F425514

General Info

Members Datasets Scaffolds Average Seq Length
370 141 360 275

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0012686|Ga0495606_0012686_2775_3692
Length 305
Sequence MSEKPIYNMIKQTLAALAICAFGAVSCQSKPADKSTTAAPVAANPAPASAVGQQGDAAAILARKQVPIICYHQIRDWKPTDSKNAKDYIVQIAAFKEHIKMLADSGYHTILPDQLYAYLTKGAALPKKPIMLTFDDTDLDQFTIANPTLKKYGFKAVYFVMTVSLGRPHYMTKEQVKQLSDEGNVVASHTWDHHRVDRYSHTSTLKIIGKNGKITNRPVDDWVTQIDKPTKTLEEITGKKMDYFAYPFGIWNKAALPELRKHGFKMAFQLADKRDQTDPLMTVRRILDSGYWSAKTLSNSIRNSF

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
7 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
133 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
139 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 0.54
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.49
Nodule 0
Rhizoplane 0.27
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 5.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009235 3300001904 Bacteria 1629
2 JGI24740J21852_10036041 3300001979 Bacteria 1541
3 JGI24739J22299_10015086 3300001989 Bacteria 2809
4 JGI24739J22299_10032954 3300001989 Bacteria 1778
5 JGI24737J22298_10000742 3300001990 Bacteria 11497
6 JGI24735J21928_10000004 3300002067 Bacteria 381713
7 JGI24735J21928_10009531 3300002067 Bacteria 3115
8 JGI25162J39368_1000017 3300002737 Bacteria 281385
9 JGI25162J39368_1000188 3300002737 Bacteria 64938
10 JGI25157J39369_1007132 3300002741 Bacteria 1636
11 JGI25164J39214_1001352 3300002772 Bacteria 5983
12 JGI25165J46597_1001026 3300003214 Bacteria 18349
13 rootH1_10051843 3300003316 Bacteria 12922
14 rootH2_10017336 3300003320 Bacteria 11789
15 rootH2_10320287 3300003320 Bacteria 2255
16 rootL2_10123691 3300003322 Bacteria 3202
17 rootH1_10012862 3300003323 Bacteria 52977
18 rootH1_10016880 3300003323 Bacteria 64867
19 rootH1_10082703 3300003323 Bacteria 7494
20 rootH1_10153641 3300003323 Bacteria 2795
21 Ga0058863_10515375 3300004799 Bacteria 1926
22 Ga0065714_10005009 3300005288 Bacteria 6404
23 Ga0065714_10069414 3300005288 Unclassified 4239
24 Ga0065714_10076831 3300005288 Bacteria 2750
25 Ga0065714_10080694 3300005288 Unclassified 2389
26 Ga0070658_10006680 3300005327 Bacteria 9348
27 Ga0070658_10031611 3300005327 Bacteria 4251
28 Ga0070658_10050868 3300005327 Bacteria 3358
29 Ga0070658_10086403 3300005327 Bacteria 2580
30 Ga0070658_10192828 3300005327 Bacteria 1718
31 Ga0070658_10438012 3300005327 Bacteria 1125
32 Ga0070683_100015681 3300005329 Bacteria 6663
33 Ga0070683_100627512 3300005329 Bacteria 1029
34 Ga0070680_100003013 3300005336 Bacteria 12502
35 Ga0070680_100138350 3300005336 Bacteria 2041
36 Ga0070680_100163220 3300005336 Bacteria 1872
37 Ga0070680_100172976 3300005336 Unclassified 1818
38 Ga0070680_100350522 3300005336 Bacteria 1255
39 Ga0070682_100276316 3300005337 Bacteria 1222
40 Ga0070660_100004419 3300005339 Bacteria 9716
41 Ga0070660_100021572 3300005339 Bacteria 4752
42 Ga0070660_100033606 3300005339 Bacteria 3867
43 Ga0070660_100059299 3300005339 Bacteria 2968
44 Ga0070660_100242179 3300005339 Bacteria 1469
45 Ga0070669_100392500 3300005353 Bacteria 1134
46 Ga0070659_100000120 3300005366 Bacteria 59172
47 Ga0070659_100000231 3300005366 Bacteria 43452
48 Ga0070659_100003390 3300005366 Bacteria 11346
49 Ga0070659_100012700 3300005366 Bacteria 6249
50 Ga0070659_100071346 3300005366 Bacteria 2761
51 Ga0070667_100164743 3300005367 Bacteria 1955
52 Ga0070663_100012425 3300005455 Bacteria 5386
53 Ga0070678_100574794 3300005456 Bacteria 1003
54 Ga0070681_10042430 3300005458 Bacteria 4558
55 Ga0070681_10042876 3300005458 Bacteria 4533
56 Ga0070681_10062635 3300005458 Bacteria 3693
57 Ga0070681_10080817 3300005458 Bacteria 3206
58 Ga0070679_100000386 3300005530 Bacteria 37602
59 Ga0070679_100002288 3300005530 Bacteria 17307
60 Ga0070679_100064191 3300005530 Bacteria 3660
61 Ga0070679_100081822 3300005530 Bacteria 3218
62 Ga0070679_100118997 3300005530 Bacteria 2626
63 Ga0070679_100231021 3300005530 Unclassified 1809
64 Ga0070684_100009804 3300005535 Bacteria 7563
65 Ga0070684_100012509 3300005535 Bacteria 6806
66 Ga0070684_100066050 3300005535 Bacteria 3176
67 Ga0068853_100099909 3300005539 Bacteria 2564
68 Ga0068853_100131246 3300005539 Bacteria 2243
69 Ga0068853_100310629 3300005539 Bacteria 1459
70 Ga0068853_100504572 3300005539 Bacteria 1142
71 Ga0068855_100000042 3300005563 Bacteria 149332
72 Ga0068855_100000341 3300005563 Bacteria 57937
73 Ga0068855_100000995 3300005563 Bacteria 35281
74 Ga0068855_100001648 3300005563 Bacteria 27984
75 Ga0068855_100014274 3300005563 Bacteria 9568
76 Ga0068855_100086496 3300005563 Bacteria 3625
77 Ga0068855_100135688 3300005563 Bacteria 2808
78 Ga0068855_100136765 3300005563 Bacteria 2795
79 Ga0068855_100142815 3300005563 Bacteria 2727
80 Ga0068855_100159666 3300005563 Bacteria 2560
81 Ga0068857_100007316 3300005577 Bacteria 9511
82 Ga0068857_100023350 3300005577 Bacteria 5443
83 Ga0068854_100035349 3300005578 Bacteria 3496
84 Ga0068854_100046355 3300005578 Bacteria 3095
85 Ga0068854_100409101 3300005578 Unclassified 1124
86 Ga0068856_100000005 3300005614 Bacteria 225505
87 Ga0068856_100000015 3300005614 Bacteria 157353
88 Ga0068856_100174319 3300005614 Bacteria 2163
89 Ga0068852_100003382 3300005616 Bacteria 11138
90 Ga0068852_100246952 3300005616 Bacteria 1708
91 Ga0068858_100121758 3300005842 Bacteria 2440
92 Ga0068860_100013736 3300005843 Bacteria 7941
93 Ga0068860_100045434 3300005843 Bacteria 4188
94 Ga0068862_100024370 3300005844 Bacteria 5076
95 Ga0075366_10000414 3300006195 Bacteria 19952
96 Ga0075366_10001191 3300006195 Bacteria 12894
97 Ga0075366_10056121 3300006195 Bacteria 2339
98 Ga0097621_100020481 3300006237 Bacteria 5096
99 Ga0068871_100039582 3300006358 Bacteria 3773
100 Ga0105240_10000008 3300009093 Bacteria 618862
101 Ga0105240_10000039 3300009093 Bacteria 270117
102 Ga0105240_10000075 3300009093 Bacteria 199596
103 Ga0105240_10009037 3300009093 Bacteria 14151
104 Ga0105240_10028278 3300009093 Bacteria 7324
105 Ga0105240_10074469 3300009093 Bacteria 4191
106 Ga0105240_10129110 3300009093 Bacteria 3034
107 Ga0105240_10201195 3300009093 Bacteria 2334
108 Ga0105240_10572325 3300009093 Bacteria 1247
109 Ga0105241_10005435 3300009174 Bacteria 9424
110 Ga0105241_10049977 3300009174 Bacteria 3186
111 Ga0105241_10058217 3300009174 Bacteria 2967
112 Ga0105241_10097510 3300009174 Bacteria 2331
113 Ga0105241_10115179 3300009174 Unclassified 2157
114 Ga0105237_10000271 3300009545 Bacteria 73094
115 Ga0105237_10000485 3300009545 Bacteria 56664
116 Ga0105237_10001497 3300009545 Bacteria 30756
117 Ga0105237_10006397 3300009545 Bacteria 13072
118 Ga0105237_10158587 3300009545 Bacteria 2260
119 Ga0105237_10158721 3300009545 Bacteria 2259
120 Ga0105238_10147173 3300009551 Bacteria 2331
121 Ga0105238_10345616 3300009551 Bacteria 1476
122 Ga0105238_10430204 3300009551 Bacteria 1315
123 Ga0105249_10605261 3300009553 Bacteria 1151
124 Ga0105239_10000002 3300010375 Bacteria 610298
125 Ga0105239_10000021 3300010375 Bacteria 259369
126 Ga0105239_10000039 3300010375 Bacteria 203537
127 Ga0105239_10001188 3300010375 Bacteria 35645
128 Ga0105239_10001886 3300010375 Bacteria 27399
129 Ga0105239_10005607 3300010375 Bacteria 14674
130 Ga0105239_10005678 3300010375 Bacteria 14583
131 Ga0105239_10006422 3300010375 Bacteria 13644
132 Ga0105239_10029981 3300010375 Bacteria 5983
133 Ga0105239_10044949 3300010375 Bacteria 4841
134 Ga0157373_10000069 3300013100 Bacteria 91687
135 Ga0157373_10000075 3300013100 Bacteria 85818
136 Ga0157373_10003785 3300013100 Bacteria 11442
137 Ga0157373_10031540 3300013100 Bacteria 3815
138 Ga0157373_10052333 3300013100 Bacteria 2906
139 Ga0157371_10000135 3300013102 Bacteria 107607
140 Ga0157371_10002305 3300013102 Bacteria 18368
141 Ga0157371_10002840 3300013102 Bacteria 16187
142 Ga0157371_10005260 3300013102 Bacteria 10976
143 Ga0157371_10006218 3300013102 Bacteria 9898
144 Ga0157371_10007042 3300013102 Bacteria 9150
145 Ga0157371_10016895 3300013102 Bacteria 5434
146 Ga0157371_10050573 3300013102 Bacteria 2953
147 Ga0157371_10053676 3300013102 Bacteria 2862
148 Ga0157371_10061653 3300013102 Bacteria 2659
149 Ga0157371_10071472 3300013102 Bacteria 2456
150 Ga0157370_10000621 3300013104 Bacteria 44144
151 Ga0157370_10006171 3300013104 Bacteria 13294
152 Ga0157370_10010061 3300013104 Bacteria 10000
153 Ga0157370_10086673 3300013104 Bacteria 2942
154 Ga0157370_10476150 3300013104 Bacteria 1147
155 Ga0157369_10009128 3300013105 Bacteria 11347
156 Ga0157369_10022254 3300013105 Bacteria 7078
157 Ga0157369_10084901 3300013105 Bacteria 3383
158 Ga0157369_10175055 3300013105 Bacteria 2259
159 Ga0157369_10298233 3300013105 Bacteria 1677
160 Ga0157374_10003644 3300013296 Bacteria 12965
161 Ga0157378_10009587 3300013297 Bacteria 8432
162 Ga0157378_10378192 3300013297 Bacteria 1390
163 Ga0163162_10006525 3300013306 Bacteria 11304
164 Ga0163162_10010380 3300013306 Bacteria 9052
165 Ga0163162_10120373 3300013306 Bacteria 2729
166 Ga0157372_10000061 3300013307 Bacteria 119814
167 Ga0157372_10001252 3300013307 Bacteria 27459
168 Ga0157372_10003032 3300013307 Bacteria 18099
169 Ga0157372_10009047 3300013307 Bacteria 10583
170 Ga0157372_10020665 3300013307 Bacteria 7105
171 Ga0157372_10024522 3300013307 Bacteria 6554
172 Ga0157372_10028348 3300013307 Bacteria 6110
173 Ga0157372_10033430 3300013307 Bacteria 5648
174 Ga0157372_10046077 3300013307 Bacteria 4839
175 Ga0157372_10061459 3300013307 Bacteria 4207
176 Ga0157372_10063348 3300013307 Bacteria 4145
177 Ga0157372_10069807 3300013307 Unclassified 3952
178 Ga0157372_10180811 3300013307 Bacteria 2441
179 Ga0157372_11011053 3300013307 Unclassified 963
180 Ga0163163_10177743 3300014325 Bacteria 2175
181 Ga0182008_10005931 3300014497 Bacteria 6893
182 Ga0163161_10069727 3300017792 Unclassified 2570
183 Ga0206351_10342086 3300020077 Bacteria 966
184 Ga0209563_110868 3300025230 Bacteria 1308
185 Ga0207427_100085 3300025231 Bacteria 142561
186 Ga0209437_100024 3300025233 Bacteria 592878
187 Ga0209437_100052 3300025233 Bacteria 380548
188 Ga0209026_1000762 3300025250 Bacteria 18053
189 Ga0209026_1001478 3300025250 Bacteria 10362
190 Ga0209026_1004614 3300025250 Bacteria 4017
191 Ga0209129_1008662 3300025258 Bacteria 2796
192 Ga0209233_1000067 3300025261 Bacteria 380554
193 Ga0209233_1002436 3300025261 Bacteria 6862
194 Ga0209233_1012491 3300025261 Bacteria 2464
195 Ga0209233_1024064 3300025261 Bacteria 1530
196 Ga0207647_10000105 3300025904 Bacteria 65502
197 Ga0207705_10014117 3300025909 Bacteria 5754
198 Ga0207705_10019338 3300025909 Bacteria 4870
199 Ga0207705_10138704 3300025909 Bacteria 1815
200 Ga0207654_10029765 3300025911 Bacteria 2992
201 Ga0207654_10044297 3300025911 Bacteria 2526
202 Ga0207654_10062413 3300025911 Bacteria 2183
203 Ga0207654_10110225 3300025911 Bacteria 1711
204 Ga0207707_10017327 3300025912 Bacteria 6280
205 Ga0207707_10066975 3300025912 Bacteria 3127
206 Ga0207707_10073821 3300025912 Bacteria 2975
207 Ga0207707_10190351 3300025912 Bacteria 1790
208 Ga0207707_10374459 3300025912 Bacteria 1225
209 Ga0207695_10000055 3300025913 Bacteria 382776
210 Ga0207695_10000058 3300025913 Bacteria 366582
211 Ga0207695_10099498 3300025913 Bacteria 2905
212 Ga0207695_10127570 3300025913 Bacteria 2505
213 Ga0207695_10186430 3300025913 Bacteria 1993
214 Ga0207695_10226713 3300025913 Bacteria 1774
215 Ga0207695_10282371 3300025913 Unclassified 1554
216 Ga0207671_10002964 3300025914 Bacteria 17463
217 Ga0207671_10004997 3300025914 Bacteria 12413
218 Ga0207671_10005094 3300025914 Bacteria 12260
219 Ga0207671_10011279 3300025914 Bacteria 7290
220 Ga0207671_10016755 3300025914 Bacteria 5683
221 Ga0207660_10009387 3300025917 Bacteria 6333
222 Ga0207660_10010682 3300025917 Bacteria 5967
223 Ga0207660_10146228 3300025917 Bacteria 1812
224 Ga0207657_10007309 3300025919 Bacteria 11327
225 Ga0207657_10022045 3300025919 Bacteria 5979
226 Ga0207657_10022381 3300025919 Bacteria 5915
227 Ga0207657_10034798 3300025919 Bacteria 4524
228 Ga0207657_10133282 3300025919 Unclassified 2035
229 Ga0207652_10000276 3300025921 Bacteria 53325
230 Ga0207652_10001426 3300025921 Bacteria 21187
231 Ga0207652_10002842 3300025921 Bacteria 14517
232 Ga0207652_10006657 3300025921 Bacteria 9308
233 Ga0207652_10070989 3300025921 Bacteria 3025
234 Ga0207652_10099330 3300025921 Bacteria 2568
235 Ga0207652_10494168 3300025921 Bacteria 1102
236 Ga0207694_10192365 3300025924 Bacteria 1658
237 Ga0207690_10002760 3300025932 Bacteria 10601
238 Ga0207690_10013302 3300025932 Bacteria 4943
239 Ga0207690_10024979 3300025932 Bacteria 3747
240 Ga0207690_10025093 3300025932 Bacteria 3739
241 Ga0207690_10096304 3300025932 Bacteria 2104
242 Ga0207661_10010522 3300025944 Bacteria 6663
243 Ga0207661_10076909 3300025944 Unclassified 2743
244 Ga0207661_10410522 3300025944 Bacteria 1229
245 Ga0207667_10000037 3300025949 Bacteria 297252
246 Ga0207667_10000411 3300025949 Bacteria 57956
247 Ga0207667_10002576 3300025949 Bacteria 22534
248 Ga0207667_10006854 3300025949 Bacteria 13761
249 Ga0207667_10013156 3300025949 Bacteria 9487
250 Ga0207667_10072037 3300025949 Bacteria 3592
251 Ga0207667_10165987 3300025949 Bacteria 2270
252 Ga0207667_10197320 3300025949 Bacteria 2065
253 Ga0207667_10443982 3300025949 Bacteria 1319
254 Ga0207640_10003431 3300025981 Bacteria 8536
255 Ga0207640_10178273 3300025981 Unclassified 1591
256 Ga0207703_10098406 3300026035 Bacteria 2474
257 Ga0207639_10102559 3300026041 Bacteria 2316
258 Ga0207639_10139225 3300026041 Bacteria 2020
259 Ga0207639_10172026 3300026041 Bacteria 1835
260 Ga0207639_10174792 3300026041 Bacteria 1822
261 Ga0207678_10023447 3300026067 Bacteria 5398
262 Ga0207678_10081727 3300026067 Bacteria 2766
263 Ga0207702_10000047 3300026078 Bacteria 143192
264 Ga0207702_10001062 3300026078 Bacteria 28135
265 Ga0207702_10008236 3300026078 Bacteria 8813
266 Ga0207702_10105405 3300026078 Bacteria 2497
267 Ga0207641_10390422 3300026088 Bacteria 1335
268 Ga0207674_10032230 3300026116 Bacteria 5498
269 Ga0207674_10089604 3300026116 Bacteria 3069
270 Ga0207674_10108856 3300026116 Bacteria 2747
271 Ga0207675_100275192 3300026118 Bacteria 1635
272 Ga0207698_10044718 3300026142 Bacteria 3330
273 Ga0207698_10241707 3300026142 Bacteria 1646
274 Ga0207698_10869480 3300026142 Bacteria 907
275 Ga0268264_10002849 3300028381 Bacteria 15081
276 Ga0307517_10045586 3300028786 Unclassified 4600
277 Ga0307517_10101396 3300028786 Bacteria 2266
278 Ga0307515_10001132 3300028794 Bacteria 61076
279 Ga0307515_10002629 3300028794 Bacteria 38616
280 Ga0265338_10106227 3300028800 Bacteria 2274
281 Ga0265338_10139628 3300028800 Bacteria 1900
282 Ga0307516_10075532 3300031730 Bacteria 3224
283 Ga0307414_10061183 3300032004 Unclassified 2666
284 Ga0307507_10000015 3300033179 Bacteria 237419
285 Ga0395899_0000121 3300037312 Bacteria 125324
286 Ga0395899_0000502 3300037312 Bacteria 43550
287 Ga0395899_0000626 3300037312 Bacteria 36835
288 Ga0395899_0007398 3300037312 Bacteria 8489
289 Ga0395899_0009741 3300037312 Bacteria 7374
290 Ga0395900_0000358 3300037418 Bacteria 66350
291 Ga0395900_0001057 3300037418 Bacteria 35310
292 Ga0395900_0032945 3300037418 Bacteria 5331
293 Ga0395900_0033694 3300037418 Bacteria 5270
294 Ga0395900_0104936 3300037418 Bacteria 2903
295 Ga0395900_0349610 3300037418 Bacteria 1452
296 Ga0395898_0001310 3300037466 Bacteria 36272
297 Ga0395898_0002566 3300037466 Bacteria 21273
298 Ga0395898_0038620 3300037466 Bacteria 4730
299 Ga0395905_0000278 3300037471 Bacteria 75859
300 Ga0395905_0001089 3300037471 Bacteria 34151
301 Ga0395905_0005533 3300037471 Bacteria 12891
302 Ga0395905_0055833 3300037471 Bacteria 3696
303 Ga0395905_0213339 3300037471 Unclassified 1808
304 Ga0395905_0622004 3300037471 Bacteria 982
305 Ga0395901_0001075 3300038443 Bacteria 29195
306 Ga0395901_0001963 3300038443 Bacteria 21154
307 Ga0395901_0038202 3300038443 Bacteria 4966
308 Ga0395901_0055329 3300038443 Bacteria 4126
309 Ga0395901_0767834 3300038443 Bacteria 955
310 Ga0466968_0059115 3300044735 Bacteria 1651
311 Ga0466970_0448193 3300044765 Bacteria 740
312 Ga0466959_0045077 3300045049 Bacteria 3248
313 Ga0495650_0000132 3300046471 Bacteria 174226
314 Ga0495585_0000758 3300046492 Bacteria 28597
315 Ga0495585_0000910 3300046492 Bacteria 25075
316 Ga0495606_0000100 3300046507 Bacteria 147592
317 Ga0495606_0012686 3300046507 Bacteria 6728
318 Ga0495606_0073625 3300046507 Bacteria 2143
319 Ga0495606_0193473 3300046507 Bacteria 1164
320 Ga0495610_0000539 3300046512 Bacteria 38045
321 Ga0495616_0003038 3300046513 Bacteria 10877
322 Ga0495616_0103512 3300046513 Bacteria 1332
323 Ga0495631_0070864 3300046518 Bacteria 1507
324 Ga0495644_0003939 3300046523 Bacteria 5843
325 Ga0495652_0158101 3300046529 Bacteria 1763
326 Ga0495654_0035280 3300046530 Bacteria 2520
327 Ga0495609_0002616 3300046538 Bacteria 10935
328 Ga0495633_0000035 3300046558 Bacteria 185403
329 Ga0495633_0031437 3300046558 Bacteria 2573
330 Ga0495668_0000032 3300046616 Bacteria 254951
331 Ga0495625_0000036 3300046660 Bacteria 221680
332 Ga0495625_0000981 3300046660 Bacteria 37838
333 Ga0495625_0002108 3300046660 Bacteria 22205
334 Ga0495625_0048042 3300046660 Bacteria 3074
335 Ga0495625_0062059 3300046660 Bacteria 2643
336 Ga0495625_0281329 3300046660 Bacteria 1070
337 Ga0495661_0004471 3300046665 Bacteria 10087
338 Ga0495661_0068002 3300046665 Bacteria 2091
339 Ga0495658_0015662 3300046683 Bacteria 3892
340 Ga0495671_0160027 3300046692 Bacteria 1095
341 Ga0495649_0000017 3300046694 Bacteria 221685
342 Ga0495660_0021940 3300046810 Bacteria 3651
343 Ga0495660_0054649 3300046810 Bacteria 2163
344 Ga0495687_001261 3300047443 Bacteria 23987
345 Ga0495685_052015 3300047447 Bacteria 1388
346 Ga0495686_0000052 3300047472 Bacteria 262622
347 Ga0495686_0006461 3300047472 Bacteria 8968
348 Ga0495678_005034 3300049459 Bacteria 7435
349 Ga0495682_0044643 3300049460 Bacteria 1621
350 Ga0501033_0126006 3300049570 Bacteria 1857
351 Ga0501034_0112390 3300049571 Bacteria 2714
352 Ga0501070_0429634 3300049586 Bacteria 1066
353 nmdc:mga0k408_1658_c1 3300050493 Bacteria 12029
354 nmdc:mga0k408_518_c1 3300050493 Bacteria 21209
355 nmdc:mga0k408_81377_c1 3300050493 Unclassified 1896
356 Ga0500618_000004 3300053125 Bacteria 293180
357 Ga0500618_000127 3300053125 Bacteria 62903
358 Ga0500642_0018395 3300053130 Bacteria 2701
359 Ga0500622_0001459 3300053156 Bacteria 18875
360 Ga0500624_000226 3300053157 Bacteria 20611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0448193 Ga0466970_0448193_99_701 198
2 3300013297 Ga0157378_10378192 Ga0157378_103781921 230
3 3300038443 Ga0395901_0767834 Ga0395901_0767834_18_716 231
4 3300003323 rootH1_10153641 rootH1_101536411 232
5 3300004799 Ga0058863_10515375 Ga0058863_105153751 233
6 3300046660 Ga0495625_0062059 Ga0495625_0062059_1891_2628 233
7 3300005327 Ga0070658_10438012 Ga0070658_104380122 236
8 3300044735 Ga0466968_0059115 Ga0466968_0059115_25_765 237
9 3300005327 Ga0070658_10006680 Ga0070658_100066809 238
10 3300009545 Ga0105237_10006397 Ga0105237_100063978 238
11 3300010375 Ga0105239_10005678 Ga0105239_1000567816 238
12 3300013307 Ga0157372_10046077 Ga0157372_100460774 238
13 3300025913 Ga0207695_10186430 Ga0207695_101864302 238
14 3300025914 Ga0207671_10016755 Ga0207671_100167552 238
15 3300025949 Ga0207667_10165987 Ga0207667_101659872 238
16 3300003323 rootH1_10016880 rootH1_100168807 240
17 3300045049 Ga0466959_0045077 Ga0466959_0045077_47_835 240
18 3300005843 Ga0068860_100013736 Ga0068860_1000137362 243
19 3300028381 Ga0268264_10002849 Ga0268264_100028492 243
20 3300005288 Ga0065714_10069414 Ga0065714_100694142 244
21 3300025912 Ga0207707_10190351 Ga0207707_101903512 244
22 3300046660 Ga0495625_0281329 Ga0495625_0281329_199_1041 244
23 3300003323 rootH1_10082703 rootH1_100827035 245
24 3300005327 Ga0070658_10050868 Ga0070658_100508683 245
25 3300005366 Ga0070659_100000120 Ga0070659_10000012010 245
26 3300005530 Ga0070679_100231021 Ga0070679_1002310212 245
27 3300005535 Ga0070684_100009804 Ga0070684_1000098046 245
28 3300005563 Ga0068855_100000341 Ga0068855_10000034143 245
29 3300005614 Ga0068856_100000005 Ga0068856_10000000520 245
30 3300009093 Ga0105240_10028278 Ga0105240_100282782 245
31 3300009093 Ga0105240_10201195 Ga0105240_102011952 245
32 3300009174 Ga0105241_10049977 Ga0105241_100499772 245
33 3300009545 Ga0105237_10000485 Ga0105237_100004856 245
34 3300010375 Ga0105239_10000039 Ga0105239_10000039120 245
35 3300013100 Ga0157373_10000069 Ga0157373_1000006916 245
36 3300013100 Ga0157373_10000075 Ga0157373_1000007567 245
37 3300013296 Ga0157374_10003644 Ga0157374_100036444 245
38 3300013307 Ga0157372_10001252 Ga0157372_1000125220 245
39 3300013307 Ga0157372_10063348 Ga0157372_100633483 245
40 3300025250 Ga0209026_1004614 Ga0209026_10046142 245
41 3300025261 Ga0209233_1012491 Ga0209233_10124912 245
42 3300025913 Ga0207695_10226713 Ga0207695_102267132 245
43 3300025921 Ga0207652_10494168 Ga0207652_104941681 245
44 3300025932 Ga0207690_10024979 Ga0207690_100249792 245
45 3300025944 Ga0207661_10410522 Ga0207661_104105222 245
46 3300025949 Ga0207667_10000411 Ga0207667_1000041142 245
47 3300026078 Ga0207702_10000047 Ga0207702_1000004723 245
48 3300026078 Ga0207702_10105405 Ga0207702_101054053 245
49 3300026116 Ga0207674_10108856 Ga0207674_101088562 245
50 3300037312 Ga0395899_0000121 Ga0395899_0000121_81674_82513 245
51 3300037471 Ga0395905_0000278 Ga0395905_0000278_8618_9460 245
52 3300038443 Ga0395901_0038202 Ga0395901_0038202_2886_3728 245
53 3300046507 Ga0495606_0073625 Ga0495606_0073625_1083_1868 245
54 3300046810 Ga0495660_0021940 Ga0495660_0021940_2654_3439 245
55 3300053125 Ga0500618_000004 Ga0500618_000004_231626_232411 245
56 3300053130 Ga0500642_0018395 Ga0500642_0018395_877_1725 245
57 3300026118 Ga0207675_100275192 Ga0207675_1002751922 248
58 iso_pu_bacteria 2977232053 2977233532 248
59 3300001990 JGI24737J22298_10000742 JGI24737J22298_100007424 249
60 3300002067 JGI24735J21928_10000004 JGI24735J21928_1000000446 249
61 3300013307 Ga0157372_10003032 Ga0157372_1000303210 249
62 3300020077 Ga0206351_10342086 Ga0206351_103420861 249
63 3300005339 Ga0070660_100004419 Ga0070660_1000044199 250
64 3300025919 Ga0207657_10022045 Ga0207657_100220452 250
65 3300005288 Ga0065714_10080694 Ga0065714_100806942 251
66 3300005327 Ga0070658_10031611 Ga0070658_100316115 251
67 3300005327 Ga0070658_10192828 Ga0070658_101928282 251
68 3300005329 Ga0070683_100627512 Ga0070683_1006275121 251
69 3300005336 Ga0070680_100003013 Ga0070680_1000030138 251
70 3300005336 Ga0070680_100138350 Ga0070680_1001383502 251
71 3300005336 Ga0070680_100163220 Ga0070680_1001632202 251
72 3300005336 Ga0070680_100172976 Ga0070680_1001729762 251
73 3300005336 Ga0070680_100350522 Ga0070680_1003505222 251
74 3300005337 Ga0070682_100276316 Ga0070682_1002763162 251
75 3300005339 Ga0070660_100021572 Ga0070660_1000215722 251
76 3300005339 Ga0070660_100033606 Ga0070660_1000336065 251
77 3300005339 Ga0070660_100059299 Ga0070660_1000592992 251
78 3300005353 Ga0070669_100392500 Ga0070669_1003925002 251
79 3300005366 Ga0070659_100012700 Ga0070659_1000127005 251
80 3300005366 Ga0070659_100071346 Ga0070659_1000713462 251
81 3300005367 Ga0070667_100164743 Ga0070667_1001647432 251
82 3300005455 Ga0070663_100012425 Ga0070663_1000124254 251
83 3300005458 Ga0070681_10042430 Ga0070681_100424303 251
84 3300005458 Ga0070681_10042876 Ga0070681_100428764 251
85 3300005458 Ga0070681_10062635 Ga0070681_100626353 251
86 3300005530 Ga0070679_100000386 Ga0070679_10000038621 251
87 3300005530 Ga0070679_100002288 Ga0070679_10000228814 251
88 3300005530 Ga0070679_100064191 Ga0070679_1000641913 251
89 3300005530 Ga0070679_100118997 Ga0070679_1001189973 251
90 3300005535 Ga0070684_100066050 Ga0070684_1000660502 251
91 3300005539 Ga0068853_100099909 Ga0068853_1000999092 251
92 3300005539 Ga0068853_100131246 Ga0068853_1001312462 251
93 3300005539 Ga0068853_100504572 Ga0068853_1005045722 251
94 3300005563 Ga0068855_100000995 Ga0068855_10000099524 251
95 3300005563 Ga0068855_100014274 Ga0068855_1000142749 251
96 3300005563 Ga0068855_100142815 Ga0068855_1001428151 251
97 3300005563 Ga0068855_100159666 Ga0068855_1001596662 251
98 3300005577 Ga0068857_100023350 Ga0068857_1000233505 251
99 3300005578 Ga0068854_100046355 Ga0068854_1000463552 251
100 3300005614 Ga0068856_100174319 Ga0068856_1001743192 251
101 3300005616 Ga0068852_100003382 Ga0068852_1000033828 251
102 3300005616 Ga0068852_100246952 Ga0068852_1002469522 251
103 3300005843 Ga0068860_100045434 Ga0068860_1000454343 251
104 3300005844 Ga0068862_100024370 Ga0068862_1000243702 251
105 3300006237 Ga0097621_100020481 Ga0097621_1000204812 251
106 3300006358 Ga0068871_100039582 Ga0068871_1000395822 251
107 3300009174 Ga0105241_10115179 Ga0105241_101151792 251
108 3300010375 Ga0105239_10029981 Ga0105239_100299814 251
109 3300013100 Ga0157373_10031540 Ga0157373_100315403 251
110 3300013100 Ga0157373_10052333 Ga0157373_100523332 251
111 3300013102 Ga0157371_10002305 Ga0157371_1000230515 251
112 3300013102 Ga0157371_10002840 Ga0157371_1000284012 251
113 3300013102 Ga0157371_10006218 Ga0157371_100062183 251
114 3300013102 Ga0157371_10007042 Ga0157371_100070428 251
115 3300013102 Ga0157371_10016895 Ga0157371_100168952 251
116 3300013102 Ga0157371_10050573 Ga0157371_100505734 251
117 3300013102 Ga0157371_10053676 Ga0157371_100536762 251
118 3300013102 Ga0157371_10061653 Ga0157371_100616532 251
119 3300013102 Ga0157371_10071472 Ga0157371_100714722 251
120 3300013104 Ga0157370_10000621 Ga0157370_1000062127 251
121 3300013104 Ga0157370_10006171 Ga0157370_100061714 251
122 3300013104 Ga0157370_10010061 Ga0157370_1001006110 251
123 3300013104 Ga0157370_10086673 Ga0157370_100866732 251
124 3300013105 Ga0157369_10009128 Ga0157369_100091287 251
125 3300013105 Ga0157369_10022254 Ga0157369_100222546 251
126 3300013105 Ga0157369_10084901 Ga0157369_100849013 251
127 3300013105 Ga0157369_10298233 Ga0157369_102982332 251
128 3300013297 Ga0157378_10009587 Ga0157378_100095876 251
129 3300013307 Ga0157372_10009047 Ga0157372_100090477 251
130 3300013307 Ga0157372_10020665 Ga0157372_100206659 251
131 3300013307 Ga0157372_10024522 Ga0157372_100245225 251
132 3300013307 Ga0157372_10028348 Ga0157372_100283482 251
133 3300013307 Ga0157372_10033430 Ga0157372_100334304 251
134 3300013307 Ga0157372_10069807 Ga0157372_100698076 251
135 3300013307 Ga0157372_10180811 Ga0157372_101808113 251
136 3300013307 Ga0157372_11011053 Ga0157372_110110531 251
137 3300014325 Ga0163163_10177743 Ga0163163_101777432 251
138 3300017792 Ga0163161_10069727 Ga0163161_100697272 251
139 3300025909 Ga0207705_10014117 Ga0207705_100141173 251
140 3300025909 Ga0207705_10019338 Ga0207705_100193384 251
141 3300025911 Ga0207654_10062413 Ga0207654_100624132 251
142 3300025912 Ga0207707_10066975 Ga0207707_100669754 251
143 3300025912 Ga0207707_10073821 Ga0207707_100738212 251
144 3300025912 Ga0207707_10374459 Ga0207707_103744592 251
145 3300025913 Ga0207695_10127570 Ga0207695_101275702 251
146 3300025917 Ga0207660_10010682 Ga0207660_100106826 251
147 3300025917 Ga0207660_10146228 Ga0207660_101462282 251
148 3300025919 Ga0207657_10007309 Ga0207657_100073096 251
149 3300025919 Ga0207657_10034798 Ga0207657_100347984 251
150 3300025919 Ga0207657_10133282 Ga0207657_101332822 251
151 3300025921 Ga0207652_10000276 Ga0207652_1000027629 251
152 3300025921 Ga0207652_10001426 Ga0207652_100014267 251
153 3300025921 Ga0207652_10002842 Ga0207652_100028429 251
154 3300025921 Ga0207652_10070989 Ga0207652_100709892 251
155 3300025921 Ga0207652_10099330 Ga0207652_100993303 251
156 3300025932 Ga0207690_10013302 Ga0207690_100133023 251
157 3300025932 Ga0207690_10025093 Ga0207690_100250934 251
158 3300025944 Ga0207661_10076909 Ga0207661_100769092 251
159 3300025949 Ga0207667_10002576 Ga0207667_1000257615 251
160 3300025949 Ga0207667_10013156 Ga0207667_100131567 251
161 3300025949 Ga0207667_10197320 Ga0207667_101973202 251
162 3300025981 Ga0207640_10178273 Ga0207640_101782732 251
163 3300026041 Ga0207639_10102559 Ga0207639_101025592 251
164 3300026041 Ga0207639_10139225 Ga0207639_101392252 251
165 3300026067 Ga0207678_10023447 Ga0207678_100234472 251
166 3300026067 Ga0207678_10081727 Ga0207678_100817274 251
167 3300026088 Ga0207641_10390422 Ga0207641_103904221 251
168 3300026116 Ga0207674_10032230 Ga0207674_100322307 251
169 3300026116 Ga0207674_10089604 Ga0207674_100896042 251
170 3300026142 Ga0207698_10044718 Ga0207698_100447182 251
171 3300026142 Ga0207698_10241707 Ga0207698_102417072 251
172 3300037312 Ga0395899_0000626 Ga0395899_0000626_10672_11520 251
173 3300037312 Ga0395899_0007398 Ga0395899_0007398_6907_7770 251
174 3300037312 Ga0395899_0009741 Ga0395899_0009741_384_1235 251
175 3300037418 Ga0395900_0032945 Ga0395900_0032945_2250_3113 251
176 3300037418 Ga0395900_0033694 Ga0395900_0033694_384_1235 251
177 3300037418 Ga0395900_0104936 Ga0395900_0104936_1593_2438 251
178 3300037466 Ga0395898_0001310 Ga0395898_0001310_22455_23303 251
179 3300037466 Ga0395898_0002566 Ga0395898_0002566_6433_7284 251
180 3300037466 Ga0395898_0038620 Ga0395898_0038620_1445_2308 251
181 3300037471 Ga0395905_0055833 Ga0395905_0055833_554_1393 251
182 3300038443 Ga0395901_0001075 Ga0395901_0001075_22950_23801 251
183 3300038443 Ga0395901_0055329 Ga0395901_0055329_862_1710 251
184 3300049570 Ga0501033_0126006 Ga0501033_0126006_508_1368 251
185 3300049571 Ga0501034_0112390 Ga0501034_0112390_1000_1875 251
186 3300049586 Ga0501070_0429634 Ga0501070_0429634_64_924 251
187 iso_pu_bacteria 2739367866 2740033001 251
188 3300005288 Ga0065714_10076831 Ga0065714_100768311 252
189 3300006195 Ga0075366_10000414 Ga0075366_100004145 252
190 3300013307 Ga0157372_10061459 Ga0157372_100614594 252
191 3300014497 Ga0182008_10005931 Ga0182008_100059313 252
192 3300001989 JGI24739J22299_10015086 JGI24739J22299_100150864 253
193 3300001989 JGI24739J22299_10032954 JGI24739J22299_100329541 253
194 3300009093 Ga0105240_10000008 Ga0105240_10000008373 253
195 3300009093 Ga0105240_10000075 Ga0105240_10000075106 253
196 3300010375 Ga0105239_10044949 Ga0105239_100449493 253
197 3300013104 Ga0157370_10476150 Ga0157370_104761501 253
198 3300025911 Ga0207654_10044297 Ga0207654_100442972 253
199 3300025913 Ga0207695_10000055 Ga0207695_10000055238 253
200 3300032004 Ga0307414_10061183 Ga0307414_100611834 253
201 3300028786 Ga0307517_10045586 Ga0307517_100455863 254
202 3300028786 Ga0307517_10101396 Ga0307517_101013963 254
203 3300037418 Ga0395900_0000358 Ga0395900_0000358_16884_17669 254
204 3300046523 Ga0495644_0003939 Ga0495644_0003939_794_1621 254
205 3300047447 Ga0495685_052015 Ga0495685_052015_533_1360 254
206 3300009174 Ga0105241_10058217 Ga0105241_100582174 255
207 3300009545 Ga0105237_10001497 Ga0105237_1000149726 255
208 3300025914 Ga0207671_10002964 Ga0207671_1000296413 255
209 3300031730 Ga0307516_10075532 Ga0307516_100755323 255
210 3300037312 Ga0395899_0000502 Ga0395899_0000502_11743_12558 255
211 3300037418 Ga0395900_0001057 Ga0395900_0001057_3976_4791 255
212 3300037471 Ga0395905_0001089 Ga0395905_0001089_3063_3878 255
213 3300038443 Ga0395901_0001963 Ga0395901_0001963_6117_6932 255
214 3300053125 Ga0500618_000127 Ga0500618_000127_39418_40296 255
215 3300037418 Ga0395900_0349610 Ga0395900_0349610_183_1088 256
216 3300037471 Ga0395905_0005533 Ga0395905_0005533_604_1509 256
217 3300037471 Ga0395905_0213339 Ga0395905_0213339_518_1423 256
218 iso_pu_bacteria 2599185184 2599478388 256
219 iso_pu_bacteria 2852623160 2852624024 256
220 iso_pu_bacteria 2884933994 2884937053 256
221 iso_pu_bacteria 2919437846 2919439021 256
222 iso_pu_bacteria 2928078545 2928080559 256
223 iso_pu_bacteria 2928147474 2928150787 256
224 iso_pu_bacteria 2932082852 2932083057 256
225 3300026078 Ga0207702_10008236 Ga0207702_100082368 258
226 3300046507 Ga0495606_0193473 Ga0495606_0193473_99_989 258
227 3300046513 Ga0495616_0103512 Ga0495616_0103512_197_1090 258
228 3300046660 Ga0495625_0048042 Ga0495625_0048042_1475_2368 258
229 3300049459 Ga0495678_005034 Ga0495678_005034_2656_3549 258
230 3300053156 Ga0500622_0001459 Ga0500622_0001459_17930_18754 258
231 3300002741 JGI25157J39369_1007132 JGI25157J39369_10071322 259
232 3300002772 JGI25164J39214_1001352 JGI25164J39214_10013523 259
233 3300003214 JGI25165J46597_1001026 JGI25165J46597_100102610 259
234 3300003323 rootH1_10012862 rootH1_1001286213 259
235 3300005327 Ga0070658_10086403 Ga0070658_100864034 259
236 3300005329 Ga0070683_100015681 Ga0070683_1000156814 259
237 3300005366 Ga0070659_100000231 Ga0070659_10000023110 259
238 3300005456 Ga0070678_100574794 Ga0070678_1005747941 259
239 3300005458 Ga0070681_10080817 Ga0070681_100808173 259
240 3300005530 Ga0070679_100081822 Ga0070679_1000818222 259
241 3300005535 Ga0070684_100012509 Ga0070684_1000125092 259
242 3300005563 Ga0068855_100000042 Ga0068855_100000042139 259
243 3300005563 Ga0068855_100001648 Ga0068855_1000016486 259
244 3300005563 Ga0068855_100135688 Ga0068855_1001356882 259
245 3300005563 Ga0068855_100136765 Ga0068855_1001367655 259
246 3300005578 Ga0068854_100409101 Ga0068854_1004091011 259
247 3300005614 Ga0068856_100000015 Ga0068856_10000001527 259
248 3300005842 Ga0068858_100121758 Ga0068858_1001217582 259
249 3300006195 Ga0075366_10001191 Ga0075366_1000119111 259
250 3300006195 Ga0075366_10056121 Ga0075366_100561212 259
251 3300009093 Ga0105240_10009037 Ga0105240_1000903714 259
252 3300009093 Ga0105240_10074469 Ga0105240_100744695 259
253 3300009093 Ga0105240_10129110 Ga0105240_101291103 259
254 3300009174 Ga0105241_10097510 Ga0105241_100975103 259
255 3300009551 Ga0105238_10147173 Ga0105238_101471732 259
256 3300009553 Ga0105249_10605261 Ga0105249_106052612 259
257 3300010375 Ga0105239_10000021 Ga0105239_10000021195 259
258 3300010375 Ga0105239_10005607 Ga0105239_100056076 259
259 3300013306 Ga0163162_10006525 Ga0163162_100065253 259
260 3300025230 Ga0209563_110868 Ga0209563_1108682 259
261 3300025231 Ga0207427_100085 Ga0207427_10008584 259
262 3300025233 Ga0209437_100052 Ga0209437_100052160 259
263 3300025250 Ga0209026_1000762 Ga0209026_10007625 259
264 3300025250 Ga0209026_1001478 Ga0209026_10014788 259
265 3300025261 Ga0209233_1000067 Ga0209233_1000067160 259
266 3300025909 Ga0207705_10138704 Ga0207705_101387044 259
267 3300025911 Ga0207654_10110225 Ga0207654_101102252 259
268 3300025912 Ga0207707_10017327 Ga0207707_100173276 259
269 3300025913 Ga0207695_10099498 Ga0207695_100994983 259
270 3300025913 Ga0207695_10282371 Ga0207695_102823712 259
271 3300025914 Ga0207671_10004997 Ga0207671_1000499710 259
272 3300025917 Ga0207660_10009387 Ga0207660_100093874 259
273 3300025919 Ga0207657_10022381 Ga0207657_100223817 259
274 3300025921 Ga0207652_10006657 Ga0207652_100066578 259
275 3300025932 Ga0207690_10002760 Ga0207690_100027603 259
276 3300025944 Ga0207661_10010522 Ga0207661_100105224 259
277 3300025949 Ga0207667_10000037 Ga0207667_10000037141 259
278 3300025949 Ga0207667_10006854 Ga0207667_100068547 259
279 3300025949 Ga0207667_10443982 Ga0207667_104439822 259
280 3300026035 Ga0207703_10098406 Ga0207703_100984062 259
281 3300026041 Ga0207639_10172026 Ga0207639_101720262 259
282 3300026078 Ga0207702_10001062 Ga0207702_1000106213 259
283 3300028800 Ga0265338_10106227 Ga0265338_101062274 259
284 3300028800 Ga0265338_10139628 Ga0265338_101396281 259
285 3300047472 Ga0495686_0000052 Ga0495686_0000052_252947_253849 259
286 3300050493 nmdc:mga0k408_1658_c1 nmdc:mga0k408_1658_c1_8863_9681 259
287 3300050493 nmdc:mga0k408_81377_c1 nmdc:mga0k408_81377_c1_118_951 259
288 3300001904 JGI24736J21556_1009235 JGI24736J21556_10092352 260
289 3300001979 JGI24740J21852_10036041 JGI24740J21852_100360412 260
290 3300002067 JGI24735J21928_10009531 JGI24735J21928_100095313 260
291 3300002737 JGI25162J39368_1000017 JGI25162J39368_100001713 260
292 3300002737 JGI25162J39368_1000188 JGI25162J39368_100018826 260
293 3300003316 rootH1_10051843 rootH1_100518434 260
294 3300003320 rootH2_10017336 rootH2_1001733610 260
295 3300003320 rootH2_10320287 rootH2_103202872 260
296 3300003322 rootL2_10123691 rootL2_101236913 260
297 3300005288 Ga0065714_10005009 Ga0065714_100050097 260
298 3300005339 Ga0070660_100242179 Ga0070660_1002421793 260
299 3300005366 Ga0070659_100003390 Ga0070659_1000033901 260
300 3300005539 Ga0068853_100310629 Ga0068853_1003106292 260
301 3300005563 Ga0068855_100086496 Ga0068855_1000864964 260
302 3300005577 Ga0068857_100007316 Ga0068857_1000073162 260
303 3300005578 Ga0068854_100035349 Ga0068854_1000353492 260
304 3300009093 Ga0105240_10000039 Ga0105240_1000003944 260
305 3300009093 Ga0105240_10572325 Ga0105240_105723251 260
306 3300009174 Ga0105241_10005435 Ga0105241_100054358 260
307 3300009545 Ga0105237_10000271 Ga0105237_1000027148 260
308 3300009545 Ga0105237_10158587 Ga0105237_101585873 260
309 3300009545 Ga0105237_10158721 Ga0105237_101587213 260
310 3300009551 Ga0105238_10345616 Ga0105238_103456162 260
311 3300009551 Ga0105238_10430204 Ga0105238_104302042 260
312 3300010375 Ga0105239_10000002 Ga0105239_10000002178 260
313 3300010375 Ga0105239_10001188 Ga0105239_1000118813 260
314 3300010375 Ga0105239_10001886 Ga0105239_1000188612 260
315 3300010375 Ga0105239_10006422 Ga0105239_1000642212 260
316 3300013100 Ga0157373_10003785 Ga0157373_100037854 260
317 3300013102 Ga0157371_10000135 Ga0157371_1000013519 260
318 3300013102 Ga0157371_10005260 Ga0157371_1000526010 260
319 3300013105 Ga0157369_10175055 Ga0157369_101750554 260
320 3300013306 Ga0163162_10010380 Ga0163162_100103804 260
321 3300013306 Ga0163162_10120373 Ga0163162_101203733 260
322 3300013307 Ga0157372_10000061 Ga0157372_100000618 260
323 3300025233 Ga0209437_100024 Ga0209437_100024303 260
324 3300025258 Ga0209129_1008662 Ga0209129_10086622 260
325 3300025261 Ga0209233_1002436 Ga0209233_10024367 260
326 3300025261 Ga0209233_1024064 Ga0209233_10240642 260
327 3300025904 Ga0207647_10000105 Ga0207647_1000010565 260
328 3300025911 Ga0207654_10029765 Ga0207654_100297653 260
329 3300025913 Ga0207695_10000058 Ga0207695_10000058162 260
330 3300025914 Ga0207671_10005094 Ga0207671_1000509410 260
331 3300025914 Ga0207671_10011279 Ga0207671_100112795 260
332 3300025924 Ga0207694_10192365 Ga0207694_101923652 260
333 3300025932 Ga0207690_10096304 Ga0207690_100963042 260
334 3300025949 Ga0207667_10072037 Ga0207667_100720373 260
335 3300025981 Ga0207640_10003431 Ga0207640_100034317 260
336 3300026041 Ga0207639_10174792 Ga0207639_101747922 260
337 3300026142 Ga0207698_10869480 Ga0207698_108694801 260
338 3300028794 Ga0307515_10001132 Ga0307515_1000113215 260
339 3300028794 Ga0307515_10002629 Ga0307515_100026294 260
340 3300033179 Ga0307507_10000015 Ga0307507_1000001512 260
341 3300037312 Ga0395899_0000121 Ga0395899_0000121_35112_35897 260
342 3300037471 Ga0395905_0622004 Ga0395905_0622004_91_873 260
343 3300046471 Ga0495650_0000132 Ga0495650_0000132_135924_136838 260
344 3300046492 Ga0495585_0000758 Ga0495585_0000758_10174_11094 260
345 3300046492 Ga0495585_0000910 Ga0495585_0000910_16775_17659 260
346 3300046507 Ga0495606_0000100 Ga0495606_0000100_115946_116860 260
347 3300046507 Ga0495606_0012686 Ga0495606_0012686_2775_3692 260
348 3300046512 Ga0495610_0000539 Ga0495610_0000539_29267_30157 260
349 3300046513 Ga0495616_0003038 Ga0495616_0003038_2889_3803 260
350 3300046518 Ga0495631_0070864 Ga0495631_0070864_419_1303 260
351 3300046529 Ga0495652_0158101 Ga0495652_0158101_592_1482 260
352 3300046530 Ga0495654_0035280 Ga0495654_0035280_433_1317 260
353 3300046538 Ga0495609_0002616 Ga0495609_0002616_8445_9329 260
354 3300046558 Ga0495633_0000035 Ga0495633_0000035_173026_173910 260
355 3300046558 Ga0495633_0031437 Ga0495633_0031437_1375_2265 260
356 3300046616 Ga0495668_0000032 Ga0495668_0000032_15901_16785 260
357 3300046660 Ga0495625_0000036 Ga0495625_0000036_60795_61709 260
358 3300046660 Ga0495625_0000981 Ga0495625_0000981_4246_5130 260
359 3300046660 Ga0495625_0002108 Ga0495625_0002108_13484_14368 260
360 3300046665 Ga0495661_0004471 Ga0495661_0004471_5543_6457 260
361 3300046665 Ga0495661_0068002 Ga0495661_0068002_1137_2027 260
362 3300046683 Ga0495658_0015662 Ga0495658_0015662_345_1229 260
363 3300046692 Ga0495671_0160027 Ga0495671_0160027_78_992 260
364 3300046694 Ga0495649_0000017 Ga0495649_0000017_159979_160893 260
365 3300046810 Ga0495660_0054649 Ga0495660_0054649_251_1168 260
366 3300047443 Ga0495687_001261 Ga0495687_001261_1640_2554 260
367 3300047472 Ga0495686_0006461 Ga0495686_0006461_2182_2973 260
368 3300049460 Ga0495682_0044643 Ga0495682_0044643_627_1511 260
369 3300050493 nmdc:mga0k408_518_c1 nmdc:mga0k408_518_c1_16005_16889 260
370 3300053157 Ga0500624_000226 Ga0500624_000226_635_1513 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

122

267

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dq3-assembly2.cif.gz_B streptococcus pyogenes deacetylase ppld in complex with acetate 0.8989 31 257
6dq3-assembly2.cif.gz_B streptococcus pyogenes deacetylase ppld in complex with acetate 0.8838 31 257
6go1-assembly2.cif.gz_B crystal structure of a bacillus anthracis peptidoglycan deacetylase 0.8336 31 257
4v33-assembly2.cif.gz_B crystal structure of the putative polysaccharide deacetylase ba0330 from bacillus anthracis 0.8324 31 257
4hd5-assembly1.cif.gz_A crystal structure of bc0361, a polysaccharide deacetylase from bacillus cereus 0.8266 31 257
ID Description Score Start End Superfamily
af_P31666_165_404_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8414 32 256 3.20.20.370
4v33B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8316 31 257 3.20.20.370
4v33B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.828 31 257 3.20.20.370
4f9dB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8131 33 260 3.20.20.370
4wcjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7948 30 258 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A520A0S9-F1-model_v4 Polysaccharide deacetylase family protein 0.9987 25 146 GO:0005975
GO:0016810
AF-A0A3B7RHV5-F1-model_v4 Polysaccharide deacetylase family protein 0.9965 23 260 GO:0005975
GO:0016810
AF-A0A239FDV9-F1-model_v4 Polysaccharide deacetylase 0.9965 18 260 GO:0005975
GO:0016810
AF-A0A7G6YTC6-F1-model_v4 Polysaccharide deacetylase family protein 0.9963 23 260 GO:0005975
GO:0016810
AF-A0A1G9N7B7-F1-model_v4 Polysaccharide deacetylase 0.9962 23 260 GO:0005975
GO:0016810

Feature Viewer

pLDDT pTM Quality
94.5 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map