F425729

General Info

Members Datasets Scaffolds Average Seq Length
371 241 742 133

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10042986|Ga0105238_100429863
Length 164
Sequence LKVDRRNIRQAKHRSATPNRWAGERPPTVEIVIGVGWDSVRLFLHVLAATVWVGGQLTLAALVPALRGAGAEIPARAARAYNRIAWPAFAVLILTGIWNVAAEHDEVHGRYRTTLIVKLIVVLISGITAAAHARSRNRTALAVFGALTGLTALGALFLGVLLAG

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
69 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
123 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
128 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 4.58
Rhizosphere 92.72
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10042986 3300009551 Bacteria 4573
2 Ga0070658_10017858 3300005327 Bacteria 5673
3 Ga0070658_10340052 3300005327 Bacteria 1284
4 Ga0070658_10373553 3300005327 Bacteria 1222
5 Ga0070683_100090625 3300005329 Unclassified 2871
6 Ga0070683_100104133 3300005329 Bacteria 2674
7 Ga0070683_100107880 3300005329 Bacteria 2625
8 Ga0070690_100435185 3300005330 Bacteria 970
9 Ga0070670_100112908 3300005331 Bacteria 2342
10 Ga0068869_100250807 3300005334 Bacteria 1413
11 Ga0070680_100058361 3300005336 Bacteria 3156
12 Ga0070680_100135627 3300005336 Bacteria 2062
13 Ga0070680_100702587 3300005336 Unclassified 870
14 Ga0070682_100093196 3300005337 Bacteria 1975
15 Ga0070682_100143871 3300005337 Bacteria 1628
16 Ga0068868_100641908 3300005338 Bacteria 944
17 Ga0070660_100299665 3300005339 Bacteria 1318
18 Ga0070689_100927399 3300005340 Bacteria 771
19 Ga0070691_10604586 3300005341 Bacteria 647
20 Ga0070661_100066796 3300005344 Bacteria 2642
21 Ga0070661_100144141 3300005344 Bacteria 1797
22 Ga0070661_100997079 3300005344 Unclassified 695
23 Ga0070692_10383613 3300005345 Bacteria 882
24 Ga0070669_101739768 3300005353 Bacteria 544
25 Ga0070675_100433650 3300005354 Bacteria 1176
26 Ga0070671_100018217 3300005355 Bacteria 5701
27 Ga0070659_100476203 3300005366 Unclassified 1062
28 Ga0070659_100529465 3300005366 Bacteria 1007
29 Ga0070709_10015548 3300005434 Bacteria 4332
30 Ga0070709_10562925 3300005434 Bacteria 873
31 Ga0070714_100000344 3300005435 Bacteria 34967
32 Ga0070714_100019394 3300005435 Bacteria 5540
33 Ga0070714_100039005 3300005435 Bacteria 3997
34 Ga0070714_100164442 3300005435 Bacteria 2010
35 Ga0070714_101814491 3300005435 Bacteria 595
36 Ga0070713_100002356 3300005436 Bacteria 12319
37 Ga0070713_100008179 3300005436 Bacteria 7409
38 Ga0070713_100105956 3300005436 Bacteria 2443
39 Ga0070713_100223819 3300005436 Bacteria 1708
40 Ga0070710_10116503 3300005437 Bacteria 1611
41 Ga0070710_10159903 3300005437 Bacteria 1396
42 Ga0070710_10179048 3300005437 Bacteria 1326
43 Ga0070701_10565829 3300005438 Unclassified 748
44 Ga0070701_11050117 3300005438 Bacteria 571
45 Ga0070711_100253488 3300005439 Bacteria 1381
46 Ga0070711_100716250 3300005439 Bacteria 843
47 Ga0070705_100130723 3300005440 Bacteria 1637
48 Ga0070700_100003108 3300005441 Bacteria 8514
49 Ga0070694_100237833 3300005444 Bacteria 1372
50 Ga0070708_100004330 3300005445 Bacteria 11149
51 Ga0070708_100509792 3300005445 Bacteria 1135
52 Ga0070678_100706917 3300005456 Bacteria 908
53 Ga0070681_10077310 3300005458 Bacteria 3286
54 Ga0070681_10706243 3300005458 Bacteria 924
55 Ga0070681_10998885 3300005458 Bacteria 756
56 Ga0070685_10210034 3300005466 Bacteria 1270
57 Ga0070706_100663544 3300005467 Bacteria 968
58 Ga0070706_101175993 3300005467 Bacteria 705
59 Ga0070707_100465950 3300005468 Bacteria 1224
60 Ga0070699_100364285 3300005518 Bacteria 1303
61 Ga0070679_100057343 3300005530 Bacteria 3882
62 Ga0070679_100126967 3300005530 Bacteria 2532
63 Ga0070679_100439318 3300005530 Bacteria 1250
64 Ga0070684_100028952 3300005535 Bacteria 4689
65 Ga0070684_100093563 3300005535 Bacteria 2676
66 Ga0070695_100749793 3300005545 Bacteria 779
67 Ga0070665_100714485 3300005548 Bacteria 1015
68 Ga0070704_100722315 3300005549 Bacteria 885
69 Ga0068855_101128573 3300005563 Bacteria 818
70 Ga0068857_100357968 3300005577 Bacteria 1352
71 Ga0068854_100523764 3300005578 Bacteria 1002
72 Ga0068856_100212908 3300005614 Bacteria 1948
73 Ga0068856_100522341 3300005614 Bacteria 1208
74 Ga0068852_100181545 3300005616 Bacteria 1979
75 Ga0068852_100402625 3300005616 Bacteria 1346
76 Ga0068852_102666593 3300005616 Bacteria 519
77 Ga0068859_100506378 3300005617 Bacteria 1302
78 Ga0068864_100297153 3300005618 Bacteria 1511
79 Ga0068870_10078176 3300005840 Bacteria 1822
80 Ga0068863_100030802 3300005841 Bacteria 5123
81 Ga0068858_100017586 3300005842 Bacteria 6704
82 Ga0068858_100327605 3300005842 Bacteria 1464
83 Ga0081540_1001377 3300005983 Bacteria 21068
84 Ga0070717_10013171 3300006028 Bacteria 6324
85 Ga0070717_10160272 3300006028 Bacteria 1951
86 Ga0070717_10499296 3300006028 Bacteria 1099
87 Ga0070715_10084537 3300006163 Bacteria 1447
88 Ga0070716_100271005 3300006173 Bacteria 1166
89 Ga0070712_100317203 3300006175 Bacteria 1266
90 Ga0070712_100362237 3300006175 Bacteria 1189
91 Ga0097621_100751872 3300006237 Bacteria 900
92 Ga0068871_100249184 3300006358 Bacteria 1546
93 Ga0075428_100215799 3300006844 Bacteria 2073
94 Ga0075431_101306472 3300006847 Bacteria 686
95 Ga0097620_100506395 3300006931 Bacteria 1302
96 Ga0105240_10157393 3300009093 Bacteria 2701
97 Ga0105240_10397435 3300009093 Bacteria 1553
98 Ga0111539_10001006 3300009094 Bacteria 36927
99 Ga0105245_10324656 3300009098 Bacteria 1517
100 Ga0105245_10605702 3300009098 Bacteria 1122
101 Ga0105247_10108633 3300009101 Bacteria 1782
102 Ga0105241_10143887 3300009174 Bacteria 1944
103 Ga0105237_10026372 3300009545 Bacteria 5939
104 Ga0105237_10086638 3300009545 Bacteria 3122
105 Ga0105238_11358289 3300009551 Bacteria 737
106 Ga0105238_11444384 3300009551 Bacteria 716
107 Ga0105249_10297703 3300009553 Bacteria 1617
108 Ga0105239_10129397 3300010375 Bacteria 2807
109 Ga0105239_10329206 3300010375 Bacteria 1723
110 Ga0157344_1020583 3300012476 Bacteria 566
111 Ga0157339_1009519 3300012505 Bacteria 861
112 Ga0157373_10015571 3300013100 Bacteria 5558
113 Ga0157370_10068351 3300013104 Bacteria 3358
114 Ga0157369_10028306 3300013105 Bacteria 6203
115 Ga0157369_10540264 3300013105 Bacteria 1205
116 Ga0157369_11936642 3300013105 Unclassified 598
117 Ga0157374_10079077 3300013296 Bacteria 3115
118 Ga0157378_10530081 3300013297 Bacteria 1180
119 Ga0163162_10263757 3300013306 Bacteria 1854
120 Ga0157372_10857776 3300013307 Bacteria 1054
121 Ga0163163_10214018 3300014325 Bacteria 1976
122 Ga0163163_10539161 3300014325 Bacteria 1229
123 Ga0163163_10609684 3300014325 Bacteria 1155
124 Ga0157377_10464426 3300014745 Bacteria 877
125 Ga0157377_10866949 3300014745 Bacteria 672
126 Ga0157379_10649924 3300014968 Bacteria 987
127 Ga0157379_11479045 3300014968 Bacteria 660
128 Ga0157376_10156166 3300014969 Bacteria 2063
129 Ga0206356_11731968 3300020070 Bacteria 689
130 Ga0206353_10549888 3300020082 Bacteria 3216
131 Ga0213876_10004116 3300021384 Bacteria 8171
132 Ga0213876_10313524 3300021384 Bacteria 834
133 Ga0207692_10029705 3300025898 Bacteria 2600
134 Ga0207692_10094574 3300025898 Bacteria 1628
135 Ga0207692_10110102 3300025898 Bacteria 1526
136 Ga0207692_10131490 3300025898 Bacteria 1414
137 Ga0207710_10212726 3300025900 Bacteria 958
138 Ga0207680_10552468 3300025903 Bacteria 822
139 Ga0207699_10023069 3300025906 Bacteria 3382
140 Ga0207654_10211845 3300025911 Bacteria 1281
141 Ga0207707_10013759 3300025912 Bacteria 7056
142 Ga0207707_10812502 3300025912 Bacteria 778
143 Ga0207695_10426935 3300025913 Bacteria 1209
144 Ga0207695_10798505 3300025913 Bacteria 824
145 Ga0207693_10177277 3300025915 Bacteria 1677
146 Ga0207693_10330210 3300025915 Bacteria 1194
147 Ga0207663_10460439 3300025916 Bacteria 982
148 Ga0207663_10953803 3300025916 Bacteria 687
149 Ga0207660_10085534 3300025917 Bacteria 2326
150 Ga0207660_10188785 3300025917 Bacteria 1603
151 Ga0207657_10027901 3300025919 Bacteria 5162
152 Ga0207657_10478560 3300025919 Bacteria 976
153 Ga0207649_10236273 3300025920 Bacteria 1310
154 Ga0207652_11210066 3300025921 Bacteria 657
155 Ga0207646_10871476 3300025922 Bacteria 800
156 Ga0207646_10928098 3300025922 Bacteria 771
157 Ga0207681_11089562 3300025923 Bacteria 671
158 Ga0207694_10121710 3300025924 Bacteria 2084
159 Ga0207694_10428281 3300025924 Bacteria 1103
160 Ga0207694_10515054 3300025924 Bacteria 1002
161 Ga0207659_10691963 3300025926 Bacteria 873
162 Ga0207687_10267950 3300025927 Bacteria 1364
163 Ga0207700_10014074 3300025928 Bacteria 5230
164 Ga0207700_10037180 3300025928 Bacteria 3523
165 Ga0207700_10050330 3300025928 Bacteria 3105
166 Ga0207700_10368732 3300025928 Bacteria 1253
167 Ga0207700_11812507 3300025928 Bacteria 536
168 Ga0207664_10037329 3300025929 Bacteria 3759
169 Ga0207664_10089403 3300025929 Bacteria 2522
170 Ga0207664_10253832 3300025929 Bacteria 1536
171 Ga0207664_10327392 3300025929 Bacteria 1353
172 Ga0207664_11578320 3300025929 Bacteria 578
173 Ga0207644_10066734 3300025931 Bacteria 2620
174 Ga0207644_10072296 3300025931 Bacteria 2526
175 Ga0207690_10061000 3300025932 Bacteria 2562
176 Ga0207690_10412614 3300025932 Bacteria 1079
177 Ga0207670_10179898 3300025936 Bacteria 1592
178 Ga0207665_10010568 3300025939 Bacteria 6063
179 Ga0207691_10078629 3300025940 Bacteria 2969
180 Ga0207661_10080947 3300025944 Bacteria 2681
181 Ga0207661_10221310 3300025944 Bacteria 1673
182 Ga0207661_12007256 3300025944 Unclassified 524
183 Ga0207679_10504038 3300025945 Bacteria 1080
184 Ga0207712_10485557 3300025961 Bacteria 1054
185 Ga0207640_10265417 3300025981 Bacteria 1340
186 Ga0207703_10098834 3300026035 Bacteria 2469
187 Ga0207678_10026242 3300026067 Bacteria 5083
188 Ga0207708_10000030 3300026075 Bacteria 157064
189 Ga0207708_10045446 3300026075 Bacteria 3346
190 Ga0207702_10765964 3300026078 Bacteria 953
191 Ga0207702_10846973 3300026078 Bacteria 905
192 Ga0207641_10022761 3300026088 Bacteria 5159
193 Ga0207674_10294059 3300026116 Bacteria 1573
194 Ga0207674_10750115 3300026116 Bacteria 942
195 Ga0207683_10012231 3300026121 Bacteria 7325
196 Ga0207698_10263394 3300026142 Bacteria 1585
197 Ga0207698_10347314 3300026142 Bacteria 1400
198 Ga0207698_11514654 3300026142 Bacteria 686
199 Ga0265338_10352556 3300028800 Bacteria 1058
200 Ga0316575_10054499 3300031665 Bacteria 1593
201 Ga0316579_10315251 3300031691 Bacteria 756
202 Ga0316576_10073443 3300031727 Bacteria 2527
203 Ga0316578_10029650 3300031728 Bacteria 3106
204 Ga0373926_0144297 3300035083 Bacteria 905
205 Ga0373928_0000761 3300035084 Bacteria 6301
206 Ga0373929_0009394 3300035085 Bacteria 1812
207 Ga0373934_0140620 3300035086 Bacteria 987
208 Ga0373944_0012034 3300035089 Bacteria 2380
209 Ga0373923_0036735 3300035111 Bacteria 2001
210 Ga0373932_0000096 3300035112 Bacteria 23497
211 Ga0373954_0136981 3300035118 Bacteria 1193
212 Ga0373957_0037262 3300035120 Bacteria 1816
213 Ga0373960_0331124 3300035121 Bacteria 573
214 Ga0373943_0009308 3300035170 Bacteria 4403
215 Ga0373943_0025208 3300035170 Bacteria 2779
216 Ga0373946_0014284 3300035171 Bacteria 2993
217 Ga0373946_0163114 3300035171 Bacteria 1048
218 Ga0373955_0045822 3300035172 Bacteria 2361
219 Ga0373924_0176540 3300035410 Bacteria 939
220 Ga0373931_0000010 3300035691 Bacteria 334069
221 Ga0373933_0286727 3300035724 Bacteria 1064
222 Ga0373933_0512200 3300035724 Bacteria 786
223 Ga0373933_0533522 3300035724 Bacteria 770
224 Ga0373947_0104757 3300035725 Bacteria 1781
225 Ga0373947_0222830 3300035725 Bacteria 1240
226 Ga0373937_0142533 3300036401 Bacteria 2242
227 Ga0316582_0062322 3300036647 Bacteria 2394
228 Ga0373925_0819663 3300037068 Bacteria 767
229 Ga0373925_1008316 3300037068 Bacteria 685
230 Ga0395900_1564150 3300037418 Bacteria 571
231 Ga0395898_0293031 3300037466 Bacteria 1552
232 Ga0436365_0590145 3300039437 Bacteria 40118
233 Ga0436365_1808826 3300039437 Bacteria 1921
234 Ga0436365_1908466 3300039437 Bacteria 791
235 Ga0439439_0275771 3300041406 Bacteria 503
236 Ga0451802_1804839 3300041460 Bacteria 513
237 Ga0451853_1808527 3300041512 Unclassified 653
238 Ga0466965_0525231 3300044683 Bacteria 666
239 Ga0466966_0004911 3300044684 Bacteria 8791
240 Ga0466966_0025603 3300044684 Bacteria 3853
241 Ga0466961_0018530 3300044693 Bacteria 4479
242 Ga0466961_0076323 3300044693 Bacteria 2124
243 Ga0466963_0025020 3300044694 Bacteria 3804
244 Ga0466963_0102292 3300044694 Bacteria 1962
245 Ga0466963_0130678 3300044694 Bacteria 1734
246 Ga0466964_0017774 3300044706 Bacteria 2724
247 Ga0466964_0048265 3300044706 Bacteria 1740
248 Ga0466971_0013210 3300044719 Bacteria 3625
249 Ga0466971_0025578 3300044719 Bacteria 2636
250 Ga0466968_0019121 3300044735 Bacteria 2755
251 Ga0466968_0096346 3300044735 Bacteria 1317
252 Ga0466957_0013261 3300044842 Bacteria 4780
253 Ga0466957_0265469 3300044842 Bacteria 1145
254 Ga0466957_1309480 3300044842 Bacteria 526
255 Ga0466957_1445897 3300044842 Bacteria 501
256 Ga0466960_0005641 3300044901 Bacteria 4967
257 Ga0466959_0017855 3300045049 Bacteria 5204
258 Ga0466959_0580449 3300045049 Bacteria 755
259 Ga0466959_0823099 3300045049 Bacteria 620
260 Ga0466958_0036634 3300045836 Bacteria 2937
261 Ga0466958_0088281 3300045836 Bacteria 1915
262 Ga0466958_0420750 3300045836 Bacteria 864
263 Ga0466958_0464715 3300045836 Unclassified 820
264 Ga0466958_0918281 3300045836 Bacteria 571
265 Ga0466967_0042536 3300045976 Bacteria 3927
266 Ga0466967_0089950 3300045976 Bacteria 2788
267 Ga0466967_0091421 3300045976 Bacteria 2766
268 Ga0466967_0241562 3300045976 Bacteria 1723
269 Ga0466967_2219291 3300045976 Bacteria 545
270 Ga0495592_0122599 3300046454 Bacteria 1826
271 Ga0495592_0238332 3300046454 Bacteria 1208
272 Ga0495603_0098825 3300046455 Bacteria 1704
273 Ga0495629_0319484 3300046459 Bacteria 1061
274 Ga0495651_0011564 3300046462 Bacteria 6780
275 Ga0495653_0134791 3300046463 Bacteria 1743
276 Ga0495664_0055040 3300046477 Bacteria 2367
277 Ga0495664_0181441 3300046477 Bacteria 1276
278 Ga0495594_0065166 3300046499 Bacteria 2021
279 Ga0495608_0034503 3300046511 Bacteria 3415
280 Ga0495608_0444405 3300046511 Bacteria 789
281 Ga0495618_0073744 3300046514 Bacteria 2173
282 Ga0495618_0229017 3300046514 Bacteria 1170
283 Ga0495628_0115135 3300046516 Bacteria 2065
284 Ga0495628_0610264 3300046516 Bacteria 778
285 Ga0495630_0046591 3300046517 Bacteria 3241
286 Ga0495666_0008763 3300046526 Bacteria 5067
287 Ga0495652_0496769 3300046529 Bacteria 846
288 Ga0495587_0114184 3300046536 Bacteria 1549
289 Ga0495645_0119753 3300046543 Bacteria 1854
290 Ga0495645_0452517 3300046543 Bacteria 809
291 Ga0495667_0083425 3300046559 Bacteria 2075
292 Ga0495634_0540627 3300046642 Bacteria 680
293 Ga0495657_0494586 3300046675 Bacteria 713
294 Ga0495657_0683420 3300046675 Bacteria 590
295 Ga0495599_0061615 3300046678 Bacteria 2344
296 Ga0495599_0082030 3300046678 Bacteria 2014
297 Ga0495623_0190704 3300046679 Bacteria 1184
298 Ga0495647_0335350 3300046681 Bacteria 686
299 Ga0495658_0455905 3300046683 Bacteria 817
300 Ga0495600_0075610 3300046809 Bacteria 2199
301 Ga0495604_0239149 3300047317 Bacteria 1242
302 Ga0495604_0361575 3300047317 Bacteria 962
303 Ga0495674_0267266 3300047319 Bacteria 1404
304 Ga0495674_0567801 3300047319 Bacteria 901
305 Ga0495676_0418229 3300047321 Bacteria 887
306 Ga0495676_0773811 3300047321 Unclassified 619
307 Ga0495680_0028678 3300047322 Bacteria 4562
308 Ga0495680_0104342 3300047322 Bacteria 2109
309 Ga0495680_0162710 3300047322 Bacteria 1619
310 Ga0495675_0069147 3300047444 Bacteria 2230
311 Ga0495684_0203638 3300047471 Bacteria 1458
312 Ga0495593_0014229 3300047673 Bacteria 4524
313 Ga0495602_0124347 3300048088 Bacteria 2069
314 Ga0495602_0166292 3300048088 Bacteria 1716
315 Ga0495614_0014614 3300048089 Bacteria 3433
316 Ga0496100_0827979 3300048903 Bacteria 725
317 Ga0496102_0359645 3300048905 Bacteria 1370
318 Ga0496103_0196910 3300048906 Bacteria 1295
319 Ga0496104_0301176 3300048907 Bacteria 1515
320 Ga0496105_0162784 3300048908 Bacteria 1831
321 Ga0496106_0508540 3300048909 Bacteria 967
322 Ga0496107_0607159 3300048910 Bacteria 808
323 Ga0496108_0473295 3300048911 Bacteria 1094
324 Ga0496109_0024393 3300048912 Bacteria 5376
325 Ga0496109_0309978 3300048912 Bacteria 1489
326 Ga0496109_1339210 3300048912 Unclassified 652
327 Ga0496110_0184467 3300048913 Bacteria 1894
328 Ga0496111_0270923 3300048914 Bacteria 1259
329 Ga0496113_0135676 3300048916 Bacteria 1933
330 Ga0496113_1070798 3300048916 Bacteria 633
331 Ga0496115_0135786 3300048918 Bacteria 2028
332 Ga0496126_0010692 3300048929 Bacteria 9589
333 Ga0496126_0183760 3300048929 Bacteria 1774
334 Ga0496126_0398043 3300048929 Bacteria 1118
335 Ga0501032_0254582 3300049569 Bacteria 1139
336 Ga0501033_0055287 3300049570 Bacteria 2935
337 Ga0501036_0065566 3300049572 Bacteria 3073
338 Ga0501037_0261361 3300049573 Bacteria 1209
339 Ga0501039_0026571 3300049575 Bacteria 4449
340 Ga0501040_0153005 3300049576 Bacteria 1628
341 Ga0501041_0004497 3300049577 Bacteria 8085
342 Ga0501041_0966989 3300049577 Bacteria 548
343 Ga0501042_0059486 3300049578 Bacteria 2728
344 Ga0501042_0111274 3300049578 Bacteria 1972
345 Ga0501043_0060265 3300049579 Bacteria 2979
346 Ga0501046_0011483 3300049580 Bacteria 7571
347 Ga0501048_0003743 3300049582 Bacteria 11602
348 Ga0501069_0348414 3300049585 Bacteria 873
349 Ga0501070_0118600 3300049586 Bacteria 2187
350 Ga0501071_0043301 3300049587 Bacteria 3227
351 Ga0501072_0027686 3300049588 Bacteria 4421
352 Ga0501072_0508291 3300049588 Bacteria 953
353 Ga0501074_0057152 3300049590 Bacteria 2811
354 Ga0501075_0014252 3300049591 Bacteria 5695
355 Ga0501076_0060383 3300049592 Bacteria 3016
356 Ga0501077_0125990 3300049593 Bacteria 1623
357 Ga0501079_0015033 3300049741 Bacteria 5901
358 Ga0501080_0366287 3300049742 Bacteria 1300
359 Ga0501081_0329254 3300049743 Bacteria 1124
360 Ga0501083_0029566 3300049744 Bacteria 3767
361 Ga0501035_0112628 3300049822 Bacteria 2384
362 Ga0501035_0498379 3300049822 Bacteria 1003
363 Ga0501045_0030476 3300049824 Bacteria 3904
364 nmdc:mga0yw44_45583_c1 3300050492 Bacteria 2629
365 nmdc:mga0rr50_625661_c1 3300050513 Bacteria 918
366 nmdc:mga08x19_200306_c1 3300050514 Bacteria 1368
367 Ga0495595_0029579 3300053084 Bacteria 2452
368 Ga0495595_0202213 3300053084 Bacteria 989
369 Ga0501084_0039101 3300054114 Bacteria 3968
370 Ga0501082_0010652 3300060353 Bacteria 7915
371 Ga0466962_0016676 3300061719 Bacteria 3542
372 Ga0105238_10042986
373 Ga0070658_10017858
374 Ga0070658_10340052
375 Ga0070658_10373553
376 Ga0070683_100090625
377 Ga0070683_100104133
378 Ga0070683_100107880
379 Ga0070690_100435185
380 Ga0070670_100112908
381 Ga0068869_100250807
382 Ga0070680_100058361
383 Ga0070680_100135627
384 Ga0070680_100702587
385 Ga0070682_100093196
386 Ga0070682_100143871
387 Ga0068868_100641908
388 Ga0070660_100299665
389 Ga0070689_100927399
390 Ga0070691_10604586
391 Ga0070661_100066796
392 Ga0070661_100144141
393 Ga0070661_100997079
394 Ga0070692_10383613
395 Ga0070669_101739768
396 Ga0070675_100433650
397 Ga0070671_100018217
398 Ga0070659_100476203
399 Ga0070659_100529465
400 Ga0070709_10015548
401 Ga0070709_10562925
402 Ga0070714_100000344
403 Ga0070714_100019394
404 Ga0070714_100039005
405 Ga0070714_100164442
406 Ga0070714_101814491
407 Ga0070713_100002356
408 Ga0070713_100008179
409 Ga0070713_100105956
410 Ga0070713_100223819
411 Ga0070710_10116503
412 Ga0070710_10159903
413 Ga0070710_10179048
414 Ga0070701_10565829
415 Ga0070701_11050117
416 Ga0070711_100253488
417 Ga0070711_100716250
418 Ga0070705_100130723
419 Ga0070700_100003108
420 Ga0070694_100237833
421 Ga0070708_100004330
422 Ga0070708_100509792
423 Ga0070678_100706917
424 Ga0070681_10077310
425 Ga0070681_10706243
426 Ga0070681_10998885
427 Ga0070685_10210034
428 Ga0070706_100663544
429 Ga0070706_101175993
430 Ga0070707_100465950
431 Ga0070699_100364285
432 Ga0070679_100057343
433 Ga0070679_100126967
434 Ga0070679_100439318
435 Ga0070684_100028952
436 Ga0070684_100093563
437 Ga0070695_100749793
438 Ga0070665_100714485
439 Ga0070704_100722315
440 Ga0068855_101128573
441 Ga0068857_100357968
442 Ga0068854_100523764
443 Ga0068856_100212908
444 Ga0068856_100522341
445 Ga0068852_100181545
446 Ga0068852_100402625
447 Ga0068852_102666593
448 Ga0068859_100506378
449 Ga0068864_100297153
450 Ga0068870_10078176
451 Ga0068863_100030802
452 Ga0068858_100017586
453 Ga0068858_100327605
454 Ga0081540_1001377
455 Ga0070717_10013171
456 Ga0070717_10160272
457 Ga0070717_10499296
458 Ga0070715_10084537
459 Ga0070716_100271005
460 Ga0070712_100317203
461 Ga0070712_100362237
462 Ga0097621_100751872
463 Ga0068871_100249184
464 Ga0075428_100215799
465 Ga0075431_101306472
466 Ga0097620_100506395
467 Ga0105240_10157393
468 Ga0105240_10397435
469 Ga0111539_10001006
470 Ga0105245_10324656
471 Ga0105245_10605702
472 Ga0105247_10108633
473 Ga0105241_10143887
474 Ga0105237_10026372
475 Ga0105237_10086638
476 Ga0105238_11358289
477 Ga0105238_11444384
478 Ga0105249_10297703
479 Ga0105239_10129397
480 Ga0105239_10329206
481 Ga0157344_1020583
482 Ga0157339_1009519
483 Ga0157373_10015571
484 Ga0157370_10068351
485 Ga0157369_10028306
486 Ga0157369_10540264
487 Ga0157369_11936642
488 Ga0157374_10079077
489 Ga0157378_10530081
490 Ga0163162_10263757
491 Ga0157372_10857776
492 Ga0163163_10214018
493 Ga0163163_10539161
494 Ga0163163_10609684
495 Ga0157377_10464426
496 Ga0157377_10866949
497 Ga0157379_10649924
498 Ga0157379_11479045
499 Ga0157376_10156166
500 Ga0206356_11731968
501 Ga0206353_10549888
502 Ga0213876_10004116
503 Ga0213876_10313524
504 Ga0207692_10029705
505 Ga0207692_10094574
506 Ga0207692_10110102
507 Ga0207692_10131490
508 Ga0207710_10212726
509 Ga0207680_10552468
510 Ga0207699_10023069
511 Ga0207654_10211845
512 Ga0207707_10013759
513 Ga0207707_10812502
514 Ga0207695_10426935
515 Ga0207695_10798505
516 Ga0207693_10177277
517 Ga0207693_10330210
518 Ga0207663_10460439
519 Ga0207663_10953803
520 Ga0207660_10085534
521 Ga0207660_10188785
522 Ga0207657_10027901
523 Ga0207657_10478560
524 Ga0207649_10236273
525 Ga0207652_11210066
526 Ga0207646_10871476
527 Ga0207646_10928098
528 Ga0207681_11089562
529 Ga0207694_10121710
530 Ga0207694_10428281
531 Ga0207694_10515054
532 Ga0207659_10691963
533 Ga0207687_10267950
534 Ga0207700_10014074
535 Ga0207700_10037180
536 Ga0207700_10050330
537 Ga0207700_10368732
538 Ga0207700_11812507
539 Ga0207664_10037329
540 Ga0207664_10089403
541 Ga0207664_10253832
542 Ga0207664_10327392
543 Ga0207664_11578320
544 Ga0207644_10066734
545 Ga0207644_10072296
546 Ga0207690_10061000
547 Ga0207690_10412614
548 Ga0207670_10179898
549 Ga0207665_10010568
550 Ga0207691_10078629
551 Ga0207661_10080947
552 Ga0207661_10221310
553 Ga0207661_12007256
554 Ga0207679_10504038
555 Ga0207712_10485557
556 Ga0207640_10265417
557 Ga0207703_10098834
558 Ga0207678_10026242
559 Ga0207708_10000030
560 Ga0207708_10045446
561 Ga0207702_10765964
562 Ga0207702_10846973
563 Ga0207641_10022761
564 Ga0207674_10294059
565 Ga0207674_10750115
566 Ga0207683_10012231
567 Ga0207698_10263394
568 Ga0207698_10347314
569 Ga0207698_11514654
570 Ga0265338_10352556
571 Ga0316575_10054499
572 Ga0316579_10315251
573 Ga0316576_10073443
574 Ga0316578_10029650
575 Ga0373926_0144297
576 Ga0373928_0000761
577 Ga0373929_0009394
578 Ga0373934_0140620
579 Ga0373944_0012034
580 Ga0373923_0036735
581 Ga0373932_0000096
582 Ga0373954_0136981
583 Ga0373957_0037262
584 Ga0373960_0331124
585 Ga0373943_0009308
586 Ga0373943_0025208
587 Ga0373946_0014284
588 Ga0373946_0163114
589 Ga0373955_0045822
590 Ga0373924_0176540
591 Ga0373931_0000010
592 Ga0373933_0286727
593 Ga0373933_0512200
594 Ga0373933_0533522
595 Ga0373947_0104757
596 Ga0373947_0222830
597 Ga0373937_0142533
598 Ga0316582_0062322
599 Ga0373925_0819663
600 Ga0373925_1008316
601 Ga0395900_1564150
602 Ga0395898_0293031
603 Ga0436365_0590145
604 Ga0436365_1808826
605 Ga0436365_1908466
606 Ga0439439_0275771
607 Ga0451802_1804839
608 Ga0451853_1808527
609 Ga0466965_0525231
610 Ga0466966_0004911
611 Ga0466966_0025603
612 Ga0466961_0018530
613 Ga0466961_0076323
614 Ga0466963_0025020
615 Ga0466963_0102292
616 Ga0466963_0130678
617 Ga0466964_0017774
618 Ga0466964_0048265
619 Ga0466971_0013210
620 Ga0466971_0025578
621 Ga0466968_0019121
622 Ga0466968_0096346
623 Ga0466957_0013261
624 Ga0466957_0265469
625 Ga0466957_1309480
626 Ga0466957_1445897
627 Ga0466960_0005641
628 Ga0466959_0017855
629 Ga0466959_0580449
630 Ga0466959_0823099
631 Ga0466958_0036634
632 Ga0466958_0088281
633 Ga0466958_0420750
634 Ga0466958_0464715
635 Ga0466958_0918281
636 Ga0466967_0042536
637 Ga0466967_0089950
638 Ga0466967_0091421
639 Ga0466967_0241562
640 Ga0466967_2219291
641 Ga0495592_0122599
642 Ga0495592_0238332
643 Ga0495603_0098825
644 Ga0495629_0319484
645 Ga0495651_0011564
646 Ga0495653_0134791
647 Ga0495664_0055040
648 Ga0495664_0181441
649 Ga0495594_0065166
650 Ga0495608_0034503
651 Ga0495608_0444405
652 Ga0495618_0073744
653 Ga0495618_0229017
654 Ga0495628_0115135
655 Ga0495628_0610264
656 Ga0495630_0046591
657 Ga0495666_0008763
658 Ga0495652_0496769
659 Ga0495587_0114184
660 Ga0495645_0119753
661 Ga0495645_0452517
662 Ga0495667_0083425
663 Ga0495634_0540627
664 Ga0495657_0494586
665 Ga0495657_0683420
666 Ga0495599_0061615
667 Ga0495599_0082030
668 Ga0495623_0190704
669 Ga0495647_0335350
670 Ga0495658_0455905
671 Ga0495600_0075610
672 Ga0495604_0239149
673 Ga0495604_0361575
674 Ga0495674_0267266
675 Ga0495674_0567801
676 Ga0495676_0418229
677 Ga0495676_0773811
678 Ga0495680_0028678
679 Ga0495680_0104342
680 Ga0495680_0162710
681 Ga0495675_0069147
682 Ga0495684_0203638
683 Ga0495593_0014229
684 Ga0495602_0124347
685 Ga0495602_0166292
686 Ga0495614_0014614
687 Ga0496100_0827979
688 Ga0496102_0359645
689 Ga0496103_0196910
690 Ga0496104_0301176
691 Ga0496105_0162784
692 Ga0496106_0508540
693 Ga0496107_0607159
694 Ga0496108_0473295
695 Ga0496109_0024393
696 Ga0496109_0309978
697 Ga0496109_1339210
698 Ga0496110_0184467
699 Ga0496111_0270923
700 Ga0496113_0135676
701 Ga0496113_1070798
702 Ga0496115_0135786
703 Ga0496126_0010692
704 Ga0496126_0183760
705 Ga0496126_0398043
706 Ga0501032_0254582
707 Ga0501033_0055287
708 Ga0501036_0065566
709 Ga0501037_0261361
710 Ga0501039_0026571
711 Ga0501040_0153005
712 Ga0501041_0004497
713 Ga0501041_0966989
714 Ga0501042_0059486
715 Ga0501042_0111274
716 Ga0501043_0060265
717 Ga0501046_0011483
718 Ga0501048_0003743
719 Ga0501069_0348414
720 Ga0501070_0118600
721 Ga0501071_0043301
722 Ga0501072_0027686
723 Ga0501072_0508291
724 Ga0501074_0057152
725 Ga0501075_0014252
726 Ga0501076_0060383
727 Ga0501077_0125990
728 Ga0501079_0015033
729 Ga0501080_0366287
730 Ga0501081_0329254
731 Ga0501083_0029566
732 Ga0501035_0112628
733 Ga0501035_0498379
734 Ga0501045_0030476
735 nmdc:mga0yw44_45583_c1
736 nmdc:mga0rr50_625661_c1
737 nmdc:mga08x19_200306_c1
738 Ga0495595_0029579
739 Ga0495595_0202213
740 Ga0501084_0039101
741 Ga0501082_0010652
742 Ga0466962_0016676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oy2-assembly1.cif.gz_C high resolution structure of cytochrome bd-ii oxidase from e. coli 0.7255 8 121
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.7198 13 132
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.7148 9 127
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.681 13 132
4xto-assembly1.cif.gz_B crystal structure of the light-driven sodium pump kr2 in the pentameric red form, ph 5.6 0.6668 45 131
ID Description Score Start End Superfamily
af_Q9QYU1_158_283_1.20.120.900 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Pex19, mPTS binding domain 0.6712 39 128 1.20.120.900
4xtoD00 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6656 45 131 1.20.1070.10
2yfaB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.6655 22 131 1.20.1440.210
2yfbB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.6651 22 131 1.20.1440.210
af_Q9C540_5_220_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6553 3 132 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A543LN64-F1-model_v4 deleted 0.9618 7 133
AF-A0A7C4XX54-F1-model_v4 Copper resistance protein D domain-containing protein 0.9567 1 131 GO:0016020
AF-A0A7Y2DPN4-F1-model_v4 Copper resistance protein D domain-containing protein 0.9554 1 133 GO:0016020
AF-A0A7Y0DEN6-F1-model_v4 Copper resistance protein D domain-containing protein 0.9531 1 132 GO:0016020
AF-A0A2D8GF14-F1-model_v4 Copper resistance protein D domain-containing protein 0.9523 1 130 GO:0016020

Map