F425575

General Info

Members Datasets Scaffolds Average Seq Length
370 180 740 353

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_3868_c1|nmdc:mga05p37_3868_c1_14785_15948
Length 387
Sequence MARHDTLRAVEEDTRQGGHRMTSRRQFVEAAGMLAGLVFVGCDLLAAASVQAQTRRREVTVGGRRVKTVDVHAHCAVPEAMALMGMKLAGPGSTLPPLLHMATQASERLRAMDEQGIDVEALSINPYWYKADRDVATQVCKMQNEKLAEACAANPDRFVAFATVALQHPDLAAQQLEEGVKKYGLRGAGIGGSVNGEELSDPKFHPFWKKAEDLGVLVFIHPQGNGVAADIPNRLKGNGLLENVIGNPLETTIALSHLIFEGTLDRFPGLKICAAHGGGYLPSYAGRSDQGCNVFPDRCPGPKDGPLKKKPTEYLKQMYYDNILFTPEAMRHIIAEVGASQIVIGTDFPYPWTKTAIDLVLSTPGLSDDQRTAILGGTAAKLLGIKT

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
100 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 7.3
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_3868_c1 3300050507 Bacteria 17512
2 JGI25406J46586_10005936 3300003203 Bacteria 5651
3 Ga0070683_100156450 3300005329 Bacteria 2162
4 Ga0070670_100014142 3300005331 Bacteria 6846
5 Ga0070670_100226380 3300005331 Bacteria 1627
6 Ga0070666_10179932 3300005335 Bacteria 1483
7 Ga0070680_100033029 3300005336 Unclassified 4168
8 Ga0070669_100130311 3300005353 Bacteria 1928
9 Ga0070671_100097457 3300005355 Bacteria 2466
10 Ga0070709_10006152 3300005434 Bacteria 6530
11 Ga0070714_100118100 3300005435 Bacteria 2356
12 Ga0070713_100003085 3300005436 Bacteria 10954
13 Ga0070711_100086969 3300005439 Bacteria 2242
14 Ga0070708_100024660 3300005445 Bacteria 5136
15 Ga0070708_100024835 3300005445 Bacteria 5118
16 Ga0070708_100048542 3300005445 Bacteria 3752
17 Ga0070708_100070646 3300005445 Bacteria 3141
18 Ga0070708_100277365 3300005445 Bacteria 1577
19 Ga0070678_100185700 3300005456 Bacteria 1706
20 Ga0070662_100038642 3300005457 Bacteria 3391
21 Ga0070681_10011584 3300005458 Bacteria 8729
22 Ga0070681_10044054 3300005458 Bacteria 4466
23 Ga0070681_10051209 3300005458 Bacteria 4119
24 Ga0070685_10020391 3300005466 Bacteria 3586
25 Ga0070706_100032095 3300005467 Bacteria 4844
26 Ga0070706_100046340 3300005467 Bacteria 4014
27 Ga0070706_100131649 3300005467 Bacteria 2334
28 Ga0070707_100024968 3300005468 Bacteria 5666
29 Ga0070707_100042684 3300005468 Bacteria 4343
30 Ga0070707_100086680 3300005468 Bacteria 3028
31 Ga0070707_100095983 3300005468 Bacteria 2871
32 Ga0070707_100147190 3300005468 Bacteria 2292
33 Ga0070707_100180715 3300005468 Bacteria 2056
34 Ga0070707_100221345 3300005468 Bacteria 1843
35 Ga0070698_100045025 3300005471 Bacteria 4517
36 Ga0070698_100068035 3300005471 Bacteria 3580
37 Ga0070698_100131198 3300005471 Bacteria 2461
38 Ga0070698_100227493 3300005471 Bacteria 1798
39 Ga0070699_100030567 3300005518 Bacteria 4650
40 Ga0070699_100078055 3300005518 Bacteria 2883
41 Ga0070699_100089721 3300005518 Bacteria 2686
42 Ga0070699_100137651 3300005518 Bacteria 2154
43 Ga0070699_100206118 3300005518 Bacteria 1749
44 Ga0070697_100027034 3300005536 Bacteria 4588
45 Ga0070697_100159467 3300005536 Bacteria 1905
46 Ga0070696_100057599 3300005546 Bacteria 2712
47 Ga0070693_100101087 3300005547 Bacteria 1756
48 Ga0070665_100404272 3300005548 Bacteria 1373
49 Ga0068856_100287273 3300005614 Bacteria 1662
50 Ga0068864_100225052 3300005618 Bacteria 1732
51 Ga0068870_10122156 3300005840 Bacteria 1502
52 Ga0068863_100040880 3300005841 Bacteria 4408
53 Ga0068860_100032564 3300005843 Bacteria 5008
54 Ga0068860_100271518 3300005843 Bacteria 1655
55 Ga0068862_100032297 3300005844 Bacteria 4422
56 Ga0081455_10007642 3300005937 Bacteria 11353
57 Ga0081540_1001427 3300005983 Bacteria 20668
58 Ga0081540_1025830 3300005983 Bacteria 3369
59 Ga0081539_10000277 3300005985 Bacteria 117060
60 Ga0075365_10038116 3300006038 Bacteria 3122
61 Ga0075365_10064222 3300006038 Bacteria 2459
62 Ga0075365_10090668 3300006038 Bacteria 2082
63 Ga0075428_100002883 3300006844 Bacteria 18731
64 Ga0075428_100018013 3300006844 Bacteria 7805
65 Ga0075428_100121830 3300006844 Bacteria 2840
66 Ga0075428_100496680 3300006844 Unclassified 1306
67 Ga0075430_100157002 3300006846 Bacteria 1894
68 Ga0075431_100006213 3300006847 Bacteria 11863
69 Ga0075431_100089306 3300006847 Bacteria 3181
70 Ga0075431_100101906 3300006847 Bacteria 2962
71 Ga0075431_100104202 3300006847 Bacteria 2928
72 Ga0075433_10001836 3300006852 Bacteria 15941
73 Ga0075433_10009069 3300006852 Bacteria 7944
74 Ga0075433_10009564 3300006852 Bacteria 7752
75 Ga0075433_10018680 3300006852 Bacteria 5765
76 Ga0075433_10154627 3300006852 Bacteria 2041
77 Ga0075433_10154798 3300006852 Bacteria 2039
78 Ga0075433_10366904 3300006852 Bacteria 1271
79 Ga0075434_100012439 3300006871 Bacteria 8069
80 Ga0075434_100017409 3300006871 Bacteria 6924
81 Ga0075434_100035737 3300006871 Bacteria 4912
82 Ga0075434_100081279 3300006871 Unclassified 3238
83 Ga0075434_100223490 3300006871 Bacteria 1903
84 Ga0075434_100295165 3300006871 Bacteria 1641
85 Ga0075429_100000237 3300006880 Bacteria 37841
86 Ga0075429_100000485 3300006880 Bacteria 29758
87 Ga0075429_100000683 3300006880 Bacteria 26402
88 Ga0075429_100010016 3300006880 Bacteria 8213
89 Ga0075429_100135877 3300006880 Bacteria 2152
90 Ga0075429_100168261 3300006880 Bacteria 1920
91 Ga0068865_100272386 3300006881 Bacteria 1345
92 Ga0075436_100015100 3300006914 Bacteria 5292
93 Ga0075435_100000532 3300007076 Bacteria 23325
94 Ga0075435_100008014 3300007076 Bacteria 7560
95 Ga0075435_100102439 3300007076 Bacteria 2373
96 Ga0075435_100125126 3300007076 Bacteria 2148
97 Ga0075435_100156452 3300007076 Bacteria 1918
98 Ga0099794_10010953 3300007265 Bacteria 3869
99 Ga0099795_10008815 3300007788 Bacteria 2898
100 Ga0099795_10016994 3300007788 Bacteria 2312
101 Ga0111539_10000622 3300009094 Bacteria 45985
102 Ga0111539_10006412 3300009094 Bacteria 15172
103 Ga0111539_10035838 3300009094 Bacteria 6005
104 Ga0111539_10100748 3300009094 Bacteria 3391
105 Ga0111539_10141302 3300009094 Bacteria 2818
106 Ga0111539_10195560 3300009094 Bacteria 2359
107 Ga0105247_10013685 3300009101 Bacteria 4866
108 Ga0114129_10000562 3300009147 Bacteria 45605
109 Ga0114129_10002337 3300009147 Bacteria 26313
110 Ga0114129_10009090 3300009147 Bacteria 14159
111 Ga0114129_10010899 3300009147 Bacteria 12950
112 Ga0114129_10011697 3300009147 Bacteria 12487
113 Ga0114129_10013017 3300009147 Bacteria 11849
114 Ga0114129_10025021 3300009147 Bacteria 8463
115 Ga0114129_10072996 3300009147 Bacteria 4782
116 Ga0114129_10136000 3300009147 Bacteria 3372
117 Ga0114129_10141333 3300009147 Bacteria 3299
118 Ga0114129_10244143 3300009147 Bacteria 2413
119 Ga0114129_10312163 3300009147 Bacteria 2092
120 Ga0114129_10510412 3300009147 Bacteria 1569
121 Ga0114129_10941135 3300009147 Unclassified 1092
122 Ga0105241_10045639 3300009174 Bacteria 3326
123 Ga0105241_10096725 3300009174 Bacteria 2339
124 Ga0099796_10024502 3300010159 Bacteria 1895
125 Ga0105239_10400976 3300010375 Bacteria 1552
126 Ga0163162_10056826 3300013306 Bacteria 3941
127 Ga0163163_10044944 3300014325 Bacteria 4334
128 Ga0163163_10133306 3300014325 Bacteria 2524
129 Ga0157380_10080833 3300014326 Bacteria 2657
130 Ga0182008_10026668 3300014497 Bacteria 2929
131 Ga0157377_10008215 3300014745 Bacteria 5079
132 Ga0157377_10052470 3300014745 Bacteria 2302
133 Ga0213876_10012798 3300021384 Bacteria 4461
134 Ga0213876_10026877 3300021384 Bacteria 3036
135 Ga0213875_10001172 3300021388 Bacteria 17976
136 Ga0207688_10008894 3300025901 Bacteria 5464
137 Ga0207680_10101801 3300025903 Bacteria 1847
138 Ga0207647_10011378 3300025904 Bacteria 6241
139 Ga0207643_10006193 3300025908 Bacteria 6403
140 Ga0207684_10008211 3300025910 Bacteria 9296
141 Ga0207684_10036303 3300025910 Bacteria 4184
142 Ga0207684_10038640 3300025910 Bacteria 4050
143 Ga0207684_10044671 3300025910 Bacteria 3758
144 Ga0207684_10056030 3300025910 Bacteria 3344
145 Ga0207684_10119313 3300025910 Bacteria 2261
146 Ga0207684_10171163 3300025910 Bacteria 1872
147 Ga0207654_10042988 3300025911 Bacteria 2559
148 Ga0207707_10056764 3300025912 Bacteria 3407
149 Ga0207707_10068791 3300025912 Bacteria 3086
150 Ga0207663_10020536 3300025916 Bacteria 3742
151 Ga0207662_10000773 3300025918 Bacteria 14699
152 Ga0207657_10008032 3300025919 Bacteria 10762
153 Ga0207646_10023356 3300025922 Bacteria 5681
154 Ga0207646_10101270 3300025922 Bacteria 2582
155 Ga0207646_10156058 3300025922 Bacteria 2059
156 Ga0207681_10018984 3300025923 Bacteria 4338
157 Ga0207650_10001141 3300025925 Bacteria 19510
158 Ga0207700_10011470 3300025928 Bacteria 5651
159 Ga0207700_10098534 3300025928 Bacteria 2326
160 Ga0207664_10015878 3300025929 Bacteria 5483
161 Ga0207664_10076170 3300025929 Bacteria 2715
162 Ga0207644_10211546 3300025931 Bacteria 1533
163 Ga0207706_10009235 3300025933 Bacteria 9062
164 Ga0207706_10019719 3300025933 Bacteria 6065
165 Ga0207709_10068666 3300025935 Bacteria 2241
166 Ga0207665_10084532 3300025939 Bacteria 2190
167 Ga0207691_10005919 3300025940 Bacteria 11807
168 Ga0207691_10017401 3300025940 Bacteria 6817
169 Ga0207711_10059249 3300025941 Bacteria 3297
170 Ga0207689_10020373 3300025942 Bacteria 5581
171 Ga0207661_10143549 3300025944 Bacteria 2057
172 Ga0207661_10172433 3300025944 Bacteria 1884
173 Ga0207640_10296402 3300025981 Bacteria 1277
174 Ga0207703_10101167 3300026035 Bacteria 2443
175 Ga0207639_10201980 3300026041 Bacteria 1705
176 Ga0207678_10087798 3300026067 Bacteria 2657
177 Ga0207641_10128207 3300026088 Bacteria 2274
178 Ga0207648_10068121 3300026089 Bacteria 3101
179 Ga0207675_100012385 3300026118 Bacteria 7966
180 Ga0209588_1004919 3300027671 Bacteria 3799
181 Ga0207428_10000027 3300027907 Bacteria 250186
182 Ga0207428_10000069 3300027907 Bacteria 149507
183 Ga0207428_10058983 3300027907 Unclassified 3044
184 Ga0207428_10141362 3300027907 Bacteria 1837
185 Ga0268265_10131707 3300028380 Bacteria 2079
186 Ga0268264_10029766 3300028381 Bacteria 4474
187 Ga0268264_10291900 3300028381 Bacteria 1532
188 Ga0307408_100143684 3300031548 Bacteria 1875
189 Ga0307406_10113463 3300031901 Bacteria 1870
190 Ga0307409_100211304 3300031995 Unclassified 1744
191 Ga0307416_100188257 3300032002 Bacteria 1943
192 Ga0373926_0011705 3300035083 Bacteria 2957
193 Ga0373940_0004769 3300035088 Bacteria 2890
194 Ga0373944_0019436 3300035089 Bacteria 1949
195 Ga0373957_0031531 3300035120 Bacteria 1948
196 Ga0373946_0008672 3300035171 Bacteria 3733
197 Ga0373955_0096589 3300035172 Bacteria 1691
198 Ga0373962_0047477 3300035242 Bacteria 1229
199 Ga0373931_0004609 3300035691 Bacteria 6305
200 Ga0373931_0013421 3300035691 Bacteria 3989
201 Ga0373931_0035151 3300035691 Bacteria 2604
202 Ga0373935_0010357 3300035692 Bacteria 5593
203 Ga0373935_0218933 3300035692 Bacteria 1322
204 Ga0373927_0059137 3300035695 Bacteria 2479
205 Ga0373947_0077696 3300035725 Bacteria 2048
206 Ga0373937_0028887 3300036401 Bacteria 5021
207 Ga0373937_0095387 3300036401 Bacteria 2758
208 Ga0373925_0086778 3300037068 Bacteria 2388
209 Ga0436364_0379435 3300037853 Bacteria 15772
210 Ga0436364_0826827 3300037853 Bacteria 12894
211 Ga0436364_0883536 3300037853 Bacteria 58970
212 Ga0436364_1278154 3300037853 Bacteria 1618
213 Ga0436365_0331577 3300039437 Bacteria 6411
214 Ga0436365_0374713 3300039437 Bacteria 11204
215 Ga0436365_0640820 3300039437 Unclassified 1623
216 Ga0436365_1167680 3300039437 Bacteria 20779
217 Ga0436365_1623709 3300039437 Bacteria 5866
218 Ga0439435_0005509 3300042436 Bacteria 2789
219 Ga0451577_0053488 3300042876 Bacteria 3605
220 Ga0466967_0044751 3300045976 Bacteria 3842
221 Ga0466967_0176798 3300045976 Unclassified 2011
222 Ga0495603_0026418 3300046455 Bacteria 3507
223 Ga0495629_0105638 3300046459 Bacteria 1964
224 Ga0495653_0132700 3300046463 Bacteria 1761
225 Ga0495580_0002075 3300046472 Bacteria 17590
226 Ga0495580_0036156 3300046472 Bacteria 3547
227 Ga0495580_0299581 3300046472 Bacteria 1095
228 Ga0495639_0066080 3300046475 Bacteria 1664
229 Ga0495585_0165268 3300046492 Bacteria 1146
230 Ga0495628_0232706 3300046516 Bacteria 1381
231 Ga0495630_0305256 3300046517 Unclassified 1216
232 Ga0495637_0056136 3300046520 Bacteria 1631
233 Ga0495666_0017245 3300046526 Bacteria 3597
234 Ga0495665_0089458 3300046531 Unclassified 1618
235 Ga0495598_0024685 3300046537 Bacteria 1632
236 Ga0495668_0156348 3300046616 Bacteria 1249
237 Ga0495647_0051358 3300046681 Bacteria 1602
238 Ga0495658_0038310 3300046683 Bacteria 2654
239 Ga0495613_0069769 3300046689 Bacteria 2562
240 Ga0495649_0165466 3300046694 Bacteria 1159
241 Ga0495589_0051671 3300046794 Bacteria 2032
242 Ga0495581_0050223 3300047315 Bacteria 2409
243 Ga0495674_0181849 3300047319 Bacteria 1751
244 Ga0495674_0183239 3300047319 Bacteria 1743
245 Ga0495676_0034199 3300047321 Bacteria 4267
246 Ga0495680_0096152 3300047322 Unclassified 2213
247 Ga0495681_0057261 3300047470 Bacteria 1811
248 Ga0495684_0072688 3300047471 Bacteria 2613
249 Ga0496100_0193341 3300048903 Bacteria 1478
250 Ga0496100_0288485 3300048903 Bacteria 1225
251 Ga0496101_0022079 3300048904 Bacteria 4378
252 Ga0496101_0122567 3300048904 Bacteria 1966
253 Ga0496102_0000871 3300048905 Bacteria 28857
254 Ga0496102_0079573 3300048905 Bacteria 3018
255 Ga0496103_0004835 3300048906 Bacteria 8136
256 Ga0496103_0013608 3300048906 Bacteria 4826
257 Ga0496104_0000880 3300048907 Bacteria 25856
258 Ga0496104_0321311 3300048907 Bacteria 1461
259 Ga0496105_0001416 3300048908 Bacteria 16859
260 Ga0496105_0009051 3300048908 Bacteria 7769
261 Ga0496106_0117756 3300048909 Bacteria 2073
262 Ga0496106_0169592 3300048909 Bacteria 1729
263 Ga0496107_0098952 3300048910 Bacteria 2136
264 Ga0496108_0000522 3300048911 Bacteria 30076
265 Ga0496108_0013373 3300048911 Bacteria 6692
266 Ga0496109_0001714 3300048912 Bacteria 18286
267 Ga0496109_0045492 3300048912 Bacteria 3983
268 Ga0496110_0013411 3300048913 Bacteria 6774
269 Ga0496110_0109977 3300048913 Bacteria 2475
270 Ga0496111_0000072 3300048914 Bacteria 41891
271 Ga0496111_0006641 3300048914 Bacteria 7526
272 Ga0496112_0000112 3300048915 Bacteria 50370
273 Ga0496113_0000058 3300048916 Bacteria 47947
274 Ga0496114_0358167 3300048917 Bacteria 1290
275 Ga0496115_0087554 3300048918 Bacteria 2541
276 Ga0501039_0126724 3300049575 Bacteria 2003
277 Ga0501046_0110948 3300049580 Bacteria 2095
278 Ga0501046_0308672 3300049580 Bacteria 1154
279 Ga0501046_0386850 3300049580 Bacteria 1012
280 Ga0501048_0141988 3300049582 Bacteria 1698
281 Ga0501048_0148787 3300049582 Bacteria 1656
282 Ga0501067_0004586 3300049583 Bacteria 7644
283 Ga0501072_0028295 3300049588 Bacteria 4376
284 Ga0501072_0033556 3300049588 Bacteria 4022
285 Ga0501072_0038787 3300049588 Bacteria 3739
286 Ga0501075_0013097 3300049591 Bacteria 5912
287 Ga0501076_0004145 3300049592 Bacteria 10256
288 Ga0501076_0171171 3300049592 Bacteria 1770
289 Ga0501077_0031120 3300049593 Bacteria 3394
290 Ga0501077_0305207 3300049593 Bacteria 1014
291 Ga0501079_0005919 3300049741 Bacteria 9163
292 Ga0501079_0291175 3300049741 Bacteria 1277
293 Ga0501081_0006349 3300049743 Bacteria 7665
294 Ga0501081_0010707 3300049743 Bacteria 5989
295 Ga0501045_0104804 3300049824 Bacteria 2095
296 nmdc:mga0yw44_12946_c1 3300050492 Bacteria 4370
297 nmdc:mga0yw44_3991_c1 3300050492 Bacteria 6667
298 nmdc:mga0yw44_60385_c1 3300050492 Bacteria 2322
299 nmdc:mga0yw44_720_c1 3300050492 Bacteria 7540
300 nmdc:mga0yw44_98789_c1 3300050492 Bacteria 1857
301 nmdc:mga05p37_10904_c1 3300050507 Bacteria 10791
302 nmdc:mga05p37_148909_c1 3300050507 Bacteria 2865
303 nmdc:mga05p37_1613_c1 3300050507 Bacteria 26137
304 nmdc:mga05p37_202274_c1 3300050507 Bacteria 2404
305 nmdc:mga05p37_20243_c1 3300050507 Bacteria 8053
306 nmdc:mga05p37_223988_c1 3300050507 Bacteria 2269
307 nmdc:mga05p37_228767_c1 3300050507 Bacteria 2241
308 nmdc:mga05p37_2288_c1 3300050507 Bacteria 22334
309 nmdc:mga05p37_290457_c1 3300050507 Bacteria 1946
310 nmdc:mga05p37_538626_c1 3300050507 Bacteria 1332
311 nmdc:mga05p37_6772_c1 3300050507 Bacteria 13506
312 nmdc:mga05p37_71909_c1 3300050507 Bacteria 4256
313 nmdc:mga09592_109819_c1 3300050508 Bacteria 2366
314 nmdc:mga09592_134243_c1 3300050508 Bacteria 2131
315 nmdc:mga09592_1983_c1 3300050508 Bacteria 16505
316 nmdc:mga09592_350832_c1 3300050508 Unclassified 1277
317 nmdc:mga09592_58_c1 3300050508 Bacteria 61599
318 nmdc:mga09592_7304_c1 3300050508 Bacteria 8980
319 nmdc:mga09592_991_c1 3300050508 Bacteria 22493
320 nmdc:mga0qj67_108165_c1 3300050509 Bacteria 2243
321 nmdc:mga0qj67_141_c1 3300050509 Bacteria 48622
322 nmdc:mga0qj67_28823_c1 3300050509 Bacteria 4311
323 nmdc:mga0qj67_290072_c1 3300050509 Bacteria 1326
324 nmdc:mga0qj67_56473_c1 3300050509 Bacteria 3111
325 nmdc:mga06r32_113591_c1 3300050510 Bacteria 2666
326 nmdc:mga06r32_122833_c1 3300050510 Unclassified 2562
327 nmdc:mga06r32_22579_c1 3300050510 Bacteria 2161
328 nmdc:mga06r32_9098_c1 3300050510 Bacteria 8953
329 nmdc:mga06r32_97957_c1 3300050510 Bacteria 2874
330 nmdc:mga08y16_17480_c1 3300050511 Bacteria 7552
331 nmdc:mga08y16_194012_c1 3300050511 Bacteria 2106
332 nmdc:mga08y16_21560_c1 3300050511 Bacteria 6803
333 nmdc:mga08y16_7025_c1 3300050511 Bacteria 11812
334 nmdc:mga0n895_114040_c1 3300050512 Bacteria 2721
335 nmdc:mga0n895_11460_c1 3300050512 Bacteria 7911
336 nmdc:mga0n895_145843_c1 3300050512 Bacteria 2397
337 nmdc:mga0n895_2728_c1 3300050512 Bacteria 13925
338 nmdc:mga0n895_279724_c1 3300050512 Bacteria 1692
339 nmdc:mga0n895_28661_c1 3300050512 Bacteria 5300
340 nmdc:mga0n895_28787_c1 3300050512 Bacteria 5289
341 nmdc:mga0n895_43032_c1 3300050512 Unclassified 4398
342 nmdc:mga0n895_96076_c1 3300050512 Bacteria 2968
343 nmdc:mga0rr50_105068_c1 3300050513 Bacteria 2226
344 nmdc:mga0rr50_11081_c1 3300050513 Bacteria 5751
345 nmdc:mga0rr50_34361_c1 3300050513 Bacteria 3631
346 nmdc:mga08x19_110752_c1 3300050514 Bacteria 1831
347 nmdc:mga08x19_21715_c1 3300050514 Bacteria 3966
348 nmdc:mga08x19_2837_c1 3300050514 Bacteria 10452
349 nmdc:mga08x19_69414_c1 3300050514 Bacteria 2295
350 nmdc:mga0a205_23794_c1 3300050515 Bacteria 5813
351 nmdc:mga0a205_2854_c1 3300050515 Bacteria 15293
352 nmdc:mga0a205_39682_c1 3300050515 Bacteria 4530
353 nmdc:mga0a205_5169_c1 3300050515 Bacteria 11734
354 nmdc:mga0a205_78276_c1 3300050515 Bacteria 3194
355 nmdc:mga0a205_79954_c2 3300050515 Unclassified 1382
356 nmdc:mga0a205_81518_c1 3300050515 Bacteria 3125
357 nmdc:mga0a205_91102_c1 3300050515 Bacteria 2946
358 Ga0495601_0005332 3300053077 Bacteria 7487
359 Ga0495601_0044373 3300053077 Bacteria 2795
360 Ga0495619_0021901 3300053085 Bacteria 4085
361 Ga0495619_0028162 3300053085 Bacteria 3623
362 Ga0495619_0103094 3300053085 Bacteria 1943
363 Ga0495619_0201614 3300053085 Unclassified 1377
364 Ga0501084_0005664 3300054114 Bacteria 10255
365 Ga0501084_0011887 3300054114 Bacteria 7207
366 Ga0501082_0002253 3300060353 Bacteria 16888
367 Ga0501082_0015695 3300060353 Bacteria 6515
368 Ga0530510_0003885 3300061734 Bacteria 10305
369 Ga0530510_0016067 3300061734 Bacteria 5291
370 Ga0530510_0039546 3300061734 Bacteria 3405
371 nmdc:mga05p37_3868_c1
372 JGI25406J46586_10005936
373 Ga0070683_100156450
374 Ga0070670_100014142
375 Ga0070670_100226380
376 Ga0070666_10179932
377 Ga0070680_100033029
378 Ga0070669_100130311
379 Ga0070671_100097457
380 Ga0070709_10006152
381 Ga0070714_100118100
382 Ga0070713_100003085
383 Ga0070711_100086969
384 Ga0070708_100024660
385 Ga0070708_100024835
386 Ga0070708_100048542
387 Ga0070708_100070646
388 Ga0070708_100277365
389 Ga0070678_100185700
390 Ga0070662_100038642
391 Ga0070681_10011584
392 Ga0070681_10044054
393 Ga0070681_10051209
394 Ga0070685_10020391
395 Ga0070706_100032095
396 Ga0070706_100046340
397 Ga0070706_100131649
398 Ga0070707_100024968
399 Ga0070707_100042684
400 Ga0070707_100086680
401 Ga0070707_100095983
402 Ga0070707_100147190
403 Ga0070707_100180715
404 Ga0070707_100221345
405 Ga0070698_100045025
406 Ga0070698_100068035
407 Ga0070698_100131198
408 Ga0070698_100227493
409 Ga0070699_100030567
410 Ga0070699_100078055
411 Ga0070699_100089721
412 Ga0070699_100137651
413 Ga0070699_100206118
414 Ga0070697_100027034
415 Ga0070697_100159467
416 Ga0070696_100057599
417 Ga0070693_100101087
418 Ga0070665_100404272
419 Ga0068856_100287273
420 Ga0068864_100225052
421 Ga0068870_10122156
422 Ga0068863_100040880
423 Ga0068860_100032564
424 Ga0068860_100271518
425 Ga0068862_100032297
426 Ga0081455_10007642
427 Ga0081540_1001427
428 Ga0081540_1025830
429 Ga0081539_10000277
430 Ga0075365_10038116
431 Ga0075365_10064222
432 Ga0075365_10090668
433 Ga0075428_100002883
434 Ga0075428_100018013
435 Ga0075428_100121830
436 Ga0075428_100496680
437 Ga0075430_100157002
438 Ga0075431_100006213
439 Ga0075431_100089306
440 Ga0075431_100101906
441 Ga0075431_100104202
442 Ga0075433_10001836
443 Ga0075433_10009069
444 Ga0075433_10009564
445 Ga0075433_10018680
446 Ga0075433_10154627
447 Ga0075433_10154798
448 Ga0075433_10366904
449 Ga0075434_100012439
450 Ga0075434_100017409
451 Ga0075434_100035737
452 Ga0075434_100081279
453 Ga0075434_100223490
454 Ga0075434_100295165
455 Ga0075429_100000237
456 Ga0075429_100000485
457 Ga0075429_100000683
458 Ga0075429_100010016
459 Ga0075429_100135877
460 Ga0075429_100168261
461 Ga0068865_100272386
462 Ga0075436_100015100
463 Ga0075435_100000532
464 Ga0075435_100008014
465 Ga0075435_100102439
466 Ga0075435_100125126
467 Ga0075435_100156452
468 Ga0099794_10010953
469 Ga0099795_10008815
470 Ga0099795_10016994
471 Ga0111539_10000622
472 Ga0111539_10006412
473 Ga0111539_10035838
474 Ga0111539_10100748
475 Ga0111539_10141302
476 Ga0111539_10195560
477 Ga0105247_10013685
478 Ga0114129_10000562
479 Ga0114129_10002337
480 Ga0114129_10009090
481 Ga0114129_10010899
482 Ga0114129_10011697
483 Ga0114129_10013017
484 Ga0114129_10025021
485 Ga0114129_10072996
486 Ga0114129_10136000
487 Ga0114129_10141333
488 Ga0114129_10244143
489 Ga0114129_10312163
490 Ga0114129_10510412
491 Ga0114129_10941135
492 Ga0105241_10045639
493 Ga0105241_10096725
494 Ga0099796_10024502
495 Ga0105239_10400976
496 Ga0163162_10056826
497 Ga0163163_10044944
498 Ga0163163_10133306
499 Ga0157380_10080833
500 Ga0182008_10026668
501 Ga0157377_10008215
502 Ga0157377_10052470
503 Ga0213876_10012798
504 Ga0213876_10026877
505 Ga0213875_10001172
506 Ga0207688_10008894
507 Ga0207680_10101801
508 Ga0207647_10011378
509 Ga0207643_10006193
510 Ga0207684_10008211
511 Ga0207684_10036303
512 Ga0207684_10038640
513 Ga0207684_10044671
514 Ga0207684_10056030
515 Ga0207684_10119313
516 Ga0207684_10171163
517 Ga0207654_10042988
518 Ga0207707_10056764
519 Ga0207707_10068791
520 Ga0207663_10020536
521 Ga0207662_10000773
522 Ga0207657_10008032
523 Ga0207646_10023356
524 Ga0207646_10101270
525 Ga0207646_10156058
526 Ga0207681_10018984
527 Ga0207650_10001141
528 Ga0207700_10011470
529 Ga0207700_10098534
530 Ga0207664_10015878
531 Ga0207664_10076170
532 Ga0207644_10211546
533 Ga0207706_10009235
534 Ga0207706_10019719
535 Ga0207709_10068666
536 Ga0207665_10084532
537 Ga0207691_10005919
538 Ga0207691_10017401
539 Ga0207711_10059249
540 Ga0207689_10020373
541 Ga0207661_10143549
542 Ga0207661_10172433
543 Ga0207640_10296402
544 Ga0207703_10101167
545 Ga0207639_10201980
546 Ga0207678_10087798
547 Ga0207641_10128207
548 Ga0207648_10068121
549 Ga0207675_100012385
550 Ga0209588_1004919
551 Ga0207428_10000027
552 Ga0207428_10000069
553 Ga0207428_10058983
554 Ga0207428_10141362
555 Ga0268265_10131707
556 Ga0268264_10029766
557 Ga0268264_10291900
558 Ga0307408_100143684
559 Ga0307406_10113463
560 Ga0307409_100211304
561 Ga0307416_100188257
562 Ga0373926_0011705
563 Ga0373940_0004769
564 Ga0373944_0019436
565 Ga0373957_0031531
566 Ga0373946_0008672
567 Ga0373955_0096589
568 Ga0373962_0047477
569 Ga0373931_0004609
570 Ga0373931_0013421
571 Ga0373931_0035151
572 Ga0373935_0010357
573 Ga0373935_0218933
574 Ga0373927_0059137
575 Ga0373947_0077696
576 Ga0373937_0028887
577 Ga0373937_0095387
578 Ga0373925_0086778
579 Ga0436364_0379435
580 Ga0436364_0826827
581 Ga0436364_0883536
582 Ga0436364_1278154
583 Ga0436365_0331577
584 Ga0436365_0374713
585 Ga0436365_0640820
586 Ga0436365_1167680
587 Ga0436365_1623709
588 Ga0439435_0005509
589 Ga0451577_0053488
590 Ga0466967_0044751
591 Ga0466967_0176798
592 Ga0495603_0026418
593 Ga0495629_0105638
594 Ga0495653_0132700
595 Ga0495580_0002075
596 Ga0495580_0036156
597 Ga0495580_0299581
598 Ga0495639_0066080
599 Ga0495585_0165268
600 Ga0495628_0232706
601 Ga0495630_0305256
602 Ga0495637_0056136
603 Ga0495666_0017245
604 Ga0495665_0089458
605 Ga0495598_0024685
606 Ga0495668_0156348
607 Ga0495647_0051358
608 Ga0495658_0038310
609 Ga0495613_0069769
610 Ga0495649_0165466
611 Ga0495589_0051671
612 Ga0495581_0050223
613 Ga0495674_0181849
614 Ga0495674_0183239
615 Ga0495676_0034199
616 Ga0495680_0096152
617 Ga0495681_0057261
618 Ga0495684_0072688
619 Ga0496100_0193341
620 Ga0496100_0288485
621 Ga0496101_0022079
622 Ga0496101_0122567
623 Ga0496102_0000871
624 Ga0496102_0079573
625 Ga0496103_0004835
626 Ga0496103_0013608
627 Ga0496104_0000880
628 Ga0496104_0321311
629 Ga0496105_0001416
630 Ga0496105_0009051
631 Ga0496106_0117756
632 Ga0496106_0169592
633 Ga0496107_0098952
634 Ga0496108_0000522
635 Ga0496108_0013373
636 Ga0496109_0001714
637 Ga0496109_0045492
638 Ga0496110_0013411
639 Ga0496110_0109977
640 Ga0496111_0000072
641 Ga0496111_0006641
642 Ga0496112_0000112
643 Ga0496113_0000058
644 Ga0496114_0358167
645 Ga0496115_0087554
646 Ga0501039_0126724
647 Ga0501046_0110948
648 Ga0501046_0308672
649 Ga0501046_0386850
650 Ga0501048_0141988
651 Ga0501048_0148787
652 Ga0501067_0004586
653 Ga0501072_0028295
654 Ga0501072_0033556
655 Ga0501072_0038787
656 Ga0501075_0013097
657 Ga0501076_0004145
658 Ga0501076_0171171
659 Ga0501077_0031120
660 Ga0501077_0305207
661 Ga0501079_0005919
662 Ga0501079_0291175
663 Ga0501081_0006349
664 Ga0501081_0010707
665 Ga0501045_0104804
666 nmdc:mga0yw44_12946_c1
667 nmdc:mga0yw44_3991_c1
668 nmdc:mga0yw44_60385_c1
669 nmdc:mga0yw44_720_c1
670 nmdc:mga0yw44_98789_c1
671 nmdc:mga05p37_10904_c1
672 nmdc:mga05p37_148909_c1
673 nmdc:mga05p37_1613_c1
674 nmdc:mga05p37_202274_c1
675 nmdc:mga05p37_20243_c1
676 nmdc:mga05p37_223988_c1
677 nmdc:mga05p37_228767_c1
678 nmdc:mga05p37_2288_c1
679 nmdc:mga05p37_290457_c1
680 nmdc:mga05p37_538626_c1
681 nmdc:mga05p37_6772_c1
682 nmdc:mga05p37_71909_c1
683 nmdc:mga09592_109819_c1
684 nmdc:mga09592_134243_c1
685 nmdc:mga09592_1983_c1
686 nmdc:mga09592_350832_c1
687 nmdc:mga09592_58_c1
688 nmdc:mga09592_7304_c1
689 nmdc:mga09592_991_c1
690 nmdc:mga0qj67_108165_c1
691 nmdc:mga0qj67_141_c1
692 nmdc:mga0qj67_28823_c1
693 nmdc:mga0qj67_290072_c1
694 nmdc:mga0qj67_56473_c1
695 nmdc:mga06r32_113591_c1
696 nmdc:mga06r32_122833_c1
697 nmdc:mga06r32_22579_c1
698 nmdc:mga06r32_9098_c1
699 nmdc:mga06r32_97957_c1
700 nmdc:mga08y16_17480_c1
701 nmdc:mga08y16_194012_c1
702 nmdc:mga08y16_21560_c1
703 nmdc:mga08y16_7025_c1
704 nmdc:mga0n895_114040_c1
705 nmdc:mga0n895_11460_c1
706 nmdc:mga0n895_145843_c1
707 nmdc:mga0n895_2728_c1
708 nmdc:mga0n895_279724_c1
709 nmdc:mga0n895_28661_c1
710 nmdc:mga0n895_28787_c1
711 nmdc:mga0n895_43032_c1
712 nmdc:mga0n895_96076_c1
713 nmdc:mga0rr50_105068_c1
714 nmdc:mga0rr50_11081_c1
715 nmdc:mga0rr50_34361_c1
716 nmdc:mga08x19_110752_c1
717 nmdc:mga08x19_21715_c1
718 nmdc:mga08x19_2837_c1
719 nmdc:mga08x19_69414_c1
720 nmdc:mga0a205_23794_c1
721 nmdc:mga0a205_2854_c1
722 nmdc:mga0a205_39682_c1
723 nmdc:mga0a205_5169_c1
724 nmdc:mga0a205_78276_c1
725 nmdc:mga0a205_79954_c2
726 nmdc:mga0a205_81518_c1
727 nmdc:mga0a205_91102_c1
728 Ga0495601_0005332
729 Ga0495601_0044373
730 Ga0495619_0021901
731 Ga0495619_0028162
732 Ga0495619_0103094
733 Ga0495619_0201614
734 Ga0501084_0005664
735 Ga0501084_0011887
736 Ga0501082_0002253
737 Ga0501082_0015695
738 Ga0530510_0003885
739 Ga0530510_0016067
740 Ga0530510_0039546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

69

385

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4icm-assembly3.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis 0.8977 23 334
4ign-assembly2.cif.gz_B 2.32 angstrom x-ray crystal structure of r47a mutant of human acmsd 0.8868 26 334
4lao-assembly1.cif.gz_B crystal structure of cordyceps militaris idcase h195a mutant (zn) 0.8848 23 333
4epk-assembly1.cif.gz_B evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase 0.8829 25 334
2hbx-assembly1.cif.gz_A crystal structure of alpha-amino-beta-carboxymuconate-epsilon-semialdehyde-decarboxylase (acmsd) 0.8802 24 333
ID Description Score Start End Superfamily
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8883 23 334 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8772 25 336 3.20.20.140
4lalD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8746 24 334 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8632 23 333 3.20.20.140
af_Q2FV40_2_334_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8611 24 334 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A3N5PH40-F1-model_v4 Amidohydrolase-related domain-containing protein 0.979 167 335 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2V8DKA5-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9739 175 302 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A351D3F2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9662 206 333 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A3N5PH40-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9622 167 335 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A1F2SZH9-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9585 18 335 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map