F426073

General Info

Members Datasets Scaffolds Average Seq Length
372 198 744 343

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10135718|Ga0207661_101357182
Length 393
Sequence MGRKTSPDEIRHANHLTLETNPTMSKSTSNDGILATLNEAPTSRRNFLRSASLTAVGGALVACGTGAAPAAAKQAANVSQAGGPKPGATGGTMGPHDTAAGPGMSAADAMDAMHEKGIKAFPAKTKVYGNQPLAPKIENGVKVFELTASEIQWETAPDQFVAALAYNGQVPGPQIRVTEGDKVRVVFTNKLKQSSAIHFHGLELPNNMDGVPFITQPPVKPGETFTYEFTVPNAGSHMYHSHHNAAYQVGLGLLGAFIVDPKNKSQEPKVDHDVVFILNDGAHGYTFNGKSFPGTEPIVAKLGEKVRIRYMNEGMMIHPMHLHGMHQTVIAKDGWPLSNPWKCDTLNIAPGERWDVVVNCNNPGTWAFHCHILPHAESDHGMFGMVTALVVQK

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.42
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 7.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10135718 3300025944 Bacteria 2113
2 Ga0070658_10038822 3300005327 Bacteria 3840
3 Ga0070676_10002067 3300005328 Bacteria 10207
4 Ga0070683_100001575 3300005329 Bacteria 17640
5 Ga0070683_100013889 3300005329 Bacteria 7034
6 Ga0070683_100022925 3300005329 Bacteria 5581
7 Ga0070683_100051029 3300005329 Bacteria 3831
8 Ga0070683_100080572 3300005329 Bacteria 3048
9 Ga0070683_100119240 3300005329 Bacteria 2492
10 Ga0070690_100034893 3300005330 Bacteria 3154
11 Ga0068869_100002807 3300005334 Bacteria 10559
12 Ga0070680_100001122 3300005336 Bacteria 19235
13 Ga0070682_100001884 3300005337 Bacteria 11711
14 Ga0070682_100006436 3300005337 Bacteria 6601
15 Ga0068868_100021126 3300005338 Unclassified 4902
16 Ga0068868_100045333 3300005338 Unclassified 3439
17 Ga0068868_100048962 3300005338 Unclassified 3316
18 Ga0068868_100235798 3300005338 Bacteria 1536
19 Ga0070660_100001507 3300005339 Bacteria 15962
20 Ga0070660_100023261 3300005339 Bacteria 4590
21 Ga0070689_100025728 3300005340 Bacteria 4424
22 Ga0070691_10000314 3300005341 Bacteria 17078
23 Ga0070687_100001117 3300005343 Bacteria 9252
24 Ga0070687_100009214 3300005343 Bacteria 4221
25 Ga0070661_100021774 3300005344 Bacteria 4584
26 Ga0070661_100066015 3300005344 Bacteria 2659
27 Ga0070692_10061405 3300005345 Bacteria 1981
28 Ga0070669_100005018 3300005353 Bacteria 9565
29 Ga0070669_100005434 3300005353 Bacteria 9191
30 Ga0070675_100006858 3300005354 Bacteria 8744
31 Ga0070675_100021373 3300005354 Bacteria 5171
32 Ga0070675_100078372 3300005354 Unclassified 2751
33 Ga0070671_100062784 3300005355 Bacteria 3093
34 Ga0070674_100071378 3300005356 Unclassified 2456
35 Ga0070673_100284412 3300005364 Bacteria 1451
36 Ga0070688_100012759 3300005365 Bacteria 4718
37 Ga0070659_100009579 3300005366 Bacteria 7119
38 Ga0070659_100041146 3300005366 Bacteria 3611
39 Ga0070659_100058922 3300005366 Bacteria 3031
40 Ga0070667_100037307 3300005367 Bacteria 4075
41 Ga0070714_100048971 3300005435 Bacteria 3596
42 Ga0070714_100113282 3300005435 Bacteria 2405
43 Ga0070714_100154752 3300005435 Bacteria 2069
44 Ga0070713_100000638 3300005436 Bacteria 22375
45 Ga0070700_100007099 3300005441 Bacteria 6025
46 Ga0070694_100020676 3300005444 Bacteria 4198
47 Ga0070694_100086591 3300005444 Bacteria 2190
48 Ga0070708_100000016 3300005445 Bacteria 124870
49 Ga0070663_100025537 3300005455 Bacteria 3990
50 Ga0070662_100002979 3300005457 Bacteria 10528
51 Ga0070662_100026887 3300005457 Bacteria 3988
52 Ga0070681_10021441 3300005458 Bacteria 6478
53 Ga0070681_10039706 3300005458 Bacteria 4717
54 Ga0070681_10090456 3300005458 Unclassified 3011
55 Ga0070681_10102333 3300005458 Bacteria 2809
56 Ga0068867_100237451 3300005459 Bacteria 1476
57 Ga0070685_10006344 3300005466 Bacteria 6024
58 Ga0070685_10021869 3300005466 Unclassified 3480
59 Ga0070707_100032156 3300005468 Bacteria 4998
60 Ga0070707_100198891 3300005468 Bacteria 1953
61 Ga0070698_100002015 3300005471 Bacteria 22574
62 Ga0070698_100008279 3300005471 Bacteria 11242
63 Ga0070698_100100692 3300005471 Bacteria 2862
64 Ga0070698_100193230 3300005471 Bacteria 1972
65 Ga0070699_100005659 3300005518 Bacteria 10942
66 Ga0070699_100073435 3300005518 Bacteria 2976
67 Ga0070699_100074482 3300005518 Bacteria 2954
68 Ga0070699_100085335 3300005518 Bacteria 2755
69 Ga0070679_100005667 3300005530 Bacteria 11577
70 Ga0070679_100006078 3300005530 Bacteria 11233
71 Ga0070679_100011490 3300005530 Bacteria 8438
72 Ga0070679_100080482 3300005530 Bacteria 3247
73 Ga0070684_100026783 3300005535 Bacteria 4860
74 Ga0070684_100053871 3300005535 Bacteria 3503
75 Ga0070684_100087436 3300005535 Bacteria 2767
76 Ga0070684_100088749 3300005535 Unclassified 2747
77 Ga0070684_100096919 3300005535 Bacteria 2630
78 Ga0070684_100139721 3300005535 Unclassified 2190
79 Ga0070684_100291038 3300005535 Bacteria 1497
80 Ga0070684_100358547 3300005535 Unclassified 1342
81 Ga0068853_100016587 3300005539 Bacteria 6065
82 Ga0068853_100055103 3300005539 Bacteria 3427
83 Ga0070672_100065487 3300005543 Bacteria 2874
84 Ga0070672_100083716 3300005543 Bacteria 2561
85 Ga0070686_100008175 3300005544 Bacteria 5854
86 Ga0070696_100004805 3300005546 Bacteria 9032
87 Ga0070693_100001248 3300005547 Bacteria 11510
88 Ga0070665_100275625 3300005548 Bacteria 1684
89 Ga0070704_100022495 3300005549 Bacteria 4104
90 Ga0068855_100073896 3300005563 Unclassified 3960
91 Ga0068855_100100778 3300005563 Bacteria 3325
92 Ga0070664_100004917 3300005564 Bacteria 10703
93 Ga0070664_100028184 3300005564 Bacteria 4671
94 Ga0070664_100041831 3300005564 Bacteria 3867
95 Ga0070664_100061550 3300005564 Bacteria 3199
96 Ga0070664_100097555 3300005564 Bacteria 2551
97 Ga0070664_100112907 3300005564 Unclassified 2373
98 Ga0070664_100156455 3300005564 Unclassified 2014
99 Ga0068857_100015435 3300005577 Bacteria 6670
100 Ga0068857_100021371 3300005577 Bacteria 5696
101 Ga0068857_100090161 3300005577 Bacteria 2744
102 Ga0068854_100015584 3300005578 Bacteria 5039
103 Ga0068854_100019590 3300005578 Bacteria 4563
104 Ga0068856_100017648 3300005614 Bacteria 6918
105 Ga0068856_100060642 3300005614 Bacteria 3737
106 Ga0068856_100071537 3300005614 Bacteria 3434
107 Ga0068856_100077262 3300005614 Bacteria 3299
108 Ga0070702_100013724 3300005615 Bacteria 4097
109 Ga0068852_100140231 3300005616 Bacteria 2236
110 Ga0068859_100002679 3300005617 Bacteria 18089
111 Ga0068859_100008573 3300005617 Bacteria 10338
112 Ga0068859_100282372 3300005617 Unclassified 1753
113 Ga0068864_100030706 3300005618 Bacteria 4556
114 Ga0068864_100109210 3300005618 Bacteria 2462
115 Ga0068870_10019191 3300005840 Bacteria 3313
116 Ga0068870_10031203 3300005840 Bacteria 2699
117 Ga0068870_10053009 3300005840 Bacteria 2153
118 Ga0068863_100019426 3300005841 Bacteria 6499
119 Ga0068860_100079662 3300005843 Bacteria 3115
120 Ga0068862_100000694 3300005844 Bacteria 34407
121 Ga0070717_10000619 3300006028 Bacteria 22822
122 Ga0070717_10032036 3300006028 Unclassified 4233
123 Ga0070717_10266228 3300006028 Bacteria 1517
124 Ga0097621_100054063 3300006237 Bacteria 3274
125 Ga0068871_100045000 3300006358 Bacteria 3551
126 Ga0075430_100302535 3300006846 Bacteria 1323
127 Ga0075429_100012593 3300006880 Bacteria 7332
128 Ga0068865_100013357 3300006881 Bacteria 5188
129 Ga0097620_100002679 3300006931 Bacteria 18089
130 Ga0097620_100008573 3300006931 Bacteria 10338
131 Ga0097620_100282346 3300006931 Unclassified 1753
132 Ga0105240_10016825 3300009093 Bacteria 9886
133 Ga0111539_10029721 3300009094 Bacteria 6652
134 Ga0111539_10036361 3300009094 Bacteria 5955
135 Ga0111539_10158962 3300009094 Bacteria 2643
136 Ga0105245_10042144 3300009098 Bacteria 4072
137 Ga0105245_10195490 3300009098 Bacteria 1940
138 Ga0114129_10439224 3300009147 Bacteria 1713
139 Ga0105241_10027372 3300009174 Bacteria 4245
140 Ga0105242_10050777 3300009176 Bacteria 3378
141 Ga0105248_10007943 3300009177 Bacteria 11662
142 Ga0105248_10093455 3300009177 Bacteria 3387
143 Ga0105249_10000293 3300009553 Bacteria 51433
144 Ga0105239_10093928 3300010375 Bacteria 3312
145 Ga0105246_10007545 3300011119 Bacteria 6673
146 Ga0157373_10013756 3300013100 Bacteria 5933
147 Ga0157373_10058015 3300013100 Bacteria 2745
148 Ga0157373_10122102 3300013100 Bacteria 1831
149 Ga0157371_10027925 3300013102 Bacteria 4089
150 Ga0157370_10054885 3300013104 Bacteria 3798
151 Ga0157370_10059156 3300013104 Bacteria 3642
152 Ga0157369_10123498 3300013105 Bacteria 2746
153 Ga0157369_10154736 3300013105 Bacteria 2422
154 Ga0157369_10310973 3300013105 Bacteria 1638
155 Ga0157374_10233340 3300013296 Bacteria 1808
156 Ga0157378_10071933 3300013297 Bacteria 3106
157 Ga0157378_10128600 3300013297 Unclassified 2342
158 Ga0157372_10007860 3300013307 Bacteria 11334
159 Ga0157372_10011094 3300013307 Bacteria 9586
160 Ga0157372_10086418 3300013307 Bacteria 3558
161 Ga0157372_10125687 3300013307 Bacteria 2948
162 Ga0157372_10255775 3300013307 Bacteria 2033
163 Ga0157375_10015881 3300013308 Bacteria 6748
164 Ga0157375_10041110 3300013308 Bacteria 4462
165 Ga0157375_10151344 3300013308 Bacteria 2456
166 Ga0157375_10253304 3300013308 Unclassified 1921
167 Ga0157375_10393276 3300013308 Bacteria 1553
168 Ga0157375_10413636 3300013308 Bacteria 1515
169 Ga0163163_10006763 3300014325 Bacteria 10052
170 Ga0157380_10009295 3300014326 Bacteria 7037
171 Ga0182008_10002741 3300014497 Bacteria 10926
172 Ga0157376_10272734 3300014969 Bacteria 1590
173 Ga0163161_10237115 3300017792 Bacteria 1417
174 Ga0207642_10091702 3300025899 Bacteria 1502
175 Ga0207688_10103367 3300025901 Unclassified 1648
176 Ga0207699_10004632 3300025906 Bacteria 6577
177 Ga0207645_10011023 3300025907 Bacteria 6185
178 Ga0207643_10006031 3300025908 Bacteria 6478
179 Ga0207643_10012595 3300025908 Bacteria 4566
180 Ga0207643_10037781 3300025908 Unclassified 2710
181 Ga0207705_10001557 3300025909 Bacteria 18211
182 Ga0207705_10022485 3300025909 Bacteria 4496
183 Ga0207705_10205463 3300025909 Bacteria 1493
184 Ga0207654_10200315 3300025911 Bacteria 1314
185 Ga0207707_10036390 3300025912 Bacteria 4304
186 Ga0207707_10146436 3300025912 Bacteria 2065
187 Ga0207707_10368992 3300025912 Bacteria 1235
188 Ga0207695_10011252 3300025913 Bacteria 10850
189 Ga0207695_10044334 3300025913 Bacteria 4731
190 Ga0207695_10073730 3300025913 Bacteria 3477
191 Ga0207660_10045634 3300025917 Bacteria 3088
192 Ga0207660_10299469 3300025917 Bacteria 1280
193 Ga0207657_10000825 3300025919 Bacteria 32774
194 Ga0207657_10019500 3300025919 Bacteria 6438
195 Ga0207657_10108938 3300025919 Bacteria 2290
196 Ga0207649_10076423 3300025920 Bacteria 2155
197 Ga0207649_10090231 3300025920 Bacteria 2005
198 Ga0207652_10047025 3300025921 Bacteria 3685
199 Ga0207652_10124270 3300025921 Bacteria 2298
200 Ga0207646_10039792 3300025922 Bacteria 4230
201 Ga0207681_10003589 3300025923 Bacteria 9652
202 Ga0207681_10012801 3300025923 Bacteria 5185
203 Ga0207681_10031445 3300025923 Bacteria 3466
204 Ga0207650_10097111 3300025925 Bacteria 2261
205 Ga0207650_10137496 3300025925 Bacteria 1918
206 Ga0207659_10048001 3300025926 Unclassified 3023
207 Ga0207659_10233964 3300025926 Bacteria 1483
208 Ga0207687_10235014 3300025927 Bacteria 1450
209 Ga0207700_10000761 3300025928 Bacteria 18589
210 Ga0207664_10010432 3300025929 Bacteria 6559
211 Ga0207664_10021354 3300025929 Bacteria 4811
212 Ga0207644_10095253 3300025931 Bacteria 2226
213 Ga0207690_10012276 3300025932 Bacteria 5127
214 Ga0207690_10049671 3300025932 Bacteria 2797
215 Ga0207706_10001665 3300025933 Bacteria 21963
216 Ga0207706_10002574 3300025933 Bacteria 17679
217 Ga0207686_10021132 3300025934 Bacteria 3730
218 Ga0207686_10138498 3300025934 Bacteria 1679
219 Ga0207669_10131059 3300025937 Bacteria 1723
220 Ga0207704_10258566 3300025938 Bacteria 1311
221 Ga0207691_10008313 3300025940 Bacteria 9966
222 Ga0207691_10083358 3300025940 Bacteria 2870
223 Ga0207691_10095098 3300025940 Bacteria 2665
224 Ga0207711_10060950 3300025941 Bacteria 3252
225 Ga0207689_10001038 3300025942 Bacteria 26675
226 Ga0207661_10000768 3300025944 Bacteria 20822
227 Ga0207661_10019818 3300025944 Bacteria 5019
228 Ga0207661_10029436 3300025944 Bacteria 4217
229 Ga0207661_10108942 3300025944 Bacteria 2339
230 Ga0207679_10001379 3300025945 Bacteria 15313
231 Ga0207679_10054195 3300025945 Bacteria 2951
232 Ga0207679_10063320 3300025945 Bacteria 2760
233 Ga0207679_10067816 3300025945 Bacteria 2678
234 Ga0207679_10137233 3300025945 Bacteria 1971
235 Ga0207667_10154873 3300025949 Bacteria 2358
236 Ga0207667_10195642 3300025949 Bacteria 2074
237 Ga0207712_10010780 3300025961 Bacteria 5811
238 Ga0207668_10054748 3300025972 Bacteria 2770
239 Ga0207640_10017990 3300025981 Bacteria 4145
240 Ga0207640_10025539 3300025981 Unclassified 3577
241 Ga0207658_10074027 3300025986 Unclassified 2587
242 Ga0207677_10020967 3300026023 Bacteria 3983
243 Ga0207677_10106059 3300026023 Bacteria 2081
244 Ga0207703_10304991 3300026035 Bacteria 1453
245 Ga0207639_10015355 3300026041 Bacteria 5402
246 Ga0207678_10011679 3300026067 Bacteria 7712
247 Ga0207708_10004186 3300026075 Bacteria 10607
248 Ga0207702_10017462 3300026078 Bacteria 5935
249 Ga0207702_10056814 3300026078 Bacteria 3324
250 Ga0207702_10058630 3300026078 Bacteria 3277
251 Ga0207641_10055004 3300026088 Bacteria 3379
252 Ga0207648_10036150 3300026089 Bacteria 4351
253 Ga0207648_10047688 3300026089 Bacteria 3754
254 Ga0207676_10009382 3300026095 Bacteria 6964
255 Ga0207676_10023388 3300026095 Bacteria 4559
256 Ga0207674_10003207 3300026116 Bacteria 20149
257 Ga0207674_10025431 3300026116 Bacteria 6314
258 Ga0207674_10032112 3300026116 Bacteria 5508
259 Ga0207674_10053728 3300026116 Bacteria 4104
260 Ga0207675_100055747 3300026118 Bacteria 3688
261 Ga0207683_10210825 3300026121 Bacteria 1768
262 Ga0207698_10097491 3300026142 Bacteria 2426
263 Ga0209969_1001208 3300027360 Bacteria 3554
264 Ga0209999_1001712 3300027543 Bacteria 3798
265 Ga0209971_1017674 3300027682 Bacteria 1690
266 Ga0209966_1000847 3300027695 Bacteria 5947
267 Ga0209998_10000237 3300027717 Bacteria 18560
268 Ga0207428_10061813 3300027907 Bacteria 2963
269 Ga0268266_10059517 3300028379 Bacteria 3292
270 Ga0268265_10003383 3300028380 Bacteria 11485
271 Ga0268264_10114192 3300028381 Bacteria 2370
272 Ga0307408_100012562 3300031548 Bacteria 5613
273 Ga0307408_100032850 3300031548 Bacteria 3621
274 Ga0307408_100102884 3300031548 Bacteria 2179
275 Ga0307405_10012480 3300031731 Bacteria 4500
276 Ga0307405_10015058 3300031731 Bacteria 4176
277 Ga0307405_10015202 3300031731 Bacteria 4161
278 Ga0307405_10037164 3300031731 Bacteria 2924
279 Ga0307405_10169428 3300031731 Bacteria 1556
280 Ga0307413_10002084 3300031824 Bacteria 8005
281 Ga0307413_10008246 3300031824 Bacteria 4904
282 Ga0307413_10024578 3300031824 Bacteria 3287
283 Ga0307413_10040836 3300031824 Bacteria 2711
284 Ga0307413_10091236 3300031824 Bacteria 1984
285 Ga0307410_10000674 3300031852 Bacteria 14166
286 Ga0307410_10003263 3300031852 Bacteria 8098
287 Ga0307410_10037937 3300031852 Bacteria 3152
288 Ga0307410_10070659 3300031852 Bacteria 2419
289 Ga0307406_10011767 3300031901 Bacteria 4969
290 Ga0307406_10070482 3300031901 Bacteria 2289
291 Ga0307406_10078805 3300031901 Bacteria 2183
292 Ga0307407_10009271 3300031903 Bacteria 4574
293 Ga0307407_10028092 3300031903 Bacteria 3002
294 Ga0307407_10149652 3300031903 Bacteria 1515
295 Ga0307412_10047395 3300031911 Bacteria 2823
296 Ga0307412_10052618 3300031911 Bacteria 2697
297 Ga0307409_100017838 3300031995 Bacteria 4746
298 Ga0307409_100025484 3300031995 Bacteria 4150
299 Ga0307409_100026173 3300031995 Bacteria 4109
300 Ga0307409_100104148 3300031995 Bacteria 2362
301 Ga0307409_100137778 3300031995 Bacteria 2098
302 Ga0307409_100480731 3300031995 Bacteria 1205
303 Ga0307416_100041111 3300032002 Bacteria 3598
304 Ga0307416_100113055 3300032002 Bacteria 2398
305 Ga0307416_100113164 3300032002 Bacteria 2397
306 Ga0307416_100156251 3300032002 Bacteria 2100
307 Ga0307416_100275252 3300032002 Bacteria 1656
308 Ga0307416_100353843 3300032002 Bacteria 1488
309 Ga0307414_10041040 3300032004 Bacteria 3130
310 Ga0307414_10050446 3300032004 Bacteria 2883
311 Ga0307411_10011558 3300032005 Bacteria 4772
312 Ga0307411_10019828 3300032005 Bacteria 3894
313 Ga0307411_10039953 3300032005 Bacteria 2972
314 Ga0307411_10078963 3300032005 Bacteria 2258
315 Ga0307411_10088372 3300032005 Bacteria 2155
316 Ga0307411_10096572 3300032005 Bacteria 2077
317 Ga0307411_10115865 3300032005 Bacteria 1928
318 Ga0307415_100000764 3300032126 Bacteria 14526
319 Ga0307415_100013262 3300032126 Bacteria 4804
320 Ga0307415_100268651 3300032126 Bacteria 1396
321 Ga0373960_0004324 3300035121 Bacteria 3249
322 Ga0436364_1249802 3300037853 Bacteria 2025
323 Ga0450923_023977 3300042125 Bacteria 1207
324 Ga0439434_0011203 3300042435 Bacteria 2648
325 Ga0451577_0210836 3300042876 Bacteria 1755
326 Ga0495594_0110756 3300046499 Unclassified 1548
327 Ga0495599_0158995 3300046678 Bacteria 1397
328 Ga0495600_0066350 3300046809 Bacteria 2359
329 Ga0495675_0157973 3300047444 Bacteria 1397
330 Ga0496102_0136653 3300048905 Bacteria 2297
331 Ga0496104_0307211 3300048907 Bacteria 1499
332 Ga0496108_0027490 3300048911 Unclassified 4698
333 Ga0496112_0001462 3300048915 Bacteria 18143
334 Ga0496112_0008712 3300048915 Bacteria 9097
335 Ga0496112_0085354 3300048915 Bacteria 3123
336 Ga0496113_0055003 3300048916 Bacteria 2982
337 Ga0496113_0109400 3300048916 Bacteria 2149
338 Ga0496115_0389016 3300048918 Bacteria 1133
339 Ga0501325_002927 3300049541 Bacteria 1210
340 Ga0501034_0394578 3300049571 Bacteria 1307
341 Ga0501041_0031251 3300049577 Bacteria 3216
342 Ga0501042_0155321 3300049578 Bacteria 1650
343 Ga0501043_0062185 3300049579 Bacteria 2932
344 Ga0501047_0189662 3300049581 Bacteria 1920
345 Ga0501047_0368382 3300049581 Bacteria 1272
346 Ga0501070_0018863 3300049586 Bacteria 5787
347 Ga0501071_0086281 3300049587 Bacteria 2302
348 Ga0501072_0055737 3300049588 Bacteria 3115
349 Ga0501074_0051518 3300049590 Bacteria 2971
350 Ga0501075_0021891 3300049591 Bacteria 4665
351 Ga0501075_0033300 3300049591 Bacteria 3834
352 Ga0501076_0052886 3300049592 Bacteria 3218
353 Ga0501077_0000357 3300049593 Bacteria 27079
354 Ga0501230_013348 3300049667 Unclassified 1332
355 Ga0501079_0013061 3300049741 Bacteria 6335
356 Ga0501080_0061758 3300049742 Archaea 3488
357 Ga0501081_0019651 3300049743 Bacteria 4500
358 Ga0501035_0021412 3300049822 Bacteria 5944
359 Ga0501044_0026081 3300049823 Bacteria 6189
360 Ga0501044_0121680 3300049823 Bacteria 2610
361 Ga0501045_0006209 3300049824 Bacteria 8271
362 Ga0501045_0172559 3300049824 Bacteria 1610
363 nmdc:mga09592_192409_c1 3300050508 Bacteria 1766
364 nmdc:mga09592_60709_c1 3300050508 Bacteria 3196
365 nmdc:mga09592_63436_c1 3300050508 Bacteria 3127
366 nmdc:mga0qj67_260195_c1 3300050509 Bacteria 1407
367 nmdc:mga0qj67_44938_c1 3300050509 Bacteria 3484
368 nmdc:mga08y16_127463_c1 3300050511 Bacteria 2647
369 nmdc:mga08y16_167327_c1 3300050511 Bacteria 2284
370 nmdc:mga0n895_70662_c1 3300050512 Unclassified 3460
371 Ga0501082_0068877 3300060353 Bacteria 3047
372 Ga0530510_0290760 3300061734 Bacteria 1222
373 Ga0207661_10135718
374 Ga0070658_10038822
375 Ga0070676_10002067
376 Ga0070683_100001575
377 Ga0070683_100013889
378 Ga0070683_100022925
379 Ga0070683_100051029
380 Ga0070683_100080572
381 Ga0070683_100119240
382 Ga0070690_100034893
383 Ga0068869_100002807
384 Ga0070680_100001122
385 Ga0070682_100001884
386 Ga0070682_100006436
387 Ga0068868_100021126
388 Ga0068868_100045333
389 Ga0068868_100048962
390 Ga0068868_100235798
391 Ga0070660_100001507
392 Ga0070660_100023261
393 Ga0070689_100025728
394 Ga0070691_10000314
395 Ga0070687_100001117
396 Ga0070687_100009214
397 Ga0070661_100021774
398 Ga0070661_100066015
399 Ga0070692_10061405
400 Ga0070669_100005018
401 Ga0070669_100005434
402 Ga0070675_100006858
403 Ga0070675_100021373
404 Ga0070675_100078372
405 Ga0070671_100062784
406 Ga0070674_100071378
407 Ga0070673_100284412
408 Ga0070688_100012759
409 Ga0070659_100009579
410 Ga0070659_100041146
411 Ga0070659_100058922
412 Ga0070667_100037307
413 Ga0070714_100048971
414 Ga0070714_100113282
415 Ga0070714_100154752
416 Ga0070713_100000638
417 Ga0070700_100007099
418 Ga0070694_100020676
419 Ga0070694_100086591
420 Ga0070708_100000016
421 Ga0070663_100025537
422 Ga0070662_100002979
423 Ga0070662_100026887
424 Ga0070681_10021441
425 Ga0070681_10039706
426 Ga0070681_10090456
427 Ga0070681_10102333
428 Ga0068867_100237451
429 Ga0070685_10006344
430 Ga0070685_10021869
431 Ga0070707_100032156
432 Ga0070707_100198891
433 Ga0070698_100002015
434 Ga0070698_100008279
435 Ga0070698_100100692
436 Ga0070698_100193230
437 Ga0070699_100005659
438 Ga0070699_100073435
439 Ga0070699_100074482
440 Ga0070699_100085335
441 Ga0070679_100005667
442 Ga0070679_100006078
443 Ga0070679_100011490
444 Ga0070679_100080482
445 Ga0070684_100026783
446 Ga0070684_100053871
447 Ga0070684_100087436
448 Ga0070684_100088749
449 Ga0070684_100096919
450 Ga0070684_100139721
451 Ga0070684_100291038
452 Ga0070684_100358547
453 Ga0068853_100016587
454 Ga0068853_100055103
455 Ga0070672_100065487
456 Ga0070672_100083716
457 Ga0070686_100008175
458 Ga0070696_100004805
459 Ga0070693_100001248
460 Ga0070665_100275625
461 Ga0070704_100022495
462 Ga0068855_100073896
463 Ga0068855_100100778
464 Ga0070664_100004917
465 Ga0070664_100028184
466 Ga0070664_100041831
467 Ga0070664_100061550
468 Ga0070664_100097555
469 Ga0070664_100112907
470 Ga0070664_100156455
471 Ga0068857_100015435
472 Ga0068857_100021371
473 Ga0068857_100090161
474 Ga0068854_100015584
475 Ga0068854_100019590
476 Ga0068856_100017648
477 Ga0068856_100060642
478 Ga0068856_100071537
479 Ga0068856_100077262
480 Ga0070702_100013724
481 Ga0068852_100140231
482 Ga0068859_100002679
483 Ga0068859_100008573
484 Ga0068859_100282372
485 Ga0068864_100030706
486 Ga0068864_100109210
487 Ga0068870_10019191
488 Ga0068870_10031203
489 Ga0068870_10053009
490 Ga0068863_100019426
491 Ga0068860_100079662
492 Ga0068862_100000694
493 Ga0070717_10000619
494 Ga0070717_10032036
495 Ga0070717_10266228
496 Ga0097621_100054063
497 Ga0068871_100045000
498 Ga0075430_100302535
499 Ga0075429_100012593
500 Ga0068865_100013357
501 Ga0097620_100002679
502 Ga0097620_100008573
503 Ga0097620_100282346
504 Ga0105240_10016825
505 Ga0111539_10029721
506 Ga0111539_10036361
507 Ga0111539_10158962
508 Ga0105245_10042144
509 Ga0105245_10195490
510 Ga0114129_10439224
511 Ga0105241_10027372
512 Ga0105242_10050777
513 Ga0105248_10007943
514 Ga0105248_10093455
515 Ga0105249_10000293
516 Ga0105239_10093928
517 Ga0105246_10007545
518 Ga0157373_10013756
519 Ga0157373_10058015
520 Ga0157373_10122102
521 Ga0157371_10027925
522 Ga0157370_10054885
523 Ga0157370_10059156
524 Ga0157369_10123498
525 Ga0157369_10154736
526 Ga0157369_10310973
527 Ga0157374_10233340
528 Ga0157378_10071933
529 Ga0157378_10128600
530 Ga0157372_10007860
531 Ga0157372_10011094
532 Ga0157372_10086418
533 Ga0157372_10125687
534 Ga0157372_10255775
535 Ga0157375_10015881
536 Ga0157375_10041110
537 Ga0157375_10151344
538 Ga0157375_10253304
539 Ga0157375_10393276
540 Ga0157375_10413636
541 Ga0163163_10006763
542 Ga0157380_10009295
543 Ga0182008_10002741
544 Ga0157376_10272734
545 Ga0163161_10237115
546 Ga0207642_10091702
547 Ga0207688_10103367
548 Ga0207699_10004632
549 Ga0207645_10011023
550 Ga0207643_10006031
551 Ga0207643_10012595
552 Ga0207643_10037781
553 Ga0207705_10001557
554 Ga0207705_10022485
555 Ga0207705_10205463
556 Ga0207654_10200315
557 Ga0207707_10036390
558 Ga0207707_10146436
559 Ga0207707_10368992
560 Ga0207695_10011252
561 Ga0207695_10044334
562 Ga0207695_10073730
563 Ga0207660_10045634
564 Ga0207660_10299469
565 Ga0207657_10000825
566 Ga0207657_10019500
567 Ga0207657_10108938
568 Ga0207649_10076423
569 Ga0207649_10090231
570 Ga0207652_10047025
571 Ga0207652_10124270
572 Ga0207646_10039792
573 Ga0207681_10003589
574 Ga0207681_10012801
575 Ga0207681_10031445
576 Ga0207650_10097111
577 Ga0207650_10137496
578 Ga0207659_10048001
579 Ga0207659_10233964
580 Ga0207687_10235014
581 Ga0207700_10000761
582 Ga0207664_10010432
583 Ga0207664_10021354
584 Ga0207644_10095253
585 Ga0207690_10012276
586 Ga0207690_10049671
587 Ga0207706_10001665
588 Ga0207706_10002574
589 Ga0207686_10021132
590 Ga0207686_10138498
591 Ga0207669_10131059
592 Ga0207704_10258566
593 Ga0207691_10008313
594 Ga0207691_10083358
595 Ga0207691_10095098
596 Ga0207711_10060950
597 Ga0207689_10001038
598 Ga0207661_10000768
599 Ga0207661_10019818
600 Ga0207661_10029436
601 Ga0207661_10108942
602 Ga0207679_10001379
603 Ga0207679_10054195
604 Ga0207679_10063320
605 Ga0207679_10067816
606 Ga0207679_10137233
607 Ga0207667_10154873
608 Ga0207667_10195642
609 Ga0207712_10010780
610 Ga0207668_10054748
611 Ga0207640_10017990
612 Ga0207640_10025539
613 Ga0207658_10074027
614 Ga0207677_10020967
615 Ga0207677_10106059
616 Ga0207703_10304991
617 Ga0207639_10015355
618 Ga0207678_10011679
619 Ga0207708_10004186
620 Ga0207702_10017462
621 Ga0207702_10056814
622 Ga0207702_10058630
623 Ga0207641_10055004
624 Ga0207648_10036150
625 Ga0207648_10047688
626 Ga0207676_10009382
627 Ga0207676_10023388
628 Ga0207674_10003207
629 Ga0207674_10025431
630 Ga0207674_10032112
631 Ga0207674_10053728
632 Ga0207675_100055747
633 Ga0207683_10210825
634 Ga0207698_10097491
635 Ga0209969_1001208
636 Ga0209999_1001712
637 Ga0209971_1017674
638 Ga0209966_1000847
639 Ga0209998_10000237
640 Ga0207428_10061813
641 Ga0268266_10059517
642 Ga0268265_10003383
643 Ga0268264_10114192
644 Ga0307408_100012562
645 Ga0307408_100032850
646 Ga0307408_100102884
647 Ga0307405_10012480
648 Ga0307405_10015058
649 Ga0307405_10015202
650 Ga0307405_10037164
651 Ga0307405_10169428
652 Ga0307413_10002084
653 Ga0307413_10008246
654 Ga0307413_10024578
655 Ga0307413_10040836
656 Ga0307413_10091236
657 Ga0307410_10000674
658 Ga0307410_10003263
659 Ga0307410_10037937
660 Ga0307410_10070659
661 Ga0307406_10011767
662 Ga0307406_10070482
663 Ga0307406_10078805
664 Ga0307407_10009271
665 Ga0307407_10028092
666 Ga0307407_10149652
667 Ga0307412_10047395
668 Ga0307412_10052618
669 Ga0307409_100017838
670 Ga0307409_100025484
671 Ga0307409_100026173
672 Ga0307409_100104148
673 Ga0307409_100137778
674 Ga0307409_100480731
675 Ga0307416_100041111
676 Ga0307416_100113055
677 Ga0307416_100113164
678 Ga0307416_100156251
679 Ga0307416_100275252
680 Ga0307416_100353843
681 Ga0307414_10041040
682 Ga0307414_10050446
683 Ga0307411_10011558
684 Ga0307411_10019828
685 Ga0307411_10039953
686 Ga0307411_10078963
687 Ga0307411_10088372
688 Ga0307411_10096572
689 Ga0307411_10115865
690 Ga0307415_100000764
691 Ga0307415_100013262
692 Ga0307415_100268651
693 Ga0373960_0004324
694 Ga0436364_1249802
695 Ga0450923_023977
696 Ga0439434_0011203
697 Ga0451577_0210836
698 Ga0495594_0110756
699 Ga0495599_0158995
700 Ga0495600_0066350
701 Ga0495675_0157973
702 Ga0496102_0136653
703 Ga0496104_0307211
704 Ga0496108_0027490
705 Ga0496112_0001462
706 Ga0496112_0008712
707 Ga0496112_0085354
708 Ga0496113_0055003
709 Ga0496113_0109400
710 Ga0496115_0389016
711 Ga0501325_002927
712 Ga0501034_0394578
713 Ga0501041_0031251
714 Ga0501042_0155321
715 Ga0501043_0062185
716 Ga0501047_0189662
717 Ga0501047_0368382
718 Ga0501070_0018863
719 Ga0501071_0086281
720 Ga0501072_0055737
721 Ga0501074_0051518
722 Ga0501075_0021891
723 Ga0501075_0033300
724 Ga0501076_0052886
725 Ga0501077_0000357
726 Ga0501230_013348
727 Ga0501079_0013061
728 Ga0501080_0061758
729 Ga0501081_0019651
730 Ga0501035_0021412
731 Ga0501044_0026081
732 Ga0501044_0121680
733 Ga0501045_0006209
734 Ga0501045_0172559
735 nmdc:mga09592_192409_c1
736 nmdc:mga09592_60709_c1
737 nmdc:mga09592_63436_c1
738 nmdc:mga0qj67_260195_c1
739 nmdc:mga0qj67_44938_c1
740 nmdc:mga08y16_127463_c1
741 nmdc:mga08y16_167327_c1
742 nmdc:mga0n895_70662_c1
743 Ga0501082_0068877
744 Ga0530510_0290760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07732

Cu-oxidase_3

Multicopper oxidase

147

264

0.91

PF07731

Cu-oxidase_2

Multicopper oxidase

267

392

0.85

PF07732

Cu-oxidase_3

Multicopper oxidase

271

392

0.82

PF00394

Cu-oxidase

Multicopper oxidase

261

393

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e9x-assembly1.cif.gz_B multicopper oxidase mglac (data3) 0.9501 91 341
3g5w-assembly2.cif.gz_F crystal structure of blue copper oxidase from nitrosomonas europaea 0.9417 93 341
4a2g-assembly1.cif.gz_A coriolopsis gallica laccase collected at 8.98 kev 0.8988 93 341
2xyb-assembly1.cif.gz_A-2 crystal structure of a fully functional laccase from the ligninolytic fungus pycnoporus cinnabarinus 0.8912 93 341
1v10-assembly1.cif.gz_A structure of rigidoporus lignosus laccase from hemihedrally twinned crystals 0.8888 91 341
ID Description Score Start End Superfamily
2zwnA01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9555 91 213 2.60.40.420
af_Q9VX11_99_237_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9474 108 211 2.60.40.420
af_Q19687_44_215_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9361 108 210 2.60.40.420
4f7kB01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9319 94 212 2.60.40.420
3g5wA02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9172 220 341 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A535DK80-F1-model_v4 Copper oxidase 0.9811 69 342 GO:0005507
GO:0016491
AF-A0A7W0PMJ1-F1-model_v4 Multicopper oxidase domain-containing protein 0.9764 190 343 GO:0005507
GO:0016491
AF-A0A7W1SJC2-F1-model_v4 Multicopper oxidase domain-containing protein 0.9759 152 343 GO:0005507
GO:0016491
AF-A0A535DK80-F1-model_v4 Copper oxidase 0.9741 69 342 GO:0005507
GO:0016491
AF-A0A1V4T020-F1-model_v4 Copper oxidase 0.9727 82 202 GO:0005507
GO:0016491

Map