207652_10001292 3300025921 Bacteria 22268
208 Ga0207652_10050220 3300025921 Bacteria 3573
209 Ga0207681_10071108 3300025923 Bacteria 2426
210 Ga0207650_10016830 3300025925 Bacteria 5115
211 Ga0207650_10245248 3300025925 Bacteria 1449
212 Ga0207659_10008148 3300025926 Bacteria 6485
213 Ga0207659_10114602 3300025926 Bacteria 2055
214 Ga0207644_10491654 3300025931 Bacteria 1011
215 Ga0207690_10008257 3300025932 Bacteria 6175
216 Ga0207690_10033802 3300025932 Bacteria 3290
217 Ga0207690_10150013 3300025932 Bacteria 1727
218 Ga0207690_10384055 3300025932 Bacteria 1117
219 Ga0207706_10005267 3300025933 Bacteria 12062
220 Ga0207706_10025427 3300025933 Bacteria 5305
221 Ga0207686_10446639 3300025934 Unclassified 994
222 Ga0207670_10024451 3300025936 Bacteria 3775
223 Ga0207704_10062451 3300025938 Bacteria 2316
224 Ga0207691_10024906 3300025940 Bacteria 5623
225 Ga0207711_10393280 3300025941 Bacteria 1287
226 Ga0207689_10016575 3300025942 Bacteria 6234
227 Ga0207689_10019542 3300025942 Bacteria 5708
228 Ga0207689_10091625 3300025942 Bacteria 2497
229 Ga0207689_10247991 3300025942 Bacteria 1473
230 Ga0207661_10002958 3300025944 Bacteria 11754
231 Ga0207661_10003816 3300025944 Bacteria 10507
232 Ga0207661_10398875 3300025944 Bacteria 1247
233 Ga0207679_10002300 3300025945 Bacteria 11778
234 Ga0207679_10007822 3300025945 Bacteria 6792
235 Ga0207679_10017901 3300025945 Bacteria 4735
236 Ga0207679_10040587 3300025945 Unclassified 3333
237 Ga0207667_10000323 3300025949 Bacteria 66327
238 Ga0207667_10097605 3300025949 Bacteria 3032
239 Ga0207651_10294433 3300025960 Bacteria 1347
240 Ga0207712_10357833 3300025961 Bacteria 1215
241 Ga0207712_10427615 3300025961 Bacteria 1118
242 Ga0207668_10146118 3300025972 Unclassified 1825
243 Ga0207640_10059230 3300025981 Bacteria 2527
244 Ga0207640_10167335 3300025981 Bacteria 1634
245 Ga0207677_10028045 3300026023 Bacteria 3556
246 Ga0207677_10054502 3300026023 Unclassified 2729
247 Ga0207703_10567177 3300026035 Bacteria 1071
248 Ga0207639_10004893 3300026041 Bacteria 9022
249 Ga0207639_10061518 3300026041 Unclassified 2900
250 Ga0207639_10081500 3300026041 Bacteria 2563
251 Ga0207678_10006605 3300026067 Bacteria 10283
252 Ga0207678_10080142 3300026067 Bacteria 2795
253 Ga0207702_10670400 3300026078 Bacteria 1021
254 Ga0207641_10254057 3300026088 Bacteria 1643
255 Ga0207641_10538873 3300026088 Unclassified 1137
256 Ga0207648_10012243 3300026089 Bacteria 8033
257 Ga0207648_10039945 3300026089 Unclassified 4124
258 Ga0207676_10311251 3300026095 Bacteria 1442
259 Ga0207676_10728097 3300026095 Bacteria 963
260 Ga0207674_10003496 3300026116 Bacteria 19183
261 Ga0207674_10035539 3300026116 Bacteria 5200
262 Ga0207674_10063562 3300026116 Unclassified 3726
263 Ga0207674_10094767 3300026116 Bacteria 2971
264 Ga0207675_100457492 3300026118 Bacteria 1265
265 Ga0207683_10043139 3300026121 Bacteria 3940
266 Ga0207683_10388220 3300026121 Bacteria 1284
267 Ga0207698_10001507 3300026142 Bacteria 13555
268 Ga0207698_10011843 3300026142 Bacteria 5678
269 Ga0207698_10140674 3300026142 Bacteria 2079
270 Ga0207698_10233662 3300026142 Unclassified 1671
271 Ga0207698_10590248 3300026142 Unclassified 1094
272 Ga0268265_10110228 3300028380 Bacteria 2245
273 Ga0268264_10203358 3300028381 Bacteria 1813
274 Ga0268264_10359950 3300028381 Bacteria 1387
275 Ga0268264_10405677 3300028381 Bacteria 1311
276 Ga0265338_10000907 3300028800 Bacteria 49891
277 Ga0265338_10014415 3300028800 Bacteria 8800
278 Ga0316579_10029202 3300031691 Bacteria 2515
279 Ga0316579_10119276 3300031691 Unclassified 1267
280 Ga0316576_10084675 3300031727 Unclassified 2356
281 Ga0316578_10011811 3300031728 Bacteria 4585
282 Ga0316578_10074468 3300031728 Bacteria 2013
283 Ga0316577_10057498 3300031733 Bacteria 2172
284 Ga0316585_10024335 3300032137 Bacteria 1873
285 Ga0316585_10027468 3300032137 Unclassified 1776
286 Ga0316580_10006730 3300032139 Bacteria 3398
287 Ga0373955_0049083 3300035172 Bacteria 2291
288 Ga0316574_0129385 3300035398 Bacteria 1624
289 Ga0373937_0044168 3300036401 Bacteria 4069
290 Ga0316582_0034717 3300036647 Bacteria 3108
291 Ga0316582_0066831 3300036647 Bacteria 2318
292 Ga0316582_0103821 3300036647 Bacteria 1885
293 Ga0316582_0250460 3300036647 Unclassified 1214
294 Ga0316584_0006289 3300036712 Bacteria 8042
295 Ga0316584_0021979 3300036712 Bacteria 4646
296 Ga0316584_0072657 3300036712 Bacteria 2578
297 Ga0395899_0010715 3300037312 Bacteria 7027
298 Ga0395899_0058156 3300037312 Bacteria 2852
299 Ga0395899_0193636 3300037312 Bacteria 1421
300 Ga0395899_0215936 3300037312 Bacteria 1330
301 Ga0395900_0006121 3300037418 Bacteria 12548
302 Ga0395900_0007210 3300037418 Bacteria 11521
303 Ga0395900_0044796 3300037418 Bacteria 4558
304 Ga0395900_0059796 3300037418 Bacteria 3922
305 Ga0395900_0107759 3300037418 Bacteria 2862
306 Ga0395900_0128628 3300037418 Bacteria 2596
307 Ga0395900_0166049 3300037418 Bacteria 2249
308 Ga0395900_0426856 3300037418 Bacteria 1285
309 Ga0395898_0001921 3300037466 Bacteria 26459
310 Ga0395898_0004564 3300037466 Bacteria 15113
311 Ga0395898_0177383 3300037466 Bacteria 2036
312 Ga0395898_0570929 3300037466 Unclassified 1073
313 Ga0395905_0005782 3300037471 Bacteria 12570
314 Ga0395905_0109010 3300037471 Bacteria 2600
315 Ga0395905_0176185 3300037471 Bacteria 2008
316 Ga0395905_0500979 3300037471 Unclassified 1115
317 Ga0316581_0046959 3300037588 Bacteria 1321
318 Ga0395901_0020065 3300038443 Bacteria 6839
319 Ga0395901_0026645 3300038443 Bacteria 5935
320 Ga0395901_0028934 3300038443 Bacteria 5701
321 Ga0395901_0178441 3300038443 Unclassified 2227
322 Ga0395901_0299804 3300038443 Bacteria 1666
323 Ga0400490_43546 3300038726 Bacteria 15799
324 Ga0451577_0000389 3300042876 Bacteria 81293
325 Ga0451577_0000765 3300042876 Bacteria 48591
326 Ga0451577_0007863 3300042876 Bacteria 10428
327 Ga0451577_0009697 3300042876 Bacteria 9232
328 Ga0451577_0141433 3300042876 Bacteria 2163
329 Ga0451577_0147083 3300042876 Bacteria 2119
330 Ga0451577_0453731 3300042876 Bacteria 1164
331 Ga0453683_0000366 3300044673 Bacteria 54040
332 Ga0453683_0022177 3300044673 Unclassified 4051
333 Ga0453683_0233603 3300044673 Bacteria 1170
334 Ga0453684_0000225 3300044712 Bacteria 245902
335 Ga0453684_0000616 3300044712 Bacteria 130153
336 Ga0453684_0001168 3300044712 Bacteria 81539
337 Ga0453684_0002160 3300044712 Bacteria 49185
338 Ga0453684_0012603 3300044712 Bacteria 13907
339 Ga0453684_0021961 3300044712 Bacteria 9498
340 Ga0453684_0235654 3300044712 Bacteria 2110
341 Ga0451576_0000540 3300045051 Bacteria 81293
342 Ga0451576_0012438 3300045051 Bacteria 9559
343 Ga0451576_0050820 3300045051 Bacteria 4347
344 Ga0495592_0138588 3300046454 Bacteria 1694
345 Ga0495653_0212146 3300046463 Bacteria 1307
346 Ga0495608_0182792 3300046511 Bacteria 1326
347 Ga0495630_0057916 3300046517 Bacteria 2904
348 Ga0495640_0030330 3300046533 Bacteria 3873
349 Ga0495586_0128625 3300046535 Bacteria 1418
350 Ga0495587_0068492 3300046536 Bacteria 2067
351 Ga0495634_0036059 3300046642 Bacteria 3384
352 Ga0495658_0119346 3300046683 Bacteria 1594
353 Ga0495600_0139445 3300046809 Bacteria 1574
354 Ga0495684_0028921 3300047471 Bacteria 4253
355 Ga0495686_0008227 3300047472 Bacteria 7689
356 Ga0496102_0590832 3300048905 Unclassified 1033
357 Ga0496111_0140809 3300048914 Bacteria 1787
358 Ga0501033_0053254 3300049570 Bacteria 2997
359 Ga0501034_0172512 3300049571 Bacteria 2129
360 Ga0501217_013657 3300049661 Bacteria 1825
361 Ga0501252_014308 3300049682 Bacteria 979
362 Ga0501259_002029 3300049688 Bacteria 3341
363 Ga0501035_0080540 3300049822 Bacteria 2875
364 Ga0501035_0263444 3300049822 Bacteria 1461
365 Ga0501044_0664844 3300049823 Bacteria 930
366 nmdc:mga0k408_225459_c1 3300050493 Bacteria 1119
367 nmdc:mga05p37_586032_c1 3300050507 Unclassified 1262
368 nmdc:mga06r32_180947_c1 3300050510 Bacteria 2094
369 Ga0500584_033545 3300053726 Bacteria 2378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0129385 Ga0316574_0129385_19_708 227
2 3300049822 Ga0501035_0080540 Ga0501035_0080540_89_781 228
3 3300046454 Ga0495592_0138588 Ga0495592_0138588_16_738 238
4 3300036647 Ga0316582_0066831 Ga0316582_0066831_1405_2181 256
5 3300036712 Ga0316584_0072657 Ga0316584_0072657_93_869 256
6 3300037588 Ga0316581_0046959 Ga0316581_0046959_442_1218 256
7 3300009553 Ga0105249_10195544 Ga0105249_101955442 260
8 3300005331 Ga0070670_100121447 Ga0070670_1001214473 261
9 3300013307 Ga0157372_10967443 Ga0157372_109674432 264
10 3300009036 Ga0105244_10000025 Ga0105244_1000002580 265
11 3300013102 Ga0157371_10008962 Ga0157371_100089624 265
12 3300013105 Ga0157369_10084575 Ga0157369_100845752 265
13 3300013307 Ga0157372_10032279 Ga0157372_100322792 265
14 3300017792 Ga0163161_10000014 Ga0163161_1000001440 265
15 3300025728 Ga0207655_1000003 Ga0207655_1000003597 265
16 3300038726 Ga0400490_43546 Ga0400490_43546_7640_8482 265
17 3300053726 Ga0500584_033545 Ga0500584_033545_774_1631 265
18 3300025945 Ga0207679_10017901 Ga0207679_100179014 266
19 3300026067 Ga0207678_10080142 Ga0207678_100801422 266
20 3300044673 Ga0453683_0233603 Ga0453683_0233603_138_983 266
21 3300005530 Ga0070679_100001428 Ga0070679_1000014287 273
22 3300025921 Ga0207652_10000013 Ga0207652_10000013170 273
23 3300037312 Ga0395899_0058156 Ga0395899_0058156_771_1622 273
24 3300037418 Ga0395900_0059796 Ga0395900_0059796_316_1167 273
25 3300037471 Ga0395905_0500979 Ga0395905_0500979_125_1009 273
26 3300005614 Ga0068856_100721011 Ga0068856_1007210111 274
27 3300009545 Ga0105237_10159866 Ga0105237_101598662 274
28 3300026078 Ga0207702_10670400 Ga0207702_106704002 274
29 3300026142 Ga0207698_10233662 Ga0207698_102336622 274
30 3300005616 Ga0068852_100299658 Ga0068852_1002996582 275
31 3300026142 Ga0207698_10590248 Ga0207698_105902482 275
32 3300042876 Ga0451577_0141433 Ga0451577_0141433_222_1073 275
33 3300044712 Ga0453684_0012603 Ga0453684_0012603_928_1779 275
34 3300045051 Ga0451576_0012438 Ga0451576_0012438_3404_4255 275
35 3300006358 Ga0068871_100020279 Ga0068871_1000202795 276
36 3300042876 Ga0451577_0147083 Ga0451577_0147083_676_1515 276
37 3300044712 Ga0453684_0021961 Ga0453684_0021961_7212_8048 276
38 3300005577 Ga0068857_100076464 Ga0068857_1000764642 277
39 3300005617 Ga0068859_100173038 Ga0068859_1001730382 277
40 3300005843 Ga0068860_100040657 Ga0068860_1000406572 277
41 3300006931 Ga0097620_100173040 Ga0097620_1001730402 277
42 3300026118 Ga0207675_100457492 Ga0207675_1004574922 277
43 3300028381 Ga0268264_10359950 Ga0268264_103599502 277
44 3300028800 Ga0265338_10000907 Ga0265338_1000090729 277
45 3300042876 Ga0451577_0000389 Ga0451577_0000389_43027_43866 277
46 3300042876 Ga0451577_0007863 Ga0451577_0007863_1502_2344 277
47 3300042876 Ga0451577_0009697 Ga0451577_0009697_1319_2158 277
48 3300042876 Ga0451577_0453731 Ga0451577_0453731_257_1099 277
49 3300044673 Ga0453683_0000366 Ga0453683_0000366_14621_15460 277
50 3300044712 Ga0453684_0000225 Ga0453684_0000225_214714_215556 277
51 3300044712 Ga0453684_0001168 Ga0453684_0001168_37428_38267 277
52 3300045051 Ga0451576_0000540 Ga0451576_0000540_37428_38267 277
53 iso_pu_bacteria 2738541279 2738735696 277
54 iso_pu_bacteria 2738541285 2738768273 277
55 iso_pu_bacteria 2738543007 2739217278 277
56 3300005843 Ga0068860_100133844 Ga0068860_1001338444 278
57 3300009553 Ga0105249_10601945 Ga0105249_106019452 278
58 3300025961 Ga0207712_10427615 Ga0207712_104276151 278
59 3300044673 Ga0453683_0022177 Ga0453683_0022177_1937_2782 278
60 3300044712 Ga0453684_0000616 Ga0453684_0000616_93877_94722 278
61 3300044712 Ga0453684_0235654 Ga0453684_0235654_137_982 278
62 3300047472 Ga0495686_0008227 Ga0495686_0008227_6703_7545 278
63 3300050493 nmdc:mga0k408_225459_c1 nmdc:mga0k408_225459_c1_266_1108 278
64 3300005563 Ga0068855_100192776 Ga0068855_1001927762 279
65 3300013307 Ga0157372_10230157 Ga0157372_102301573 279
66 3300014325 Ga0163163_10053968 Ga0163163_100539682 279
67 3300025925 Ga0207650_10016830 Ga0207650_100168305 279
68 3300025949 Ga0207667_10097605 Ga0207667_100976053 279
69 3300038443 Ga0395901_0020065 Ga0395901_0020065_5950_6828 279
70 3300002737 JGI25162J39368_1000516 JGI25162J39368_10005164 280
71 3300003214 JGI25165J46597_1000420 JGI25165J46597_100042036 280
72 3300003323 rootH1_10047188 rootH1_1004718810 280
73 3300003323 rootH1_10119243 rootH1_101192432 280
74 3300005328 Ga0070676_10002454 Ga0070676_100024548 280
75 3300005329 Ga0070683_100002970 Ga0070683_10000297011 280
76 3300005329 Ga0070683_100006527 Ga0070683_1000065275 280
77 3300005329 Ga0070683_100385818 Ga0070683_1003858182 280
78 3300005331 Ga0070670_100027147 Ga0070670_1000271474 280
79 3300005334 Ga0068869_100002555 Ga0068869_1000025557 280
80 3300005334 Ga0068869_100020238 Ga0068869_1000202383 280
81 3300005335 Ga0070666_10053679 Ga0070666_100536792 280
82 3300005335 Ga0070666_10254926 Ga0070666_102549262 280
83 3300005338 Ga0068868_100009438 Ga0068868_1000094383 280
84 3300005338 Ga0068868_100060235 Ga0068868_1000602352 280
85 3300005339 Ga0070660_100259383 Ga0070660_1002593832 280
86 3300005340 Ga0070689_100001988 Ga0070689_1000019884 280
87 3300005340 Ga0070689_100024836 Ga0070689_1000248363 280
88 3300005344 Ga0070661_100002053 Ga0070661_10000205312 280
89 3300005355 Ga0070671_100057538 Ga0070671_1000575382 280
90 3300005364 Ga0070673_100007731 Ga0070673_1000077315 280
91 3300005364 Ga0070673_100273705 Ga0070673_1002737052 280
92 3300005365 Ga0070688_100079945 Ga0070688_1000799453 280
93 3300005366 Ga0070659_100008622 Ga0070659_1000086229 280
94 3300005367 Ga0070667_100054825 Ga0070667_1000548253 280
95 3300005455 Ga0070663_100295046 Ga0070663_1002950462 280
96 3300005457 Ga0070662_100049885 Ga0070662_1000498852 280
97 3300005457 Ga0070662_100108266 Ga0070662_1001082662 280
98 3300005459 Ga0068867_100004842 Ga0068867_1000048428 280
99 3300005459 Ga0068867_100076533 Ga0068867_1000765331 280
100 3300005466 Ga0070685_10009297 Ga0070685_100092972 280
101 3300005535 Ga0070684_100000214 Ga0070684_10000021435 280
102 3300005535 Ga0070684_100002052 Ga0070684_1000020523 280
103 3300005539 Ga0068853_100008191 Ga0068853_1000081914 280
104 3300005539 Ga0068853_100254682 Ga0068853_1002546821 280
105 3300005544 Ga0070686_100028274 Ga0070686_1000282742 280
106 3300005544 Ga0070686_100158790 Ga0070686_1001587902 280
107 3300005563 Ga0068855_100295519 Ga0068855_1002955192 280
108 3300005564 Ga0070664_100003687 Ga0070664_10000368714 280
109 3300005564 Ga0070664_100046062 Ga0070664_1000460622 280
110 3300005564 Ga0070664_100172889 Ga0070664_1001728892 280
111 3300005577 Ga0068857_100010859 Ga0068857_1000108594 280
112 3300005577 Ga0068857_100025798 Ga0068857_1000257984 280
113 3300005578 Ga0068854_100011059 Ga0068854_1000110593 280
114 3300005578 Ga0068854_100476144 Ga0068854_1004761442 280
115 3300005614 Ga0068856_100183501 Ga0068856_1001835012 280
116 3300005616 Ga0068852_100028921 Ga0068852_1000289212 280
117 3300005616 Ga0068852_100059024 Ga0068852_1000590241 280
118 3300005617 Ga0068859_100025646 Ga0068859_1000256461 280
119 3300005618 Ga0068864_100008092 Ga0068864_1000080927 280
120 3300005618 Ga0068864_100065331 Ga0068864_1000653314 280
121 3300005618 Ga0068864_100235374 Ga0068864_1002353741 280
122 3300005718 Ga0068866_10176911 Ga0068866_101769111 280
123 3300005841 Ga0068863_100270999 Ga0068863_1002709992 280
124 3300005841 Ga0068863_100280733 Ga0068863_1002807332 280
125 3300005842 Ga0068858_100082685 Ga0068858_1000826853 280
126 3300005842 Ga0068858_100265757 Ga0068858_1002657572 280
127 3300006237 Ga0097621_100110577 Ga0097621_1001105772 280
128 3300006358 Ga0068871_100088767 Ga0068871_1000887673 280
129 3300006931 Ga0097620_100025648 Ga0097620_1000256481 280
130 3300009176 Ga0105242_10078253 Ga0105242_100782533 280
131 3300009176 Ga0105242_10475042 Ga0105242_104750421 280
132 3300009177 Ga0105248_10144634 Ga0105248_101446342 280
133 3300009177 Ga0105248_10300728 Ga0105248_103007283 280
134 3300009545 Ga0105237_10024841 Ga0105237_100248413 280
135 3300009553 Ga0105249_10042631 Ga0105249_100426311 280
136 3300010375 Ga0105239_10000006 Ga0105239_100000062 280
137 3300010375 Ga0105239_10084182 Ga0105239_100841823 280
138 3300013100 Ga0157373_10066670 Ga0157373_100666703 280
139 3300013102 Ga0157371_10002769 Ga0157371_100027699 280
140 3300013102 Ga0157371_10007582 Ga0157371_100075825 280
141 3300013102 Ga0157371_10212237 Ga0157371_102122372 280
142 3300013102 Ga0157371_10220403 Ga0157371_102204032 280
143 3300013104 Ga0157370_10128507 Ga0157370_101285071 280
144 3300013296 Ga0157374_10000660 Ga0157374_1000066026 280
145 3300013296 Ga0157374_10003316 Ga0157374_100033164 280
146 3300013296 Ga0157374_10017698 Ga0157374_100176982 280
147 3300013306 Ga0163162_10002414 Ga0163162_1000241413 280
148 3300013307 Ga0157372_10341038 Ga0157372_103410381 280
149 3300013308 Ga0157375_10003088 Ga0157375_100030885 280
150 3300013308 Ga0157375_10006560 Ga0157375_100065602 280
151 3300013308 Ga0157375_10025379 Ga0157375_100253795 280
152 3300013308 Ga0157375_10132284 Ga0157375_101322841 280
153 3300014325 Ga0163163_10002002 Ga0163163_1000200215 280
154 3300014325 Ga0163163_10211383 Ga0163163_102113832 280
155 3300014745 Ga0157377_10005810 Ga0157377_100058104 280
156 3300014745 Ga0157377_10166997 Ga0157377_101669971 280
157 3300014968 Ga0157379_10029511 Ga0157379_100295112 280
158 3300014968 Ga0157379_10063697 Ga0157379_100636972 280
159 3300014969 Ga0157376_10025645 Ga0157376_100256454 280
160 3300014969 Ga0157376_10292580 Ga0157376_102925801 280
161 3300014969 Ga0157376_10489962 Ga0157376_104899621 280
162 3300017792 Ga0163161_10006183 Ga0163161_100061839 280
163 3300017792 Ga0163161_10104189 Ga0163161_101041893 280
164 3300025231 Ga0207427_100043 Ga0207427_100043225 280
165 3300025233 Ga0209437_100008 Ga0209437_100008713 280
166 3300025261 Ga0209233_1000158 Ga0209233_100015865 280
167 3300025899 Ga0207642_10114369 Ga0207642_101143692 280
168 3300025903 Ga0207680_10053513 Ga0207680_100535132 280
169 3300025903 Ga0207680_10223112 Ga0207680_102231121 280
170 3300025904 Ga0207647_10166943 Ga0207647_101669432 280
171 3300025907 Ga0207645_10002079 Ga0207645_100020794 280
172 3300025913 Ga0207695_10445321 Ga0207695_104453212 280
173 3300025914 Ga0207671_10004001 Ga0207671_100040014 280
174 3300025920 Ga0207649_10004222 Ga0207649_100042226 280
175 3300025920 Ga0207649_10023932 Ga0207649_100239324 280
176 3300025923 Ga0207681_10071108 Ga0207681_100711081 280
177 3300025925 Ga0207650_10245248 Ga0207650_102452481 280
178 3300025926 Ga0207659_10114602 Ga0207659_101146023 280
179 3300025931 Ga0207644_10491654 Ga0207644_104916541 280
180 3300025933 Ga0207706_10005267 Ga0207706_100052672 280
181 3300025933 Ga0207706_10025427 Ga0207706_100254273 280
182 3300025934 Ga0207686_10446639 Ga0207686_104466391 280
183 3300025936 Ga0207670_10024451 Ga0207670_100244512 280
184 3300025938 Ga0207704_10062451 Ga0207704_100624511 280
185 3300025940 Ga0207691_10024906 Ga0207691_100249063 280
186 3300025941 Ga0207711_10393280 Ga0207711_103932802 280
187 3300025942 Ga0207689_10016575 Ga0207689_100165753 280
188 3300025942 Ga0207689_10019542 Ga0207689_100195422 280
189 3300025942 Ga0207689_10091625 Ga0207689_100916252 280
190 3300025944 Ga0207661_10002958 Ga0207661_100029585 280
191 3300025944 Ga0207661_10003816 Ga0207661_1000381613 280
192 3300025944 Ga0207661_10398875 Ga0207661_103988752 280
193 3300025945 Ga0207679_10002300 Ga0207679_100023008 280
194 3300025945 Ga0207679_10007822 Ga0207679_100078227 280
195 3300025945 Ga0207679_10040587 Ga0207679_100405874 280
196 3300025960 Ga0207651_10294433 Ga0207651_102944332 280
197 3300025961 Ga0207712_10357833 Ga0207712_103578332 280
198 3300025972 Ga0207668_10146118 Ga0207668_101461181 280
199 3300025981 Ga0207640_10059230 Ga0207640_100592303 280
200 3300026023 Ga0207677_10028045 Ga0207677_100280453 280
201 3300026023 Ga0207677_10054502 Ga0207677_100545023 280
202 3300026035 Ga0207703_10567177 Ga0207703_105671771 280
203 3300026041 Ga0207639_10004893 Ga0207639_100048936 280
204 3300026041 Ga0207639_10081500 Ga0207639_100815001 280
205 3300026088 Ga0207641_10254057 Ga0207641_102540572 280
206 3300026088 Ga0207641_10538873 Ga0207641_105388731 280
207 3300026089 Ga0207648_10012243 Ga0207648_100122432 280
208 3300026095 Ga0207676_10311251 Ga0207676_103112511 280
209 3300026116 Ga0207674_10003496 Ga0207674_1000349612 280
210 3300026116 Ga0207674_10035539 Ga0207674_100355394 280
211 3300026121 Ga0207683_10043139 Ga0207683_100431395 280
212 3300026142 Ga0207698_10011843 Ga0207698_100118434 280
213 3300026142 Ga0207698_10140674 Ga0207698_101406742 280
214 3300028381 Ga0268264_10405677 Ga0268264_104056772 280
215 3300028800 Ga0265338_10014415 Ga0265338_100144156 280
216 3300031691 Ga0316579_10029202 Ga0316579_100292022 280
217 3300031728 Ga0316578_10011811 Ga0316578_100118113 280
218 3300031728 Ga0316578_10074468 Ga0316578_100744682 280
219 3300031733 Ga0316577_10057498 Ga0316577_100574982 280
220 3300032137 Ga0316585_10024335 Ga0316585_100243352 280
221 3300035172 Ga0373955_0049083 Ga0373955_0049083_1180_2028 280
222 3300036401 Ga0373937_0044168 Ga0373937_0044168_417_1265 280
223 3300036647 Ga0316582_0250460 Ga0316582_0250460_298_1149 280
224 3300036712 Ga0316584_0006289 Ga0316584_0006289_2598_3446 280
225 3300046463 Ga0495653_0212146 Ga0495653_0212146_237_1085 280
226 3300046511 Ga0495608_0182792 Ga0495608_0182792_237_1085 280
227 3300046517 Ga0495630_0057916 Ga0495630_0057916_213_1061 280
228 3300046533 Ga0495640_0030330 Ga0495640_0030330_2209_3057 280
229 3300046535 Ga0495586_0128625 Ga0495586_0128625_295_1143 280
230 3300046536 Ga0495587_0068492 Ga0495587_0068492_66_914 280
231 3300046642 Ga0495634_0036059 Ga0495634_0036059_912_1760 280
232 3300046683 Ga0495658_0119346 Ga0495658_0119346_207_1055 280
233 3300046809 Ga0495600_0139445 Ga0495600_0139445_265_1113 280
234 3300047471 Ga0495684_0028921 Ga0495684_0028921_1664_2512 280
235 3300048905 Ga0496102_0590832 Ga0496102_0590832_79_927 280
236 3300048914 Ga0496111_0140809 Ga0496111_0140809_558_1406 280
237 3300049661 Ga0501217_013657 Ga0501217_013657_743_1606 280
238 3300049682 Ga0501252_014308 Ga0501252_014308_104_967 280
239 3300049688 Ga0501259_002029 Ga0501259_002029_830_1693 280
240 3300005327 Ga0070658_10071653 Ga0070658_100716532 281
241 3300005334 Ga0068869_100083184 Ga0068869_1000831842 281
242 3300005336 Ga0070680_100002502 Ga0070680_1000025022 281
243 3300005366 Ga0070659_100059535 Ga0070659_1000595353 281
244 3300005366 Ga0070659_100061614 Ga0070659_1000616143 281
245 3300005455 Ga0070663_100005240 Ga0070663_1000052408 281
246 3300005458 Ga0070681_10005612 Ga0070681_100056124 281
247 3300005458 Ga0070681_10033255 Ga0070681_100332554 281
248 3300005458 Ga0070681_10123933 Ga0070681_101239332 281
249 3300005458 Ga0070681_10229410 Ga0070681_102294101 281
250 3300005458 Ga0070681_10269682 Ga0070681_102696822 281
251 3300005459 Ga0068867_100007722 Ga0068867_1000077223 281
252 3300005530 Ga0070679_100152950 Ga0070679_1001529503 281
253 3300005530 Ga0070679_100401049 Ga0070679_1004010492 281
254 3300005563 Ga0068855_100011365 Ga0068855_1000113653 281
255 3300005563 Ga0068855_100090179 Ga0068855_1000901792 281
256 3300005563 Ga0068855_100549210 Ga0068855_1005492102 281
257 3300005578 Ga0068854_100078284 Ga0068854_1000782842 281
258 3300005617 Ga0068859_100020315 Ga0068859_1000203152 281
259 3300005618 Ga0068864_100741590 Ga0068864_1007415901 281
260 3300005718 Ga0068866_10047091 Ga0068866_100470912 281
261 3300005719 Ga0068861_100282793 Ga0068861_1002827932 281
262 3300005843 Ga0068860_100003295 Ga0068860_1000032958 281
263 3300005844 Ga0068862_100014981 Ga0068862_1000149817 281
264 3300006931 Ga0097620_100020314 Ga0097620_1000203142 281
265 3300009176 Ga0105242_10331152 Ga0105242_103311521 281
266 3300009553 Ga0105249_10092083 Ga0105249_100920833 281
267 3300011119 Ga0105246_10157335 Ga0105246_101573352 281
268 3300013100 Ga0157373_10006680 Ga0157373_100066803 281
269 3300013100 Ga0157373_10171912 Ga0157373_101719122 281
270 3300013102 Ga0157371_10026677 Ga0157371_100266774 281
271 3300013102 Ga0157371_10054376 Ga0157371_100543763 281
272 3300013102 Ga0157371_10173183 Ga0157371_101731832 281
273 3300013102 Ga0157371_10213831 Ga0157371_102138311 281
274 3300013102 Ga0157371_10448424 Ga0157371_104484241 281
275 3300013104 Ga0157370_10511004 Ga0157370_105110042 281
276 3300013105 Ga0157369_10035950 Ga0157369_100359504 281
277 3300013105 Ga0157369_10106014 Ga0157369_101060143 281
278 3300013297 Ga0157378_10624400 Ga0157378_106244002 281
279 3300013307 Ga0157372_10026894 Ga0157372_100268944 281
280 3300013307 Ga0157372_10098070 Ga0157372_100980703 281
281 3300013307 Ga0157372_10187933 Ga0157372_101879332 281
282 3300025904 Ga0207647_10089413 Ga0207647_100894132 281
283 3300025909 Ga0207705_10010201 Ga0207705_100102012 281
284 3300025909 Ga0207705_10286281 Ga0207705_102862811 281
285 3300025912 Ga0207707_10158764 Ga0207707_101587642 281
286 3300025912 Ga0207707_10237044 Ga0207707_102370442 281
287 3300025917 Ga0207660_10252124 Ga0207660_102521242 281
288 3300025919 Ga0207657_10047112 Ga0207657_100471124 281
289 3300025919 Ga0207657_10187243 Ga0207657_101872432 281
290 3300025921 Ga0207652_10001292 Ga0207652_1000129213 281
291 3300025921 Ga0207652_10050220 Ga0207652_100502201 281
292 3300025932 Ga0207690_10033802 Ga0207690_100338021 281
293 3300025932 Ga0207690_10384055 Ga0207690_103840552 281
294 3300025942 Ga0207689_10247991 Ga0207689_102479912 281
295 3300025949 Ga0207667_10000323 Ga0207667_100003234 281
296 3300026041 Ga0207639_10061518 Ga0207639_100615183 281
297 3300026067 Ga0207678_10006605 Ga0207678_1000660510 281
298 3300026089 Ga0207648_10039945 Ga0207648_100399452 281
299 3300026095 Ga0207676_10728097 Ga0207676_107280971 281
300 3300026116 Ga0207674_10063562 Ga0207674_100635626 281
301 3300026116 Ga0207674_10094767 Ga0207674_100947673 281
302 3300026121 Ga0207683_10388220 Ga0207683_103882202 281
303 3300028380 Ga0268265_10110228 Ga0268265_101102282 281
304 3300028381 Ga0268264_10203358 Ga0268264_102033582 281
305 3300031691 Ga0316579_10119276 Ga0316579_101192761 281
306 3300031727 Ga0316576_10084675 Ga0316576_100846752 281
307 3300032137 Ga0316585_10027468 Ga0316585_100274683 281
308 3300032139 Ga0316580_10006730 Ga0316580_100067304 281
309 3300036647 Ga0316582_0034717 Ga0316582_0034717_1793_2653 281
310 3300036647 Ga0316582_0103821 Ga0316582_0103821_532_1383 281
311 3300036712 Ga0316584_0021979 Ga0316584_0021979_1686_2546 281
312 3300037312 Ga0395899_0010715 Ga0395899_0010715_731_1582 281
313 3300037312 Ga0395899_0215936 Ga0395899_0215936_270_1148 281
314 3300037418 Ga0395900_0006121 Ga0395900_0006121_5987_6871 281
315 3300037418 Ga0395900_0107759 Ga0395900_0107759_534_1391 281
316 3300037418 Ga0395900_0426856 Ga0395900_0426856_253_1110 281
317 3300037466 Ga0395898_0004564 Ga0395898_0004564_5954_6805 281
318 3300037466 Ga0395898_0570929 Ga0395898_0570929_29_889 281
319 3300037471 Ga0395905_0109010 Ga0395905_0109010_1587_2444 281
320 3300037471 Ga0395905_0176185 Ga0395905_0176185_741_1619 281
321 3300038443 Ga0395901_0178441 Ga0395901_0178441_1107_1967 281
322 3300038443 Ga0395901_0299804 Ga0395901_0299804_373_1233 281
323 3300049570 Ga0501033_0053254 Ga0501033_0053254_832_1686 281
324 3300049571 Ga0501034_0172512 Ga0501034_0172512_890_1744 281
325 3300049822 Ga0501035_0263444 Ga0501035_0263444_165_1019 281
326 3300049823 Ga0501044_0664844 Ga0501044_0664844_42_893 281
327 3300001904 JGI24736J21556_1004231 JGI24736J21556_10042313 282
328 3300005329 Ga0070683_100246005 Ga0070683_1002460052 282
329 3300005339 Ga0070660_100000327 Ga0070660_10000032710 282
330 3300005339 Ga0070660_100250442 Ga0070660_1002504422 282
331 3300005354 Ga0070675_100013233 Ga0070675_1000132332 282
332 3300005366 Ga0070659_100014368 Ga0070659_1000143683 282
333 3300005530 Ga0070679_100041884 Ga0070679_1000418843 282
334 3300005539 Ga0068853_100024786 Ga0068853_1000247862 282
335 3300005563 Ga0068855_100355692 Ga0068855_1003556922 282
336 3300005616 Ga0068852_100000207 Ga0068852_10000020717 282
337 3300009094 Ga0111539_10010793 Ga0111539_1001079312 282
338 3300009147 Ga0114129_10042230 Ga0114129_100422302 282
339 3300013102 Ga0157371_10002360 Ga0157371_1000236014 282
340 3300013102 Ga0157371_10004304 Ga0157371_100043044 282
341 3300013102 Ga0157371_10006656 Ga0157371_100066563 282
342 3300013102 Ga0157371_10103091 Ga0157371_101030912 282
343 3300013104 Ga0157370_10001799 Ga0157370_1000179918 282
344 3300013104 Ga0157370_10005301 Ga0157370_1000530111 282
345 3300013105 Ga0157369_10072294 Ga0157369_100722942 282
346 3300013307 Ga0157372_10036773 Ga0157372_100367732 282
347 3300013307 Ga0157372_10485596 Ga0157372_104855961 282
348 3300014326 Ga0157380_10188316 Ga0157380_101883162 282
349 3300014745 Ga0157377_10142951 Ga0157377_101429511 282
350 3300025904 Ga0207647_10000011 Ga0207647_10000011141 282
351 3300025919 Ga0207657_10000716 Ga0207657_100007169 282
352 3300025921 Ga0207652_10000890 Ga0207652_100008904 282
353 3300025926 Ga0207659_10008148 Ga0207659_100081485 282
354 3300025932 Ga0207690_10008257 Ga0207690_100082573 282
355 3300025932 Ga0207690_10150013 Ga0207690_101500132 282
356 3300025981 Ga0207640_10167335 Ga0207640_101673352 282
357 3300026142 Ga0207698_10001507 Ga0207698_1000150711 282
358 3300037312 Ga0395899_0193636 Ga0395899_0193636_94_957 282
359 3300037418 Ga0395900_0007210 Ga0395900_0007210_2269_3129 282
360 3300037418 Ga0395900_0044796 Ga0395900_0044796_3320_4174 282
361 3300037418 Ga0395900_0128628 Ga0395900_0128628_1664_2524 282
362 3300037418 Ga0395900_0166049 Ga0395900_0166049_1306_2169 282
363 3300037466 Ga0395898_0001921 Ga0395898_0001921_5710_6570 282
364 3300037466 Ga0395898_0177383 Ga0395898_0177383_709_1572 282
365 3300037471 Ga0395905_0005782 Ga0395905_0005782_4549_5403 282
366 3300038443 Ga0395901_0026645 Ga0395901_0026645_759_1622 282
367 3300038443 Ga0395901_0028934 Ga0395901_0028934_3906_4766 282
368 3300042876 Ga0451577_0000765 Ga0451577_0000765_14957_15898 282
369 3300044712 Ga0453684_0002160 Ga0453684_0002160_33045_33986 282
370 3300045051 Ga0451576_0050820 Ga0451576_0050820_1710_2651 282
371 3300050507 nmdc:mga05p37_586032_c1 nmdc:mga05p37_586032_c1_46_900 282
372 3300050510 nmdc:mga06r32_180947_c1 nmdc:mga06r32_180947_c1_422_1276 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

27

302

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nck-assembly1.cif.gz_B the crystal structure of n-acetylmannosamine kinase in fusobacterium nucleatum 0.9236 5 278
2qm1-assembly1.cif.gz_B crystal structure of glucokinase from enterococcus faecalis 0.9064 4 277
7wn7-assembly1.cif.gz_A crystal structure of hearnpv p26 0.9044 5 33
5f7q-assembly1.cif.gz_C rok repressor lmo0178 from listeria monocytogenes bound to operator 0.8984 4 275
3r8e-assembly1.cif.gz_A-2 crystal structure of a putative sugar kinase (chu_1875) from cytophaga hutchinsonii atcc 33406 at 1.65 a resolution 0.8977 5 277
ID Description Score Start End Superfamily
af_I6Y8D3_1_125_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.928 5 120 3.30.420.40
af_Q2FY27_114_312_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9021 105 271 3.30.420.40
5nckB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8997 105 278 3.30.420.40
af_I6Y8D3_109_294_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8989 107 271 3.30.420.40
1z05A02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8895 3 118 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A0K8QYZ6-F1-model_v4 Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain 0.9818 5 278 GO:0016301
AF-A0A7X7WQH6-F1-model_v4 ROK family protein 0.9816 7 275 GO:0003824
AF-A0A0S7ZKB5-F1-model_v4 ROK family transcriptional regulator 0.9779 1 222 GO:0003824
AF-A0A136MDR0-F1-model_v4 ROK family protein 0.9747 1 279 GO:0003824
AF-A0A6L4ZBM0-F1-model_v4 Sugar kinase 0.9734 4 279 GO:0003824

Feature Viewer

pLDDT pTM Quality
93.71 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map