F425566

General Info

Members Datasets Scaffolds Average Seq Length
370 172 370 168

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0063808|Ga0501070_0063808_2363_2857
Length 164
Sequence LPSNPIAAVVLAAGASSRYGVSPPKQAVFLPRVLDALRGIETVVVTGAHPVDTDARVVRCPEWELGPGASLRCGLAALGDEVEAALVVLADGPELDRRAVDRVVDAWRGEDALAASYGGVRLHPVLLGRTVWGRIPDEGARGLPARLVPCDDLTPPGDVDTREG

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
65 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
66 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
73 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 7.84
Rhizosphere 91.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100123757 3300005355 Bacteria 2177
2 Ga0070659_100190088 3300005366 Bacteria 1687
3 Ga0070709_10042207 3300005434 Bacteria 2815
4 Ga0070709_10307347 3300005434 Bacteria 1160
5 Ga0070714_100021527 3300005435 Bacteria 5276
6 Ga0070714_100035861 3300005435 Bacteria 4157
7 Ga0070714_100036286 3300005435 Bacteria 4133
8 Ga0070714_100038130 3300005435 Bacteria 4041
9 Ga0070714_100080725 3300005435 Unclassified 2830
10 Ga0070714_100394213 3300005435 Unclassified 1307
11 Ga0070714_100539050 3300005435 Bacteria 1116
12 Ga0070713_100013333 3300005436 Bacteria 6066
13 Ga0070713_100072102 3300005436 Bacteria 2921
14 Ga0070713_100116874 3300005436 Bacteria 2333
15 Ga0070713_100141428 3300005436 Unclassified 2132
16 Ga0070710_10049927 3300005437 Bacteria 2342
17 Ga0070710_10060396 3300005437 Unclassified 2156
18 Ga0070711_100031738 3300005439 Bacteria 3509
19 Ga0070711_100109193 3300005439 Unclassified 2027
20 Ga0070705_100840934 3300005440 Bacteria 733
21 Ga0070708_100068113 3300005445 Bacteria 3198
22 Ga0070708_100271488 3300005445 Bacteria 1595
23 Ga0070708_100521086 3300005445 Unclassified 1121
24 Ga0070708_100964383 3300005445 Bacteria 800
25 Ga0070663_100054413 3300005455 Bacteria 2860
26 Ga0070662_101255757 3300005457 Bacteria 637
27 Ga0070681_10576323 3300005458 Unclassified 1039
28 Ga0070706_100653673 3300005467 Unclassified 976
29 Ga0070706_101021822 3300005467 Bacteria 762
30 Ga0070707_100604635 3300005468 Unclassified 1059
31 Ga0070698_100062011 3300005471 Bacteria 3773
32 Ga0070698_100155192 3300005471 Unclassified 2235
33 Ga0070698_100322079 3300005471 Bacteria 1476
34 Ga0070679_100116057 3300005530 Bacteria 2662
35 Ga0070679_100192536 3300005530 Unclassified 2008
36 Ga0070679_100428573 3300005530 Unclassified 1268
37 Ga0070686_100648182 3300005544 Unclassified 837
38 Ga0070695_100313138 3300005545 Bacteria 1164
39 Ga0070696_100124776 3300005546 Bacteria 1867
40 Ga0070693_100050221 3300005547 Bacteria 2383
41 Ga0070693_100184236 3300005547 Bacteria 1346
42 Ga0070704_100117866 3300005549 Unclassified 2033
43 Ga0068855_101161094 3300005563 Bacteria 804
44 Ga0068856_100045467 3300005614 Bacteria 4323
45 Ga0068870_10245750 3300005840 Unclassified 1107
46 Ga0070717_10008104 3300006028 Bacteria 7837
47 Ga0070717_10043531 3300006028 Bacteria 3665
48 Ga0070717_10051688 3300006028 Bacteria 3383
49 Ga0070717_10165035 3300006028 Unclassified 1923
50 Ga0070717_10228488 3300006028 Bacteria 1638
51 Ga0070717_10592961 3300006028 Bacteria 1005
52 Ga0070715_10004504 3300006163 Bacteria 4579
53 Ga0070715_10007610 3300006163 Bacteria 3736
54 Ga0070716_100020064 3300006173 Bacteria 3504
55 Ga0070716_100055187 3300006173 Unclassified 2272
56 Ga0070716_100061430 3300006173 Unclassified 2174
57 Ga0070712_100036396 3300006175 Bacteria 3349
58 Ga0070712_100091111 3300006175 Bacteria 2233
59 Ga0070712_100219849 3300006175 Unclassified 1503
60 Ga0070712_100353117 3300006175 Unclassified 1204
61 Ga0097621_100010449 3300006237 Bacteria 6798
62 Ga0068871_100159998 3300006358 Bacteria 1925
63 Ga0068871_101073439 3300006358 Unclassified 752
64 Ga0075434_101121287 3300006871 Unclassified 800
65 Ga0105245_10234205 3300009098 Unclassified 1777
66 Ga0105245_10895335 3300009098 Bacteria 929
67 Ga0105247_10124108 3300009101 Bacteria 1676
68 Ga0105241_10050531 3300009174 Bacteria 3169
69 Ga0105239_12821003 3300010375 Bacteria 567
70 Ga0157370_10521539 3300013104 Bacteria 1090
71 Ga0157374_10041104 3300013296 Bacteria 4259
72 Ga0157372_10231608 3300013307 Bacteria 2142
73 Ga0163163_10523382 3300014325 Unclassified 1248
74 Ga0182008_10071147 3300014497 Unclassified 1711
75 Ga0182008_10072394 3300014497 Bacteria 1696
76 Ga0157379_10074183 3300014968 Bacteria 3046
77 Ga0157379_11226539 3300014968 Unclassified 722
78 Ga0157376_10015770 3300014969 Bacteria 5718
79 Ga0206356_11815991 3300020070 Bacteria 1308
80 Ga0224712_10004092 3300022467 Bacteria 3893
81 Ga0207692_10029445 3300025898 Bacteria 2610
82 Ga0207710_10064493 3300025900 Bacteria 1668
83 Ga0207699_10007837 3300025906 Bacteria 5235
84 Ga0207699_10037857 3300025906 Bacteria 2760
85 Ga0207705_10186512 3300025909 Bacteria 1567
86 Ga0207654_10031463 3300025911 Bacteria 2923
87 Ga0207707_10089996 3300025912 Bacteria 2682
88 Ga0207693_10006140 3300025915 Bacteria 9960
89 Ga0207693_10012860 3300025915 Bacteria 6754
90 Ga0207693_10045089 3300025915 Bacteria 3465
91 Ga0207663_10002700 3300025916 Bacteria 8557
92 Ga0207663_10070485 3300025916 Bacteria 2252
93 Ga0207663_10073154 3300025916 Unclassified 2217
94 Ga0207663_10110221 3300025916 Bacteria 1866
95 Ga0207660_10138895 3300025917 Bacteria 1856
96 Ga0207657_10002847 3300025919 Bacteria 18595
97 Ga0207646_10002759 3300025922 Bacteria 20509
98 Ga0207700_10035208 3300025928 Bacteria 3604
99 Ga0207700_10305097 3300025928 Unclassified 1376
100 Ga0207700_10508834 3300025928 Unclassified 1066
101 Ga0207664_10022929 3300025929 Bacteria 4670
102 Ga0207664_10029088 3300025929 Bacteria 4205
103 Ga0207664_10033418 3300025929 Bacteria 3951
104 Ga0207664_10049033 3300025929 Unclassified 3323
105 Ga0207664_10178797 3300025929 Unclassified 1820
106 Ga0207664_10406886 3300025929 Bacteria 1211
107 Ga0207644_10138772 3300025931 Bacteria 1870
108 Ga0207665_10002447 3300025939 Bacteria 12534
109 Ga0207665_10002480 3300025939 Bacteria 12442
110 Ga0207665_10193754 3300025939 Bacteria 1478
111 Ga0207689_11259169 3300025942 Unclassified 622
112 Ga0207678_10007890 3300026067 Bacteria 9392
113 Ga0207675_100007354 3300026118 Bacteria 10405
114 Ga0207683_10004201 3300026121 Bacteria 12445
115 Ga0373950_0006092 3300034818 Bacteria 1826
116 Ga0373958_0024907 3300034819 Unclassified 1136
117 Ga0373938_0014578 3300034957 Bacteria 1511
118 Ga0373926_0005523 3300035083 Bacteria 4171
119 Ga0373929_0028232 3300035085 Unclassified 1184
120 Ga0373934_0255391 3300035086 Unclassified 725
121 Ga0373944_0027607 3300035089 Bacteria 1684
122 Ga0373936_0196020 3300035113 Bacteria 890
123 Ga0373941_0006525 3300035115 Unclassified 2816
124 Ga0373945_0022615 3300035116 Bacteria 2167
125 Ga0373953_0136917 3300035117 Bacteria 1046
126 Ga0373957_0263574 3300035120 Unclassified 727
127 Ga0373943_0001283 3300035170 Bacteria 11248
128 Ga0373943_0217194 3300035170 Unclassified 1064
129 Ga0373943_0529906 3300035170 Bacteria 690
130 Ga0373955_0536086 3300035172 Bacteria 716
131 Ga0373931_0042229 3300035691 Bacteria 2397
132 Ga0373933_0088007 3300035724 Unclassified 1913
133 Ga0373947_0002113 3300035725 Bacteria 12113
134 Ga0373937_0001058 3300036401 Bacteria 23217
135 Ga0373937_0144659 3300036401 Bacteria 2225
136 Ga0373937_0221016 3300036401 Bacteria 1783
137 Ga0373925_0001501 3300037068 Bacteria 19995
138 Ga0373925_0052040 3300037068 Bacteria 3059
139 Ga0395899_0351799 3300037312 Bacteria 985
140 Ga0395899_0454025 3300037312 Unclassified 839
141 Ga0395898_0027064 3300037466 Bacteria 5761
142 Ga0395898_0542394 3300037466 Bacteria 1105
143 Ga0395905_0139019 3300037471 Bacteria 2285
144 Ga0395905_0367710 3300037471 Bacteria 1331
145 Ga0395901_0088887 3300038443 Bacteria 3232
146 Ga0395901_0372881 3300038443 Bacteria 1470
147 Ga0395901_0385734 3300038443 Bacteria 1441
148 Ga0466972_0290737 3300044658 Bacteria 764
149 Ga0466966_0194753 3300044684 Bacteria 1227
150 Ga0466966_0489775 3300044684 Bacteria 739
151 Ga0466961_0007503 3300044693 Bacteria 6937
152 Ga0466961_0117730 3300044693 Bacteria 1669
153 Ga0466961_0392810 3300044693 Bacteria 842
154 Ga0466963_0001805 3300044694 Bacteria 11654
155 Ga0466963_0002423 3300044694 Bacteria 10428
156 Ga0466963_0003006 3300044694 Bacteria 9542
157 Ga0466963_0003165 3300044694 Bacteria 9347
158 Ga0466963_0007554 3300044694 Bacteria 6488
159 Ga0466963_0021168 3300044694 Bacteria 4098
160 Ga0466963_0058181 3300044694 Bacteria 2576
161 Ga0466963_0113320 3300044694 Bacteria 1862
162 Ga0466963_0116537 3300044694 Bacteria 1836
163 Ga0466964_0016278 3300044706 Bacteria 2837
164 Ga0466964_0019105 3300044706 Bacteria 2632
165 Ga0466964_0068935 3300044706 Unclassified 1490
166 Ga0466964_0129313 3300044706 Unclassified 1148
167 Ga0466964_0131827 3300044706 Unclassified 1139
168 Ga0466964_0433836 3300044706 Unclassified 693
169 Ga0466971_0003143 3300044719 Bacteria 7036
170 Ga0466968_0000933 3300044735 Bacteria 10298
171 Ga0466968_0077786 3300044735 Bacteria 1453
172 Ga0466968_0212510 3300044735 Bacteria 909
173 Ga0466970_0020911 3300044765 Bacteria 3405
174 Ga0466957_0007794 3300044842 Bacteria 6064
175 Ga0466957_0015797 3300044842 Bacteria 4410
176 Ga0466957_0021942 3300044842 Bacteria 3765
177 Ga0466957_0070027 3300044842 Unclassified 2167
178 Ga0466957_0403638 3300044842 Bacteria 935
179 Ga0466960_0016180 3300044901 Bacteria 3230
180 Ga0466960_0382690 3300044901 Bacteria 808
181 Ga0466959_0003272 3300045049 Bacteria 10554
182 Ga0466959_0061306 3300045049 Bacteria 2735
183 Ga0466958_0001480 3300045836 Bacteria 11201
184 Ga0466958_0006546 3300045836 Bacteria 6347
185 Ga0466958_0026124 3300045836 Bacteria 3449
186 Ga0466958_0057280 3300045836 Bacteria 2368
187 Ga0466958_0081027 3300045836 Bacteria 1997
188 Ga0466967_0005380 3300045976 Bacteria 8862
189 Ga0466967_0008400 3300045976 Bacteria 7559
190 Ga0466967_0009935 3300045976 Bacteria 7103
191 Ga0466967_0034228 3300045976 Bacteria 4310
192 Ga0466967_0041841 3300045976 Bacteria 3954
193 Ga0466967_0042266 3300045976 Bacteria 3937
194 Ga0466967_0118967 3300045976 Bacteria 2437
195 Ga0466967_0135873 3300045976 Bacteria 2286
196 Ga0466967_0182389 3300045976 Bacteria 1981
197 Ga0466967_0201238 3300045976 Bacteria 1886
198 Ga0466967_0214599 3300045976 Bacteria 1826
199 Ga0466967_0276952 3300045976 Bacteria 1609
200 Ga0466967_0291016 3300045976 Bacteria 1569
201 Ga0466967_0477723 3300045976 Bacteria 1221
202 Ga0466967_1237749 3300045976 Bacteria 743
203 Ga0495592_0000037 3300046454 Bacteria 125143
204 Ga0495592_0051471 3300046454 Bacteria 3059
205 Ga0495592_0132620 3300046454 Bacteria 1741
206 Ga0495603_0008076 3300046455 Bacteria 6359
207 Ga0495629_0130778 3300046459 Bacteria 1748
208 Ga0495641_0005407 3300046461 Bacteria 8637
209 Ga0495641_0010174 3300046461 Bacteria 5490
210 Ga0495641_0144805 3300046461 Bacteria 1062
211 Ga0495651_0000038 3300046462 Bacteria 97248
212 Ga0495651_0044484 3300046462 Bacteria 3441
213 Ga0495653_0004001 3300046463 Bacteria 11902
214 Ga0495653_0025614 3300046463 Bacteria 4736
215 Ga0495653_0047002 3300046463 Bacteria 3340
216 Ga0495653_0158275 3300046463 Bacteria 1575
217 Ga0495580_0033594 3300046472 Bacteria 3695
218 Ga0495582_0040361 3300046473 Bacteria 2571
219 Ga0495582_0113451 3300046473 Bacteria 1523
220 Ga0495582_0415546 3300046473 Bacteria 776
221 Ga0495639_0000977 3300046475 Bacteria 12876
222 Ga0495662_0047065 3300046476 Bacteria 2082
223 Ga0495662_0153520 3300046476 Bacteria 1134
224 Ga0495664_0014004 3300046477 Bacteria 4543
225 Ga0495664_0029420 3300046477 Bacteria 3213
226 Ga0495664_0085758 3300046477 Bacteria 1891
227 Ga0495584_0037377 3300046491 Bacteria 2453
228 Ga0495608_0001032 3300046511 Bacteria 19553
229 Ga0495608_0009021 3300046511 Bacteria 6975
230 Ga0495608_0332971 3300046511 Bacteria 936
231 Ga0495608_0478683 3300046511 Bacteria 755
232 Ga0495618_0001122 3300046514 Bacteria 18089
233 Ga0495618_0028699 3300046514 Bacteria 3468
234 Ga0495618_0694891 3300046514 Bacteria 598
235 Ga0495628_0000025 3300046516 Bacteria 127935
236 Ga0495628_0026160 3300046516 Bacteria 4763
237 Ga0495628_0129262 3300046516 Bacteria 1933
238 Ga0495628_0240421 3300046516 Bacteria 1354
239 Ga0495630_0034774 3300046517 Bacteria 3764
240 Ga0495630_0128412 3300046517 Unclassified 1924
241 Ga0495630_0155988 3300046517 Bacteria 1738
242 Ga0495666_0003161 3300046526 Bacteria 8288
243 Ga0495652_0000088 3300046529 Bacteria 98865
244 Ga0495652_0023704 3300046529 Bacteria 5439
245 Ga0495652_0045218 3300046529 Bacteria 3787
246 Ga0495665_0003374 3300046531 Bacteria 8667
247 Ga0495665_0061915 3300046531 Bacteria 1976
248 Ga0495665_0136677 3300046531 Bacteria 1282
249 Ga0495640_0006444 3300046533 Bacteria 9280
250 Ga0495586_0004202 3300046535 Bacteria 7714
251 Ga0495587_0000502 3300046536 Bacteria 27283
252 Ga0495587_0030814 3300046536 Bacteria 3251
253 Ga0495587_0477401 3300046536 Bacteria 690
254 Ga0495609_0227390 3300046538 Bacteria 773
255 Ga0495645_0000024 3300046543 Bacteria 125065
256 Ga0495645_0111557 3300046543 Unclassified 1934
257 Ga0495667_0112637 3300046559 Unclassified 1758
258 Ga0495667_0150377 3300046559 Bacteria 1499
259 Ga0495667_0307970 3300046559 Bacteria 1003
260 Ga0495656_0019905 3300046615 Bacteria 2596
261 Ga0495634_0091192 3300046642 Bacteria 1978
262 Ga0495635_0018898 3300046663 Bacteria 4809
263 Ga0495635_0219681 3300046663 Bacteria 1285
264 Ga0495588_0190208 3300046674 Archaea 1084
265 Ga0495599_0000019 3300046678 Bacteria 141108
266 Ga0495599_0040124 3300046678 Bacteria 2940
267 Ga0495599_0043511 3300046678 Bacteria 2818
268 Ga0495599_0109794 3300046678 Bacteria 1718
269 Ga0495623_0000032 3300046679 Bacteria 84435
270 Ga0495646_0001414 3300046680 Bacteria 14283
271 Ga0495646_0056334 3300046680 Bacteria 2357
272 Ga0495646_0083812 3300046680 Bacteria 1852
273 Ga0495647_0001014 3300046681 Bacteria 8554
274 Ga0495647_0029767 3300046681 Bacteria 2021
275 Ga0495647_0052971 3300046681 Bacteria 1581
276 Ga0495647_0147216 3300046681 Bacteria 1008
277 Ga0495658_0003312 3300046683 Bacteria 7996
278 Ga0495658_0019711 3300046683 Bacteria 3525
279 Ga0495658_0088067 3300046683 Bacteria 1834
280 Ga0495658_0209941 3300046683 Archaea 1216
281 Ga0495613_0051740 3300046689 Bacteria 3026
282 Ga0495613_0056129 3300046689 Bacteria 2892
283 Ga0495613_0349290 3300046689 Unclassified 1016
284 Ga0495613_0875500 3300046689 Unclassified 582
285 Ga0495624_0010665 3300046690 Bacteria 6329
286 Ga0495624_0017657 3300046690 Bacteria 4784
287 Ga0495624_0036974 3300046690 Bacteria 3143
288 Ga0495624_0190265 3300046690 Bacteria 1248
289 Ga0495600_0145994 3300046809 Bacteria 1533
290 Ga0495600_0456532 3300046809 Bacteria 789
291 Ga0495581_0003695 3300047315 Bacteria 8812
292 Ga0495581_0107012 3300047315 Bacteria 1625
293 Ga0495581_0434870 3300047315 Bacteria 764
294 Ga0495604_0000476 3300047317 Bacteria 35284
295 Ga0495604_0047344 3300047317 Bacteria 3349
296 Ga0495604_0102834 3300047317 Bacteria 2097
297 Ga0495674_0122532 3300047319 Bacteria 2196
298 Ga0495674_0134404 3300047319 Bacteria 2082
299 Ga0495674_0204038 3300047319 Unclassified 1639
300 Ga0495674_0757531 3300047319 Bacteria 758
301 Ga0495676_0143264 3300047321 Unclassified 1710
302 Ga0495676_0373036 3300047321 Bacteria 950
303 Ga0495676_0456318 3300047321 Bacteria 842
304 Ga0495676_0491455 3300047321 Unclassified 806
305 Ga0495680_0023823 3300047322 Bacteria 5086
306 Ga0495680_0048947 3300047322 Bacteria 3315
307 Ga0495680_0059742 3300047322 Bacteria 2941
308 Ga0495680_0351344 3300047322 Unclassified 1026
309 Ga0495675_0000007 3300047444 Bacteria 162640
310 Ga0495675_0129245 3300047444 Bacteria 1571
311 Ga0495684_0066473 3300047471 Bacteria 2741
312 Ga0495684_0178781 3300047471 Bacteria 1574
313 Ga0495593_0008235 3300047673 Bacteria 6065
314 Ga0495602_0000246 3300048088 Bacteria 50728
315 Ga0495602_0146820 3300048088 Bacteria 1859
316 Ga0495602_0167844 3300048088 Bacteria 1706
317 Ga0495614_0000678 3300048089 Bacteria 14326
318 Ga0495614_0091767 3300048089 Bacteria 1322
319 Ga0496100_0036846 3300048903 Bacteria 3088
320 Ga0496100_0250343 3300048903 Unclassified 1310
321 Ga0496101_0040024 3300048904 Bacteria 3337
322 Ga0496101_0606500 3300048904 Bacteria 865
323 Ga0496101_0672885 3300048904 Bacteria 817
324 Ga0496102_0035747 3300048905 Bacteria 4473
325 Ga0496102_0938840 3300048905 Bacteria 786
326 Ga0496103_0022071 3300048906 Bacteria 3831
327 Ga0496104_0068829 3300048907 Bacteria 3363
328 Ga0496104_0200515 3300048907 Unclassified 1907
329 Ga0496105_0019052 3300048908 Bacteria 5530
330 Ga0496105_0172537 3300048908 Unclassified 1772
331 Ga0496106_0001780 3300048909 Bacteria 16082
332 Ga0496106_0006450 3300048909 Bacteria 8686
333 Ga0496106_0192624 3300048909 Bacteria 1621
334 Ga0496107_0003441 3300048910 Bacteria 10574
335 Ga0496107_0018842 3300048910 Bacteria 4865
336 Ga0496107_0277904 3300048910 Bacteria 1247
337 Ga0496110_0007895 3300048913 Bacteria 8522
338 Ga0496111_0037728 3300048914 Bacteria 3459
339 Ga0496112_0633474 3300048915 Bacteria 1000
340 Ga0496113_0016018 3300048916 Bacteria 5171
341 Ga0496113_0176337 3300048916 Bacteria 1694
342 Ga0496114_0029756 3300048917 Bacteria 4489
343 Ga0496114_0069187 3300048917 Bacteria 2964
344 Ga0496115_0050995 3300048918 Bacteria 3317
345 Ga0496115_0147718 3300048918 Bacteria 1940
346 Ga0496115_0285093 3300048918 Unclassified 1355
347 Ga0496115_0387028 3300048918 Bacteria 1136
348 Ga0501047_0138390 3300049581 Bacteria 2314
349 Ga0501070_0063808 3300049586 Bacteria 3051
350 Ga0501074_0076732 3300049590 Bacteria 2398
351 Ga0501080_0099025 3300049742 Bacteria 2705
352 Ga0501083_0036819 3300049744 Bacteria 3335
353 nmdc:mga0n895_751448_c1 3300050512 Unclassified 968
354 Ga0495601_0000325 3300053077 Bacteria 25289
355 Ga0495601_0015727 3300053077 Bacteria 4576
356 Ga0495601_0033085 3300053077 Bacteria 3220
357 Ga0495601_0110580 3300053077 Bacteria 1779
358 Ga0495601_0288309 3300053077 Unclassified 1070
359 Ga0495612_0021067 3300053078 Bacteria 2615
360 Ga0495595_0050929 3300053084 Bacteria 1918
361 Ga0495619_0001347 3300053085 Bacteria 16107
362 Ga0495619_0022729 3300053085 Bacteria 4015
363 Ga0495619_0229019 3300053085 Bacteria 1287
364 Ga0495619_0565479 3300053085 Unclassified 779
365 Ga0500566_0238654 3300053094 Bacteria 892
366 Ga0500566_0319072 3300053094 Bacteria 724
367 Ga0466962_0008095 3300061719 Bacteria 5040
368 Ga0466962_0009007 3300061719 Bacteria 4780
369 Ga0466962_0070670 3300061719 Bacteria 1668
370 Ga0466962_0558215 3300061719 Bacteria 582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005545 Ga0070695_100313138 Ga0070695_1003131382 155
2 3300049581 Ga0501047_0138390 Ga0501047_0138390_1095_1589 156
3 3300049586 Ga0501070_0063808 Ga0501070_0063808_2363_2857 156
4 3300049590 Ga0501074_0076732 Ga0501074_0076732_62_556 156
5 3300049742 Ga0501080_0099025 Ga0501080_0099025_1698_2192 156
6 3300049744 Ga0501083_0036819 Ga0501083_0036819_67_561 156
7 3300005471 Ga0070698_100155192 Ga0070698_1001551924 158
8 3300005435 Ga0070714_100539050 Ga0070714_1005390502 160
9 3300005445 Ga0070708_100068113 Ga0070708_1000681136 160
10 3300005445 Ga0070708_100964383 Ga0070708_1009643832 160
11 3300005468 Ga0070707_100604635 Ga0070707_1006046352 160
12 3300005471 Ga0070698_100322079 Ga0070698_1003220792 160
13 3300005530 Ga0070679_100192536 Ga0070679_1001925363 160
14 3300006028 Ga0070717_10592961 Ga0070717_105929611 160
15 3300010375 Ga0105239_12821003 Ga0105239_128210031 160
16 3300014497 Ga0182008_10071147 Ga0182008_100711472 160
17 3300014497 Ga0182008_10072394 Ga0182008_100723942 160
18 3300044706 Ga0466964_0433836 Ga0466964_0433836_155_649 160
19 3300045976 Ga0466967_0182389 Ga0466967_0182389_1258_1752 160
20 3300045976 Ga0466967_1237749 Ga0466967_1237749_181_672 160
21 3300048905 Ga0496102_0938840 Ga0496102_0938840_28_531 160
22 3300048909 Ga0496106_0006450 Ga0496106_0006450_6327_6830 160
23 3300048910 Ga0496107_0003441 Ga0496107_0003441_6076_6579 160
24 3300048916 Ga0496113_0176337 Ga0496113_0176337_156_659 160
25 3300046536 Ga0495587_0030814 Ga0495587_0030814_318_818 162
26 3300046559 Ga0495667_0307970 Ga0495667_0307970_491_991 162
27 3300005435 Ga0070714_100035861 Ga0070714_1000358613 163
28 3300006028 Ga0070717_10043531 Ga0070717_100435311 163
29 3300006175 Ga0070712_100353117 Ga0070712_1003531171 163
30 3300046476 Ga0495662_0153520 Ga0495662_0153520_620_1111 163
31 3300046517 Ga0495630_0128412 Ga0495630_0128412_46_537 163
32 3300046680 Ga0495646_0056334 Ga0495646_0056334_117_608 163
33 3300005435 Ga0070714_100394213 Ga0070714_1003942132 164
34 3300005436 Ga0070713_100116874 Ga0070713_1001168743 164
35 3300005455 Ga0070663_100054413 Ga0070663_1000544132 164
36 3300005458 Ga0070681_10576323 Ga0070681_105763232 164
37 3300005530 Ga0070679_100428573 Ga0070679_1004285731 164
38 3300005546 Ga0070696_100124776 Ga0070696_1001247762 164
39 3300005547 Ga0070693_100050221 Ga0070693_1000502213 164
40 3300005840 Ga0068870_10245750 Ga0068870_102457502 164
41 3300006163 Ga0070715_10007610 Ga0070715_100076103 164
42 3300006173 Ga0070716_100020064 Ga0070716_1000200642 164
43 3300006175 Ga0070712_100219849 Ga0070712_1002198491 164
44 3300006237 Ga0097621_100010449 Ga0097621_1000104495 164
45 3300006358 Ga0068871_100159998 Ga0068871_1001599983 164
46 3300006871 Ga0075434_101121287 Ga0075434_1011212871 164
47 3300009174 Ga0105241_10050531 Ga0105241_100505312 164
48 3300014969 Ga0157376_10015770 Ga0157376_100157702 164
49 3300025906 Ga0207699_10037857 Ga0207699_100378575 164
50 3300025911 Ga0207654_10031463 Ga0207654_100314632 164
51 3300025915 Ga0207693_10012860 Ga0207693_100128606 164
52 3300025916 Ga0207663_10070485 Ga0207663_100704853 164
53 3300025916 Ga0207663_10073154 Ga0207663_100731543 164
54 3300025928 Ga0207700_10035208 Ga0207700_100352082 164
55 3300025929 Ga0207664_10029088 Ga0207664_100290888 164
56 3300025929 Ga0207664_10049033 Ga0207664_100490333 164
57 3300025939 Ga0207665_10002447 Ga0207665_100024478 164
58 3300025939 Ga0207665_10193754 Ga0207665_101937541 164
59 3300026067 Ga0207678_10007890 Ga0207678_100078902 164
60 3300026118 Ga0207675_100007354 Ga0207675_1000073542 164
61 3300026121 Ga0207683_10004201 Ga0207683_1000420116 164
62 3300034818 Ga0373950_0006092 Ga0373950_0006092_354_884 164
63 3300034819 Ga0373958_0024907 Ga0373958_0024907_179_709 164
64 3300034957 Ga0373938_0014578 Ga0373938_0014578_679_1209 164
65 3300035085 Ga0373929_0028232 Ga0373929_0028232_506_1036 164
66 3300035115 Ga0373941_0006525 Ga0373941_0006525_2135_2665 164
67 3300035170 Ga0373943_0217194 Ga0373943_0217194_342_866 164
68 3300035691 Ga0373931_0042229 Ga0373931_0042229_1520_2050 164
69 3300037068 Ga0373925_0052040 Ga0373925_0052040_287_811 164
70 3300037312 Ga0395899_0454025 Ga0395899_0454025_280_804 164
71 3300037466 Ga0395898_0542394 Ga0395898_0542394_223_747 164
72 3300037471 Ga0395905_0139019 Ga0395905_0139019_1622_2146 164
73 3300038443 Ga0395901_0088887 Ga0395901_0088887_1122_1646 164
74 3300046462 Ga0495651_0044484 Ga0495651_0044484_521_1027 164
75 3300046473 Ga0495582_0113451 Ga0495582_0113451_135_659 164
76 3300046477 Ga0495664_0029420 Ga0495664_0029420_947_1453 164
77 3300046516 Ga0495628_0026160 Ga0495628_0026160_1555_2061 164
78 3300046529 Ga0495652_0045218 Ga0495652_0045218_2570_3076 164
79 3300046531 Ga0495665_0061915 Ga0495665_0061915_511_1035 164
80 3300046678 Ga0495599_0109794 Ga0495599_0109794_96_602 164
81 3300046683 Ga0495658_0019711 Ga0495658_0019711_576_1100 164
82 3300046689 Ga0495613_0349290 Ga0495613_0349290_67_591 164
83 3300046690 Ga0495624_0190265 Ga0495624_0190265_494_1018 164
84 3300046809 Ga0495600_0456532 Ga0495600_0456532_259_765 164
85 3300047315 Ga0495581_0003695 Ga0495581_0003695_5022_5546 164
86 3300047317 Ga0495604_0102834 Ga0495604_0102834_1188_1694 164
87 3300047319 Ga0495674_0122532 Ga0495674_0122532_872_1378 164
88 3300047321 Ga0495676_0143264 Ga0495676_0143264_1081_1605 164
89 3300047322 Ga0495680_0048947 Ga0495680_0048947_253_759 164
90 3300047471 Ga0495684_0178781 Ga0495684_0178781_350_856 164
91 3300048088 Ga0495602_0167844 Ga0495602_0167844_975_1481 164
92 3300048904 Ga0496101_0672885 Ga0496101_0672885_96_626 164
93 3300048908 Ga0496105_0019052 Ga0496105_0019052_4912_5442 164
94 3300048909 Ga0496106_0192624 Ga0496106_0192624_640_1170 164
95 3300048918 Ga0496115_0147718 Ga0496115_0147718_301_831 164
96 3300050512 nmdc:mga0n895_751448_c1 nmdc:mga0n895_751448_c1_249_779 164
97 3300053077 Ga0495601_0033085 Ga0495601_0033085_1574_2080 164
98 3300053084 Ga0495595_0050929 Ga0495595_0050929_1129_1635 164
99 3300005445 Ga0070708_100271488 Ga0070708_1002714883 165
100 3300006028 Ga0070717_10228488 Ga0070717_102284884 165
101 3300038443 Ga0395901_0372881 Ga0395901_0372881_112_660 165
102 3300046463 Ga0495653_0158275 Ga0495653_0158275_119_616 165
103 3300046511 Ga0495608_0332971 Ga0495608_0332971_318_815 165
104 3300046559 Ga0495667_0150377 Ga0495667_0150377_185_682 165
105 3300048089 Ga0495614_0091767 Ga0495614_0091767_113_664 165
106 3300053085 Ga0495619_0565479 Ga0495619_0565479_71_568 165
107 3300005435 Ga0070714_100036286 Ga0070714_1000362863 166
108 3300005436 Ga0070713_100072102 Ga0070713_1000721022 166
109 3300005440 Ga0070705_100840934 Ga0070705_1008409342 166
110 3300005467 Ga0070706_101021822 Ga0070706_1010218222 166
111 3300005563 Ga0068855_101161094 Ga0068855_1011610942 166
112 3300006028 Ga0070717_10008104 Ga0070717_1000810410 166
113 3300009098 Ga0105245_10895335 Ga0105245_108953352 166
114 3300025922 Ga0207646_10002759 Ga0207646_1000275911 166
115 3300025928 Ga0207700_10305097 Ga0207700_103050972 166
116 3300025929 Ga0207664_10022929 Ga0207664_100229298 166
117 3300025929 Ga0207664_10178797 Ga0207664_101787972 166
118 3300035083 Ga0373926_0005523 Ga0373926_0005523_1969_2469 166
119 3300035089 Ga0373944_0027607 Ga0373944_0027607_169_669 166
120 3300035113 Ga0373936_0196020 Ga0373936_0196020_206_706 166
121 3300035116 Ga0373945_0022615 Ga0373945_0022615_1206_1706 166
122 3300035117 Ga0373953_0136917 Ga0373953_0136917_48_548 166
123 3300035120 Ga0373957_0263574 Ga0373957_0263574_170_670 166
124 3300035170 Ga0373943_0001283 Ga0373943_0001283_10442_10942 166
125 3300035172 Ga0373955_0536086 Ga0373955_0536086_17_517 166
126 3300035724 Ga0373933_0088007 Ga0373933_0088007_598_1098 166
127 3300035725 Ga0373947_0002113 Ga0373947_0002113_7494_7994 166
128 3300036401 Ga0373937_0001058 Ga0373937_0001058_10988_11488 166
129 3300036401 Ga0373937_0144659 Ga0373937_0144659_1052_1552 166
130 3300037068 Ga0373925_0001501 Ga0373925_0001501_15773_16273 166
131 3300037312 Ga0395899_0351799 Ga0395899_0351799_151_651 166
132 3300037466 Ga0395898_0027064 Ga0395898_0027064_2693_3193 166
133 3300037471 Ga0395905_0367710 Ga0395905_0367710_725_1225 166
134 3300038443 Ga0395901_0385734 Ga0395901_0385734_262_762 166
135 3300044693 Ga0466961_0117730 Ga0466961_0117730_177_677 166
136 3300044694 Ga0466963_0002423 Ga0466963_0002423_5186_5686 166
137 3300044694 Ga0466963_0003165 Ga0466963_0003165_6558_7058 166
138 3300044694 Ga0466963_0007554 Ga0466963_0007554_2933_3433 166
139 3300044694 Ga0466963_0021168 Ga0466963_0021168_2213_2713 166
140 3300044694 Ga0466963_0058181 Ga0466963_0058181_1343_1843 166
141 3300044694 Ga0466963_0113320 Ga0466963_0113320_266_766 166
142 3300044694 Ga0466963_0116537 Ga0466963_0116537_679_1179 166
143 3300044706 Ga0466964_0016278 Ga0466964_0016278_1523_2023 166
144 3300044706 Ga0466964_0068935 Ga0466964_0068935_717_1217 166
145 3300044706 Ga0466964_0131827 Ga0466964_0131827_520_1020 166
146 3300044719 Ga0466971_0003143 Ga0466971_0003143_3493_3993 166
147 3300044735 Ga0466968_0000933 Ga0466968_0000933_6437_6937 166
148 3300044735 Ga0466968_0077786 Ga0466968_0077786_522_1022 166
149 3300044842 Ga0466957_0007794 Ga0466957_0007794_4282_4782 166
150 3300044842 Ga0466957_0015797 Ga0466957_0015797_2941_3441 166
151 3300044842 Ga0466957_0070027 Ga0466957_0070027_255_755 166
152 3300044842 Ga0466957_0403638 Ga0466957_0403638_156_656 166
153 3300044901 Ga0466960_0016180 Ga0466960_0016180_2531_3031 166
154 3300044901 Ga0466960_0382690 Ga0466960_0382690_186_686 166
155 3300045049 Ga0466959_0061306 Ga0466959_0061306_998_1498 166
156 3300045836 Ga0466958_0001480 Ga0466958_0001480_2960_3460 166
157 3300045836 Ga0466958_0026124 Ga0466958_0026124_1494_1994 166
158 3300045836 Ga0466958_0057280 Ga0466958_0057280_1314_1814 166
159 3300045976 Ga0466967_0005380 Ga0466967_0005380_5265_5765 166
160 3300045976 Ga0466967_0008400 Ga0466967_0008400_2827_3327 166
161 3300045976 Ga0466967_0041841 Ga0466967_0041841_1106_1606 166
162 3300045976 Ga0466967_0042266 Ga0466967_0042266_3132_3632 166
163 3300045976 Ga0466967_0135873 Ga0466967_0135873_1338_1838 166
164 3300045976 Ga0466967_0201238 Ga0466967_0201238_1140_1640 166
165 3300045976 Ga0466967_0214599 Ga0466967_0214599_892_1392 166
166 3300045976 Ga0466967_0276952 Ga0466967_0276952_889_1389 166
167 3300045976 Ga0466967_0291016 Ga0466967_0291016_17_517 166
168 3300045976 Ga0466967_0477723 Ga0466967_0477723_44_544 166
169 3300046454 Ga0495592_0000037 Ga0495592_0000037_11760_12260 166
170 3300046454 Ga0495592_0051471 Ga0495592_0051471_644_1144 166
171 3300046454 Ga0495592_0132620 Ga0495592_0132620_1074_1574 166
172 3300046459 Ga0495629_0130778 Ga0495629_0130778_825_1325 166
173 3300046461 Ga0495641_0005407 Ga0495641_0005407_4018_4518 166
174 3300046461 Ga0495641_0010174 Ga0495641_0010174_2673_3173 166
175 3300046461 Ga0495641_0144805 Ga0495641_0144805_313_813 166
176 3300046462 Ga0495651_0000038 Ga0495651_0000038_83579_84079 166
177 3300046463 Ga0495653_0004001 Ga0495653_0004001_2050_2550 166
178 3300046463 Ga0495653_0025614 Ga0495653_0025614_2742_3242 166
179 3300046472 Ga0495580_0033594 Ga0495580_0033594_1824_2324 166
180 3300046473 Ga0495582_0040361 Ga0495582_0040361_262_762 166
181 3300046473 Ga0495582_0415546 Ga0495582_0415546_127_636 166
182 3300046475 Ga0495639_0000977 Ga0495639_0000977_134_634 166
183 3300046476 Ga0495662_0047065 Ga0495662_0047065_40_540 166
184 3300046477 Ga0495664_0014004 Ga0495664_0014004_363_863 166
185 3300046477 Ga0495664_0085758 Ga0495664_0085758_1213_1713 166
186 3300046491 Ga0495584_0037377 Ga0495584_0037377_391_891 166
187 3300046511 Ga0495608_0001032 Ga0495608_0001032_6029_6529 166
188 3300046511 Ga0495608_0478683 Ga0495608_0478683_34_534 166
189 3300046514 Ga0495618_0001122 Ga0495618_0001122_11756_12256 166
190 3300046514 Ga0495618_0028699 Ga0495618_0028699_2742_3242 166
191 3300046514 Ga0495618_0694891 Ga0495618_0694891_87_587 166
192 3300046516 Ga0495628_0000025 Ga0495628_0000025_71517_72017 166
193 3300046516 Ga0495628_0129262 Ga0495628_0129262_958_1458 166
194 3300046516 Ga0495628_0240421 Ga0495628_0240421_495_995 166
195 3300046517 Ga0495630_0034774 Ga0495630_0034774_983_1483 166
196 3300046517 Ga0495630_0155988 Ga0495630_0155988_947_1447 166
197 3300046526 Ga0495666_0003161 Ga0495666_0003161_3844_4344 166
198 3300046529 Ga0495652_0000088 Ga0495652_0000088_83599_84099 166
199 3300046529 Ga0495652_0023704 Ga0495652_0023704_1901_2401 166
200 3300046531 Ga0495665_0003374 Ga0495665_0003374_4043_4543 166
201 3300046531 Ga0495665_0136677 Ga0495665_0136677_671_1171 166
202 3300046533 Ga0495640_0006444 Ga0495640_0006444_1396_1896 166
203 3300046535 Ga0495586_0004202 Ga0495586_0004202_4473_4973 166
204 3300046536 Ga0495587_0000502 Ga0495587_0000502_15026_15526 166
205 3300046536 Ga0495587_0477401 Ga0495587_0477401_154_654 166
206 3300046538 Ga0495609_0227390 Ga0495609_0227390_205_705 166
207 3300046543 Ga0495645_0000024 Ga0495645_0000024_83574_84074 166
208 3300046543 Ga0495645_0111557 Ga0495645_0111557_1150_1650 166
209 3300046559 Ga0495667_0112637 Ga0495667_0112637_647_1147 166
210 3300046615 Ga0495656_0019905 Ga0495656_0019905_986_1486 166
211 3300046642 Ga0495634_0091192 Ga0495634_0091192_731_1231 166
212 3300046663 Ga0495635_0018898 Ga0495635_0018898_363_863 166
213 3300046663 Ga0495635_0219681 Ga0495635_0219681_735_1235 166
214 3300046678 Ga0495599_0000019 Ga0495599_0000019_69459_69959 166
215 3300046678 Ga0495599_0040124 Ga0495599_0040124_894_1394 166
216 3300046678 Ga0495599_0043511 Ga0495599_0043511_1132_1632 166
217 3300046679 Ga0495623_0000032 Ga0495623_0000032_37180_37680 166
218 3300046680 Ga0495646_0001414 Ga0495646_0001414_1601_2101 166
219 3300046680 Ga0495646_0083812 Ga0495646_0083812_520_1020 166
220 3300046681 Ga0495647_0001014 Ga0495647_0001014_3940_4440 166
221 3300046681 Ga0495647_0029767 Ga0495647_0029767_1400_1900 166
222 3300046681 Ga0495647_0052971 Ga0495647_0052971_223_723 166
223 3300046683 Ga0495658_0003312 Ga0495658_0003312_3557_4057 166
224 3300046683 Ga0495658_0088067 Ga0495658_0088067_940_1440 166
225 3300046689 Ga0495613_0051740 Ga0495613_0051740_170_670 166
226 3300046689 Ga0495613_0056129 Ga0495613_0056129_517_1017 166
227 3300046689 Ga0495613_0875500 Ga0495613_0875500_18_518 166
228 3300046690 Ga0495624_0010665 Ga0495624_0010665_4477_4977 166
229 3300046690 Ga0495624_0017657 Ga0495624_0017657_1543_2043 166
230 3300046809 Ga0495600_0145994 Ga0495600_0145994_466_966 166
231 3300047315 Ga0495581_0107012 Ga0495581_0107012_122_622 166
232 3300047315 Ga0495581_0434870 Ga0495581_0434870_42_542 166
233 3300047317 Ga0495604_0000476 Ga0495604_0000476_20017_20517 166
234 3300047317 Ga0495604_0047344 Ga0495604_0047344_1131_1631 166
235 3300047319 Ga0495674_0134404 Ga0495674_0134404_904_1404 166
236 3300047319 Ga0495674_0204038 Ga0495674_0204038_967_1467 166
237 3300047319 Ga0495674_0757531 Ga0495674_0757531_182_682 166
238 3300047321 Ga0495676_0373036 Ga0495676_0373036_355_855 166
239 3300047321 Ga0495676_0456318 Ga0495676_0456318_170_670 166
240 3300047321 Ga0495676_0491455 Ga0495676_0491455_11_511 166
241 3300047322 Ga0495680_0023823 Ga0495680_0023823_1675_2175 166
242 3300047322 Ga0495680_0059742 Ga0495680_0059742_1244_1744 166
243 3300047444 Ga0495675_0000007 Ga0495675_0000007_78562_79062 166
244 3300047444 Ga0495675_0129245 Ga0495675_0129245_960_1460 166
245 3300047471 Ga0495684_0066473 Ga0495684_0066473_1449_1949 166
246 3300047673 Ga0495593_0008235 Ga0495593_0008235_1543_2043 166
247 3300048088 Ga0495602_0000246 Ga0495602_0000246_37191_37691 166
248 3300048088 Ga0495602_0146820 Ga0495602_0146820_197_697 166
249 3300048089 Ga0495614_0000678 Ga0495614_0000678_10094_10594 166
250 3300048918 Ga0496115_0387028 Ga0496115_0387028_296_796 166
251 3300053077 Ga0495601_0000325 Ga0495601_0000325_11754_12254 166
252 3300053077 Ga0495601_0015727 Ga0495601_0015727_583_1083 166
253 3300053077 Ga0495601_0110580 Ga0495601_0110580_1122_1622 166
254 3300053077 Ga0495601_0288309 Ga0495601_0288309_171_671 166
255 3300053078 Ga0495612_0021067 Ga0495612_0021067_1125_1625 166
256 3300053085 Ga0495619_0001347 Ga0495619_0001347_13055_13555 166
257 3300053085 Ga0495619_0022729 Ga0495619_0022729_3504_4004 166
258 3300053085 Ga0495619_0229019 Ga0495619_0229019_420_920 166
259 3300053094 Ga0500566_0238654 Ga0500566_0238654_52_552 166
260 3300053094 Ga0500566_0319072 Ga0500566_0319072_152_652 166
261 3300061719 Ga0466962_0008095 Ga0466962_0008095_604_1104 166
262 3300005355 Ga0070671_100123757 Ga0070671_1001237573 167
263 3300005366 Ga0070659_100190088 Ga0070659_1001900883 167
264 3300005434 Ga0070709_10042207 Ga0070709_100422072 167
265 3300005434 Ga0070709_10307347 Ga0070709_103073472 167
266 3300005435 Ga0070714_100021527 Ga0070714_1000215276 167
267 3300005435 Ga0070714_100038130 Ga0070714_1000381305 167
268 3300005435 Ga0070714_100080725 Ga0070714_1000807255 167
269 3300005436 Ga0070713_100013333 Ga0070713_1000133333 167
270 3300005436 Ga0070713_100141428 Ga0070713_1001414281 167
271 3300005437 Ga0070710_10049927 Ga0070710_100499271 167
272 3300005437 Ga0070710_10060396 Ga0070710_100603965 167
273 3300005439 Ga0070711_100031738 Ga0070711_1000317383 167
274 3300005439 Ga0070711_100109193 Ga0070711_1001091934 167
275 3300005445 Ga0070708_100521086 Ga0070708_1005210862 167
276 3300005457 Ga0070662_101255757 Ga0070662_1012557571 167
277 3300005467 Ga0070706_100653673 Ga0070706_1006536733 167
278 3300005471 Ga0070698_100062011 Ga0070698_1000620113 167
279 3300005530 Ga0070679_100116057 Ga0070679_1001160573 167
280 3300005544 Ga0070686_100648182 Ga0070686_1006481821 167
281 3300005547 Ga0070693_100184236 Ga0070693_1001842363 167
282 3300005549 Ga0070704_100117866 Ga0070704_1001178664 167
283 3300005614 Ga0068856_100045467 Ga0068856_1000454673 167
284 3300006028 Ga0070717_10051688 Ga0070717_100516883 167
285 3300006028 Ga0070717_10165035 Ga0070717_101650352 167
286 3300006163 Ga0070715_10004504 Ga0070715_100045047 167
287 3300006173 Ga0070716_100055187 Ga0070716_1000551872 167
288 3300006173 Ga0070716_100061430 Ga0070716_1000614302 167
289 3300006175 Ga0070712_100036396 Ga0070712_1000363963 167
290 3300006175 Ga0070712_100091111 Ga0070712_1000911111 167
291 3300006358 Ga0068871_101073439 Ga0068871_1010734392 167
292 3300009098 Ga0105245_10234205 Ga0105245_102342053 167
293 3300009101 Ga0105247_10124108 Ga0105247_101241081 167
294 3300013104 Ga0157370_10521539 Ga0157370_105215391 167
295 3300013296 Ga0157374_10041104 Ga0157374_100411044 167
296 3300013307 Ga0157372_10231608 Ga0157372_102316083 167
297 3300014325 Ga0163163_10523382 Ga0163163_105233822 167
298 3300014968 Ga0157379_10074183 Ga0157379_100741835 167
299 3300014968 Ga0157379_11226539 Ga0157379_112265391 167
300 3300020070 Ga0206356_11815991 Ga0206356_118159911 167
301 3300022467 Ga0224712_10004092 Ga0224712_100040923 167
302 3300025898 Ga0207692_10029445 Ga0207692_100294455 167
303 3300025900 Ga0207710_10064493 Ga0207710_100644931 167
304 3300025906 Ga0207699_10007837 Ga0207699_100078373 167
305 3300025909 Ga0207705_10186512 Ga0207705_101865123 167
306 3300025912 Ga0207707_10089996 Ga0207707_100899962 167
307 3300025915 Ga0207693_10006140 Ga0207693_1000614012 167
308 3300025915 Ga0207693_10045089 Ga0207693_100450897 167
309 3300025916 Ga0207663_10002700 Ga0207663_100027009 167
310 3300025916 Ga0207663_10110221 Ga0207663_101102212 167
311 3300025917 Ga0207660_10138895 Ga0207660_101388955 167
312 3300025919 Ga0207657_10002847 Ga0207657_1000284712 167
313 3300025928 Ga0207700_10508834 Ga0207700_105088343 167
314 3300025929 Ga0207664_10033418 Ga0207664_100334183 167
315 3300025929 Ga0207664_10406886 Ga0207664_104068863 167
316 3300025931 Ga0207644_10138772 Ga0207644_101387725 167
317 3300025939 Ga0207665_10002480 Ga0207665_1000248010 167
318 3300025942 Ga0207689_11259169 Ga0207689_112591691 167
319 3300035086 Ga0373934_0255391 Ga0373934_0255391_21_524 167
320 3300035170 Ga0373943_0529906 Ga0373943_0529906_133_636 167
321 3300036401 Ga0373937_0221016 Ga0373937_0221016_228_731 167
322 3300044658 Ga0466972_0290737 Ga0466972_0290737_217_720 167
323 3300044684 Ga0466966_0194753 Ga0466966_0194753_12_515 167
324 3300044684 Ga0466966_0489775 Ga0466966_0489775_172_675 167
325 3300044693 Ga0466961_0007503 Ga0466961_0007503_6228_6731 167
326 3300044693 Ga0466961_0392810 Ga0466961_0392810_324_827 167
327 3300044694 Ga0466963_0001805 Ga0466963_0001805_10882_11385 167
328 3300044694 Ga0466963_0003006 Ga0466963_0003006_7863_8366 167
329 3300044706 Ga0466964_0019105 Ga0466964_0019105_1349_1852 167
330 3300044706 Ga0466964_0129313 Ga0466964_0129313_438_941 167
331 3300044735 Ga0466968_0212510 Ga0466968_0212510_105_653 167
332 3300044765 Ga0466970_0020911 Ga0466970_0020911_884_1387 167
333 3300044842 Ga0466957_0021942 Ga0466957_0021942_1030_1533 167
334 3300045049 Ga0466959_0003272 Ga0466959_0003272_1227_1730 167
335 3300045836 Ga0466958_0006546 Ga0466958_0006546_3903_4406 167
336 3300045836 Ga0466958_0081027 Ga0466958_0081027_768_1271 167
337 3300045976 Ga0466967_0009935 Ga0466967_0009935_142_645 167
338 3300045976 Ga0466967_0034228 Ga0466967_0034228_1117_1620 167
339 3300045976 Ga0466967_0118967 Ga0466967_0118967_165_668 167
340 3300046455 Ga0495603_0008076 Ga0495603_0008076_2772_3275 167
341 3300046463 Ga0495653_0047002 Ga0495653_0047002_1885_2388 167
342 3300046511 Ga0495608_0009021 Ga0495608_0009021_1652_2155 167
343 3300046674 Ga0495588_0190208 Ga0495588_0190208_251_754 167
344 3300046681 Ga0495647_0147216 Ga0495647_0147216_145_648 167
345 3300046683 Ga0495658_0209941 Ga0495658_0209941_128_631 167
346 3300046690 Ga0495624_0036974 Ga0495624_0036974_425_928 167
347 3300047322 Ga0495680_0351344 Ga0495680_0351344_372_875 167
348 3300048903 Ga0496100_0036846 Ga0496100_0036846_1409_1912 167
349 3300048903 Ga0496100_0250343 Ga0496100_0250343_353_856 167
350 3300048904 Ga0496101_0040024 Ga0496101_0040024_527_1030 167
351 3300048904 Ga0496101_0606500 Ga0496101_0606500_100_603 167
352 3300048905 Ga0496102_0035747 Ga0496102_0035747_2885_3388 167
353 3300048906 Ga0496103_0022071 Ga0496103_0022071_1706_2209 167
354 3300048907 Ga0496104_0068829 Ga0496104_0068829_508_1011 167
355 3300048907 Ga0496104_0200515 Ga0496104_0200515_493_996 167
356 3300048908 Ga0496105_0172537 Ga0496105_0172537_114_617 167
357 3300048909 Ga0496106_0001780 Ga0496106_0001780_1637_2140 167
358 3300048910 Ga0496107_0018842 Ga0496107_0018842_3356_3859 167
359 3300048910 Ga0496107_0277904 Ga0496107_0277904_520_1023 167
360 3300048913 Ga0496110_0007895 Ga0496110_0007895_2576_3079 167
361 3300048914 Ga0496111_0037728 Ga0496111_0037728_158_661 167
362 3300048915 Ga0496112_0633474 Ga0496112_0633474_246_749 167
363 3300048916 Ga0496113_0016018 Ga0496113_0016018_1835_2338 167
364 3300048917 Ga0496114_0029756 Ga0496114_0029756_3743_4246 167
365 3300048917 Ga0496114_0069187 Ga0496114_0069187_1475_1978 167
366 3300048918 Ga0496115_0050995 Ga0496115_0050995_1177_1680 167
367 3300048918 Ga0496115_0285093 Ga0496115_0285093_798_1301 167
368 3300061719 Ga0466962_0009007 Ga0466962_0009007_2894_3397 167
369 3300061719 Ga0466962_0070670 Ga0466962_0070670_251_754 167
370 3300061719 Ga0466962_0558215 Ga0466962_0558215_49_552 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

8

147

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aaw-assembly1.cif.gz_A s.pneumoniae glmu in complex with an antibacterial inhibitor 0.8383 2 115
3dk5-assembly1.cif.gz_A crystal structure of apo-glmu from mycobacterium tuberculosis 0.8322 2 155
1vic-assembly1.cif.gz_A crystal structure of cmp-kdo synthetase 0.8247 2 117
2wee-assembly1.cif.gz_A crystal structure of rv0371c from mycobacterium tuberculosis h37rv 0.8239 2 155
2we9-assembly1.cif.gz_A crystal structure of rv0371c from mycobacterium tuberculosis h37rv 0.8078 1 155
ID Description Score Start End Superfamily
af_O06296_2_135_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8402 2 108 3.90.550.10
2weeA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8309 2 150 3.90.550.10
af_Q2FVY4_1_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7916 4 153 3.90.550.10
af_Q46810_2_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.784 1 151 3.90.550.10
af_P9WMN3_2_263_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.78 3 152 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A538IDS0-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.9904 1 96 GO:0016779
AF-A0A538IA21-F1-model_v4 Nucleotidyltransferase family protein 0.9684 2 160 GO:0016779
AF-A0A538F2W8-F1-model_v4 Nucleotidyltransferase family protein 0.9647 2 160 GO:0016779
AF-A0A7M2Z016-F1-model_v4 Putative MobA-related protein 0.964 2 160 GO:0016779
AF-A0A538M2P6-F1-model_v4 Nucleotidyltransferase family protein 0.9622 2 160 GO:0016779

Feature Viewer

pLDDT pTM Quality
90.12 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map