F425508

General Info

Members Datasets Scaffolds Average Seq Length
370 224 370 417

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0023481|Ga0495641_0023481_141_1475
Length 444
Sequence VKKAVPFTKALEKSLFGSKAVGLGDAARQGLPVPPGIALSGDLVEAVASGEEKAIEKLAKAIASLKPPFAVRSSAVDEDGDASSFAGQHLTLLNISSVNDVPGAVREVWWSANSDSAITYRQRVGKFTRPSVGVVVQTLLNPTAAGVMFTENPVTGADERLIEASWGLGEAVVAGLVVPDQFSLDRSGQVLQRKPGRKRIAIRSLPSGGTFEEPVPAAKVHELCLDDAQLATMCQLALQCEKVYGPRRDIEWAFQDGTLYLLQCRAVTTGTAKSEALPPGPTPRDPVAALQRVQLFADLDRRHGEQIARLLKVRHFTNGETIIMEGSGGAAFFLIDSGEATVSSKGAHLATLGPGQYFGELALIDGGPRSATVTAASDMVCYGLTFWEFRPLVERNGAIGWKLLEALAKRLRTTNAATPNTNPEPVSESPAGLPTSGGGGTRLS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 7.3
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002108 3300001979 Bacteria 9098
2 JGI24740J21852_10022019 3300001979 Bacteria 2201
3 JGI24739J22299_10002652 3300001989 Bacteria 6883
4 JGI24735J21928_10008756 3300002067 Bacteria 3265
5 JGI24735J21928_10010659 3300002067 Bacteria 2926
6 JGI26129J50193_1001205 3300003349 Unclassified 1734
7 Ga0070658_10049408 3300005327 Unclassified 3407
8 Ga0070658_10113198 3300005327 Bacteria 2249
9 Ga0070676_10001390 3300005328 Bacteria 12219
10 Ga0070676_10034613 3300005328 Bacteria 2901
11 Ga0070676_10037013 3300005328 Bacteria 2812
12 Ga0070683_100044045 3300005329 Bacteria 4114
13 Ga0070683_100165078 3300005329 Bacteria 2101
14 Ga0070690_100007000 3300005330 Bacteria 6428
15 Ga0070690_100034794 3300005330 Bacteria 3158
16 Ga0070670_100016336 3300005331 Bacteria 6375
17 Ga0070670_100122781 3300005331 Bacteria 2241
18 Ga0070670_100200469 3300005331 Bacteria 1734
19 Ga0068869_100060025 3300005334 Bacteria 2786
20 Ga0070666_10003153 3300005335 Bacteria 10015
21 Ga0070680_100017656 3300005336 Bacteria 5628
22 Ga0070660_100005375 3300005339 Bacteria 8866
23 Ga0070660_100193619 3300005339 Archaea 1647
24 Ga0070689_100015260 3300005340 Bacteria 5598
25 Ga0070689_100025014 3300005340 Bacteria 4483
26 Ga0070689_100050766 3300005340 Bacteria 3205
27 Ga0070661_100234933 3300005344 Bacteria 1410
28 Ga0070669_100137025 3300005353 Bacteria 1884
29 Ga0070675_100007080 3300005354 Bacteria 8630
30 Ga0070675_100033596 3300005354 Bacteria 4160
31 Ga0070671_100038827 3300005355 Bacteria 3951
32 Ga0070671_100096531 3300005355 Unclassified 2479
33 Ga0070671_100157130 3300005355 Bacteria 1921
34 Ga0070671_100187249 3300005355 Bacteria 1754
35 Ga0070673_100003042 3300005364 Bacteria 10371
36 Ga0070673_100036063 3300005364 Unclassified 3755
37 Ga0070673_100103945 3300005364 Bacteria 2344
38 Ga0070659_100057752 3300005366 Unclassified 3060
39 Ga0070667_100001973 3300005367 Bacteria 18196
40 Ga0070667_100002334 3300005367 Bacteria 16608
41 Ga0070705_100151528 3300005440 Unclassified 1539
42 Ga0070694_100076212 3300005444 Unclassified 2321
43 Ga0070663_100250441 3300005455 Bacteria 1402
44 Ga0070678_100003792 3300005456 Bacteria 8480
45 Ga0070678_100210988 3300005456 Bacteria 1609
46 Ga0070662_100185279 3300005457 Bacteria 1643
47 Ga0070681_10045263 3300005458 Bacteria 4403
48 Ga0068867_100021587 3300005459 Bacteria 4596
49 Ga0068867_100036910 3300005459 Bacteria 3550
50 Ga0070685_10031350 3300005466 Bacteria 2969
51 Ga0070706_100041615 3300005467 Bacteria 4242
52 Ga0070698_100005333 3300005471 Bacteria 14073
53 Ga0070679_100028242 3300005530 Bacteria 5530
54 Ga0070679_100031513 3300005530 Bacteria 5238
55 Ga0070679_100064189 3300005530 Bacteria 3660
56 Ga0070684_100004037 3300005535 Bacteria 11107
57 Ga0070684_100034885 3300005535 Bacteria 4303
58 Ga0068853_100002852 3300005539 Bacteria 13101
59 Ga0068853_100010069 3300005539 Bacteria 7638
60 Ga0070672_100042963 3300005543 Bacteria 3482
61 Ga0070672_100090889 3300005543 Bacteria 2463
62 Ga0070672_100112074 3300005543 Bacteria 2225
63 Ga0070665_100000301 3300005548 Bacteria 77279
64 Ga0070665_100133704 3300005548 Unclassified 2482
65 Ga0070704_100009864 3300005549 Bacteria 5793
66 Ga0070704_100025422 3300005549 Bacteria 3899
67 Ga0068855_100014146 3300005563 Bacteria 9612
68 Ga0068855_100354614 3300005563 Bacteria 1615
69 Ga0068857_100009531 3300005577 Bacteria 8432
70 Ga0068854_100156616 3300005578 Bacteria 1760
71 Ga0068856_100014210 3300005614 Bacteria 7695
72 Ga0068856_100037016 3300005614 Bacteria 4786
73 Ga0070702_100072361 3300005615 Bacteria 2040
74 Ga0068852_100021159 3300005616 Bacteria 5185
75 Ga0068852_100036432 3300005616 Bacteria 4116
76 Ga0068859_100000002 3300005617 Bacteria 541370
77 Ga0068859_100018356 3300005617 Bacteria 7032
78 Ga0068859_100137829 3300005617 Unclassified 2514
79 Ga0068859_100407275 3300005617 Unclassified 1456
80 Ga0068864_100001927 3300005618 Bacteria 17038
81 Ga0068851_10002336 3300005834 Bacteria 8351
82 Ga0068851_10039399 3300005834 Bacteria 2373
83 Ga0068863_100011011 3300005841 Bacteria 8772
84 Ga0068863_100071654 3300005841 Unclassified 3278
85 Ga0068863_100106713 3300005841 Bacteria 2665
86 Ga0068863_100290953 3300005841 Unclassified 1583
87 Ga0068858_100000473 3300005842 Bacteria 41857
88 Ga0068858_100190825 3300005842 Bacteria 1936
89 Ga0068860_100036280 3300005843 Bacteria 4725
90 Ga0068860_100319940 3300005843 Bacteria 1523
91 Ga0068862_100196767 3300005844 Bacteria 1816
92 Ga0081455_10034229 3300005937 Bacteria 4554
93 Ga0070716_100016475 3300006173 Unclassified 3815
94 Ga0070712_100070858 3300006175 Unclassified 2492
95 Ga0075362_10023413 3300006177 Bacteria 2612
96 Ga0097621_100001985 3300006237 Bacteria 13953
97 Ga0068871_100012608 3300006358 Bacteria 6241
98 Ga0075434_100005159 3300006871 Bacteria 11859
99 Ga0075434_100330886 3300006871 Bacteria 1544
100 Ga0097620_100000002 3300006931 Bacteria 541370
101 Ga0097620_100018356 3300006931 Bacteria 7032
102 Ga0097620_100137818 3300006931 Unclassified 2514
103 Ga0097620_100407324 3300006931 Unclassified 1456
104 Ga0075435_100095090 3300007076 Bacteria 2464
105 Ga0105240_10001782 3300009093 Bacteria 36343
106 Ga0105240_10003129 3300009093 Bacteria 26063
107 Ga0105240_10184071 3300009093 Bacteria 2462
108 Ga0111539_10067790 3300009094 Bacteria 4213
109 Ga0111539_10102437 3300009094 Bacteria 3360
110 Ga0111539_10108180 3300009094 Bacteria 3262
111 Ga0111539_10399804 3300009094 Bacteria 1600
112 Ga0111539_10543375 3300009094 Bacteria 1354
113 Ga0114129_10386397 3300009147 Bacteria 1847
114 Ga0105243_10038280 3300009148 Bacteria 3734
115 Ga0105242_10120655 3300009176 Bacteria 2249
116 Ga0105248_10063295 3300009177 Bacteria 4152
117 Ga0105237_10010328 3300009545 Bacteria 9946
118 Ga0105238_10002126 3300009551 Bacteria 20001
119 Ga0105238_10003515 3300009551 Bacteria 15608
120 Ga0105238_10014217 3300009551 Bacteria 8049
121 Ga0105239_10001976 3300010375 Bacteria 26665
122 Ga0105239_10008528 3300010375 Bacteria 11647
123 Ga0105239_10041074 3300010375 Bacteria 5068
124 Ga0105239_10175944 3300010375 Bacteria 2393
125 Ga0105246_10010132 3300011119 Bacteria 5820
126 Ga0105246_10164171 3300011119 Bacteria 1695
127 Ga0157371_10084239 3300013102 Unclassified 2252
128 Ga0157370_10005678 3300013104 Bacteria 13949
129 Ga0157369_10006417 3300013105 Bacteria 13630
130 Ga0157369_10007537 3300013105 Bacteria 12522
131 Ga0157374_10002745 3300013296 Bacteria 14790
132 Ga0157374_10011366 3300013296 Bacteria 7704
133 Ga0157374_10115432 3300013296 Bacteria 2586
134 Ga0157374_10127274 3300013296 Bacteria 2463
135 Ga0157378_10269115 3300013297 Bacteria 1638
136 Ga0163162_10003958 3300013306 Bacteria 14211
137 Ga0163162_10146531 3300013306 Unclassified 2477
138 Ga0163162_10283901 3300013306 Bacteria 1787
139 Ga0157372_10054102 3300013307 Bacteria 4476
140 Ga0157375_10000116 3300013308 Bacteria 77874
141 Ga0157375_10008806 3300013308 Bacteria 8841
142 Ga0157375_10011076 3300013308 Bacteria 7951
143 Ga0157375_10064442 3300013308 Bacteria 3648
144 Ga0157375_10136091 3300013308 Bacteria 2581
145 Ga0157375_10255669 3300013308 Bacteria 1913
146 Ga0163163_10000414 3300014325 Bacteria 39905
147 Ga0163163_10027724 3300014325 Bacteria 5430
148 Ga0163163_10051699 3300014325 Bacteria 4051
149 Ga0163163_10064006 3300014325 Bacteria 3649
150 Ga0157377_10119820 3300014745 Bacteria 1593
151 Ga0157379_10000427 3300014968 Bacteria 33957
152 Ga0157379_10036124 3300014968 Bacteria 4406
153 Ga0157379_10056360 3300014968 Bacteria 3512
154 Ga0157379_10086691 3300014968 Unclassified 2807
155 Ga0157376_10030375 3300014969 Bacteria 4315
156 Ga0163161_10006494 3300017792 Bacteria 8096
157 Ga0163161_10015962 3300017792 Bacteria 5240
158 Ga0163161_10087292 3300017792 Bacteria 2304
159 Ga0207653_10038543 3300025885 Bacteria 1562
160 Ga0207680_10001303 3300025903 Bacteria 11812
161 Ga0207647_10000757 3300025904 Bacteria 25295
162 Ga0207647_10007195 3300025904 Bacteria 8061
163 Ga0207645_10021178 3300025907 Bacteria 4243
164 Ga0207654_10000152 3300025911 Bacteria 43823
165 Ga0207707_10002862 3300025912 Bacteria 15414
166 Ga0207707_10049931 3300025912 Bacteria 3645
167 Ga0207695_10006393 3300025913 Bacteria 15324
168 Ga0207695_10018454 3300025913 Bacteria 8070
169 Ga0207693_10022056 3300025915 Bacteria 5063
170 Ga0207660_10002524 3300025917 Bacteria 12025
171 Ga0207657_10001783 3300025919 Bacteria 23230
172 Ga0207657_10052604 3300025919 Bacteria 3533
173 Ga0207652_10001344 3300025921 Bacteria 21832
174 Ga0207652_10017558 3300025921 Bacteria 5857
175 Ga0207681_10209978 3300025923 Bacteria 1500
176 Ga0207694_10000106 3300025924 Bacteria 88467
177 Ga0207694_10005570 3300025924 Bacteria 9647
178 Ga0207694_10008016 3300025924 Bacteria 7988
179 Ga0207650_10049556 3300025925 Unclassified 3101
180 Ga0207650_10069985 3300025925 Bacteria 2636
181 Ga0207650_10203991 3300025925 Bacteria 1585
182 Ga0207659_10000493 3300025926 Bacteria 23772
183 Ga0207644_10006051 3300025931 Bacteria 7891
184 Ga0207644_10029304 3300025931 Unclassified 3818
185 Ga0207644_10114308 3300025931 Bacteria 2045
186 Ga0207644_10132200 3300025931 Bacteria 1912
187 Ga0207690_10044112 3300025932 Unclassified 2938
188 Ga0207706_10070480 3300025933 Bacteria 3075
189 Ga0207706_10147785 3300025933 Bacteria 2067
190 Ga0207706_10213760 3300025933 Bacteria 1690
191 Ga0207706_10260530 3300025933 Bacteria 1514
192 Ga0207709_10130332 3300025935 Bacteria 1713
193 Ga0207670_10008474 3300025936 Bacteria 5810
194 Ga0207670_10011900 3300025936 Archaea 5067
195 Ga0207670_10017626 3300025936 Bacteria 4319
196 Ga0207670_10019810 3300025936 Unclassified 4117
197 Ga0207669_10010519 3300025937 Bacteria 4457
198 Ga0207669_10112567 3300025937 Bacteria 1828
199 Ga0207704_10009957 3300025938 Bacteria 4613
200 Ga0207665_10027438 3300025939 Unclassified 3762
201 Ga0207691_10012081 3300025940 Bacteria 8281
202 Ga0207691_10018063 3300025940 Bacteria 6679
203 Ga0207691_10051347 3300025940 Bacteria 3770
204 Ga0207691_10057138 3300025940 Bacteria 3552
205 Ga0207711_10036584 3300025941 Bacteria 4166
206 Ga0207689_10064926 3300025942 Bacteria 3003
207 Ga0207661_10058434 3300025944 Bacteria 3104
208 Ga0207679_10026416 3300025945 Bacteria 4003
209 Ga0207667_10004104 3300025949 Bacteria 17899
210 Ga0207667_10013726 3300025949 Bacteria 9260
211 Ga0207667_10048203 3300025949 Bacteria 4505
212 Ga0207651_10009355 3300025960 Bacteria 5358
213 Ga0207651_10185271 3300025960 Bacteria 1655
214 Ga0207658_10001193 3300025986 Bacteria 20725
215 Ga0207658_10001416 3300025986 Bacteria 18701
216 Ga0207677_10006648 3300026023 Bacteria 6346
217 Ga0207703_10000556 3300026035 Bacteria 38283
218 Ga0207703_10361443 3300026035 Bacteria 1339
219 Ga0207639_10006415 3300026041 Bacteria 7995
220 Ga0207639_10013756 3300026041 Bacteria 5673
221 Ga0207678_10041965 3300026067 Bacteria 3966
222 Ga0207678_10060928 3300026067 Bacteria 3245
223 Ga0207708_10128813 3300026075 Bacteria 1977
224 Ga0207702_10000004 3300026078 Bacteria 422182
225 Ga0207641_10002344 3300026088 Bacteria 17526
226 Ga0207641_10085577 3300026088 Unclassified 2747
227 Ga0207641_10289702 3300026088 Bacteria 1543
228 Ga0207648_10011134 3300026089 Bacteria 8485
229 Ga0207648_10028232 3300026089 Bacteria 4975
230 Ga0207676_10001650 3300026095 Bacteria 16428
231 Ga0207674_10002762 3300026116 Bacteria 21898
232 Ga0207674_10098067 3300026116 Bacteria 2914
233 Ga0207683_10033454 3300026121 Bacteria 4465
234 Ga0207683_10130073 3300026121 Unclassified 2264
235 Ga0207698_10021486 3300026142 Bacteria 4465
236 Ga0209967_1002652 3300027364 Unclassified 2327
237 Ga0209981_1003241 3300027378 Unclassified 2109
238 Ga0209995_1000423 3300027471 Bacteria 6553
239 Ga0209968_1004294 3300027526 Unclassified 2139
240 Ga0209999_1000832 3300027543 Bacteria 5108
241 Ga0209982_1000444 3300027552 Bacteria 5096
242 Ga0210002_1003787 3300027617 Unclassified 2243
243 Ga0209983_1002294 3300027665 Bacteria 4196
244 Ga0209971_1000424 3300027682 Bacteria 11322
245 Ga0209966_1001034 3300027695 Bacteria 5172
246 Ga0209998_10000197 3300027717 Bacteria 21181
247 Ga0209974_10004276 3300027876 Bacteria 5094
248 Ga0268266_10001381 3300028379 Bacteria 29241
249 Ga0268266_10106999 3300028379 Unclassified 2473
250 Ga0268266_10203751 3300028379 Bacteria 1812
251 Ga0268265_10281085 3300028380 Bacteria 1489
252 Ga0268264_10027719 3300028381 Bacteria 4630
253 Ga0265338_10000190 3300028800 Bacteria 115665
254 Ga0265338_10045169 3300028800 Bacteria 4055
255 Ga0265332_10000393 3300031238 Bacteria 31844
256 Ga0265328_10003760 3300031239 Bacteria 6681
257 Ga0265320_10034704 3300031240 Unclassified 2563
258 Ga0265325_10000486 3300031241 Bacteria 28791
259 Ga0265329_10008310 3300031242 Unclassified 3944
260 Ga0265329_10026106 3300031242 Bacteria 1928
261 Ga0265339_10003239 3300031249 Bacteria 11421
262 Ga0265331_10000282 3300031250 Bacteria 56556
263 Ga0265331_10001956 3300031250 Bacteria 14384
264 Ga0265327_10029265 3300031251 Bacteria 3136
265 Ga0265316_10000114 3300031344 Bacteria 87072
266 Ga0265313_10000592 3300031595 Bacteria 37621
267 Ga0265313_10000622 3300031595 Bacteria 36655
268 Ga0316575_10017761 3300031665 Bacteria 2706
269 Ga0265314_10001579 3300031711 Bacteria 25027
270 Ga0265342_10010559 3300031712 Bacteria 6391
271 Ga0265342_10011327 3300031712 Bacteria 6113
272 Ga0307410_10158513 3300031852 Bacteria 1693
273 Ga0307412_10106342 3300031911 Bacteria 1995
274 Ga0307415_100160073 3300032126 Bacteria 1744
275 Ga0307510_10031798 3300033180 Bacteria 5953
276 Ga0373945_0007830 3300035116 Bacteria 3467
277 Ga0373943_0010543 3300035170 Bacteria 4142
278 Ga0373943_0113290 3300035170 Bacteria 1433
279 Ga0373946_0083824 3300035171 Bacteria 1401
280 Ga0316574_0015469 3300035398 Bacteria 4427
281 Ga0373931_0060066 3300035691 Bacteria 2046
282 Ga0373935_0005064 3300035692 Bacteria 7764
283 Ga0373927_0027083 3300035695 Bacteria 3745
284 Ga0373947_0018676 3300035725 Bacteria 3992
285 Ga0373947_0060173 3300035725 Unclassified 2305
286 Ga0373947_0095812 3300035725 Bacteria 1857
287 Ga0373937_0118189 3300036401 Unclassified 2469
288 Ga0373925_0007669 3300037068 Bacteria 7861
289 Ga0373925_0076567 3300037068 Bacteria 2537
290 Ga0373925_0102000 3300037068 Bacteria 2207
291 Ga0373925_0131626 3300037068 Bacteria 1951
292 Ga0395898_0117105 3300037466 Bacteria 2553
293 Ga0466963_0018557 3300044694 Bacteria 4351
294 Ga0466957_0005832 3300044842 Bacteria 6933
295 Ga0466957_0140235 3300044842 Bacteria 1557
296 Ga0466960_0014006 3300044901 Unclassified 3420
297 Ga0451576_0038024 3300045051 Bacteria 5095
298 Ga0451576_0267845 3300045051 Bacteria 1786
299 Ga0451576_0289743 3300045051 Bacteria 1712
300 Ga0466958_0011558 3300045836 Bacteria 4974
301 Ga0466967_0033533 3300045976 Bacteria 4347
302 Ga0466967_0067429 3300045976 Bacteria 3192
303 Ga0466967_0141782 3300045976 Bacteria 2239
304 Ga0495592_0047123 3300046454 Bacteria 3211
305 Ga0495629_0033781 3300046459 Bacteria 3617
306 Ga0495641_0023481 3300046461 Bacteria 3062
307 Ga0495651_0030155 3300046462 Bacteria 4229
308 Ga0495651_0115697 3300046462 Bacteria 1977
309 Ga0495653_0069880 3300046463 Bacteria 2629
310 Ga0495582_0057783 3300046473 Bacteria 2139
311 Ga0495618_0035157 3300046514 Bacteria 3145
312 Ga0495630_0032315 3300046517 Bacteria 3899
313 Ga0495666_0005629 3300046526 Bacteria 6306
314 Ga0495652_0038653 3300046529 Bacteria 4133
315 Ga0495640_0030671 3300046533 Bacteria 3847
316 Ga0495587_0062767 3300046536 Bacteria 2175
317 Ga0495667_0173823 3300046559 Unclassified 1384
318 Ga0495667_0211378 3300046559 Unclassified 1240
319 Ga0495656_0007522 3300046615 Bacteria 3852
320 Ga0495625_0033360 3300046660 Bacteria 3808
321 Ga0495657_0054069 3300046675 Bacteria 2684
322 Ga0495613_0040449 3300046689 Unclassified 3454
323 Ga0495604_0169710 3300047317 Bacteria 1536
324 Ga0495675_0016767 3300047444 Bacteria 4632
325 Ga0496100_0016857 3300048903 Bacteria 4298
326 Ga0496101_0003672 3300048904 Bacteria 9577
327 Ga0496102_0036756 3300048905 Bacteria 4414
328 Ga0496102_0067403 3300048905 Unclassified 3283
329 Ga0496103_0074033 3300048906 Bacteria 2134
330 Ga0496104_0049569 3300048907 Bacteria 3959
331 Ga0496105_0021966 3300048908 Bacteria 5166
332 Ga0496105_0063504 3300048908 Bacteria 3046
333 Ga0496106_0010840 3300048909 Bacteria 6735
334 Ga0496107_0012231 3300048910 Bacteria 5989
335 Ga0496108_0001296 3300048911 Bacteria 19637
336 Ga0496108_0031934 3300048911 Bacteria 4371
337 Ga0496108_0072591 3300048911 Unclassified 2905
338 Ga0496108_0169226 3300048911 Bacteria 1890
339 Ga0496109_0018129 3300048912 Bacteria 6181
340 Ga0496109_0071739 3300048912 Bacteria 3180
341 Ga0496109_0079718 3300048912 Bacteria 3017
342 Ga0496110_0035033 3300048913 Bacteria 4352
343 Ga0496112_0021548 3300048915 Bacteria 6130
344 Ga0496112_0178666 3300048915 Unclassified 2086
345 Ga0496113_0035786 3300048916 Bacteria 3633
346 Ga0496113_0093583 3300048916 Unclassified 2320
347 Ga0496113_0195429 3300048916 Unclassified 1607
348 Ga0496114_0013552 3300048917 Bacteria 6540
349 Ga0496114_0057403 3300048917 Bacteria 3250
350 Ga0496114_0096666 3300048917 Bacteria 2515
351 Ga0496115_0001600 3300048918 Bacteria 16275
352 Ga0501036_0261472 3300049572 Bacteria 1450
353 Ga0501039_0059055 3300049575 Bacteria 2971
354 Ga0501043_0147784 3300049579 Bacteria 1840
355 Ga0501047_0000016 3300049581 Bacteria 284621
356 Ga0501076_0260419 3300049592 Unclassified 1420
357 Ga0501081_0081385 3300049743 Bacteria 2268
358 nmdc:mga08y16_381442_c1 3300050511 Unclassified 1445
359 nmdc:mga08y16_384089_c1 3300050511 Unclassified 1439
360 nmdc:mga08y16_55028_c1 3300050511 Bacteria 4158
361 nmdc:mga08y16_61637_c1 3300050511 Bacteria 3916
362 nmdc:mga0n895_1136_c1 3300050512 Bacteria 19484
363 nmdc:mga0rr50_19177_c1 3300050513 Bacteria 4610
364 nmdc:mga0a205_1181_c1 3300050515 Bacteria 21801
365 Ga0495601_0070647 3300053077 Bacteria 2229
366 Ga0495619_0028988 3300053085 Bacteria 3574
367 Ga0495619_0034055 3300053085 Bacteria 3310
368 Ga0500627_0052818 3300053158 Unclassified 1774
369 Ga0466962_0057624 3300061719 Bacteria 1855
370 Ga0530510_0172710 3300061734 Unclassified 1601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0034055 Ga0495619_0034055_2244_3290 348
2 3300005329 Ga0070683_100165078 Ga0070683_1001650782 356
3 3300025944 Ga0207661_10058434 Ga0207661_100584342 356
4 3300025885 Ga0207653_10038543 Ga0207653_100385431 362
5 3300005456 Ga0070678_100210988 Ga0070678_1002109882 368
6 3300050511 nmdc:mga08y16_61637_c1 nmdc:mga08y16_61637_c1_26_1132 368
7 3300005327 Ga0070658_10113198 Ga0070658_101131981 371
8 3300009176 Ga0105242_10120655 Ga0105242_101206552 374
9 3300045976 Ga0466967_0033533 Ga0466967_0033533_3124_4275 376
10 3300013296 Ga0157374_10115432 Ga0157374_101154322 379
11 3300046559 Ga0495667_0211378 Ga0495667_0211378_76_1218 380
12 3300050511 nmdc:mga08y16_384089_c1 nmdc:mga08y16_384089_c1_265_1422 385
13 3300045051 Ga0451576_0289743 Ga0451576_0289743_366_1694 389
14 3300006177 Ga0075362_10023413 Ga0075362_100234134 394
15 3300061719 Ga0466962_0057624 Ga0466962_0057624_624_1817 397
16 3300035398 Ga0316574_0015469 Ga0316574_0015469_2787_4034 398
17 3300028800 Ga0265338_10000190 Ga0265338_1000019075 400
18 3300031241 Ga0265325_10000486 Ga0265325_100004867 400
19 3300031249 Ga0265339_10003239 Ga0265339_100032394 400
20 3300031595 Ga0265313_10000592 Ga0265313_1000059214 400
21 3300005535 Ga0070684_100034885 Ga0070684_1000348855 401
22 3300032126 Ga0307415_100160073 Ga0307415_1001600732 401
23 3300045976 Ga0466967_0141782 Ga0466967_0141782_217_1497 401
24 3300013308 Ga0157375_10011076 Ga0157375_100110764 403
25 3300046559 Ga0495667_0173823 Ga0495667_0173823_71_1321 404
26 3300049592 Ga0501076_0260419 Ga0501076_0260419_136_1392 404
27 3300061734 Ga0530510_0172710 Ga0530510_0172710_171_1427 404
28 3300005841 Ga0068863_100106713 Ga0068863_1001067132 407
29 3300005841 Ga0068863_100290953 Ga0068863_1002909532 407
30 3300026088 Ga0207641_10289702 Ga0207641_102897022 407
31 3300049581 Ga0501047_0000016 Ga0501047_0000016_81586_82854 407
32 3300005355 Ga0070671_100187249 Ga0070671_1001872492 408
33 3300005842 Ga0068858_100190825 Ga0068858_1001908252 408
34 3300013297 Ga0157378_10269115 Ga0157378_102691152 408
35 3300014968 Ga0157379_10086691 Ga0157379_100866911 408
36 3300026035 Ga0207703_10361443 Ga0207703_103614431 408
37 3300035691 Ga0373931_0060066 Ga0373931_0060066_251_1504 408
38 3300003349 JGI26129J50193_1001205 JGI26129J50193_10012051 410
39 3300005444 Ga0070694_100076212 Ga0070694_1000762124 410
40 3300013102 Ga0157371_10084239 Ga0157371_100842391 410
41 3300013307 Ga0157372_10054102 Ga0157372_100541022 410
42 3300027364 Ga0209967_1002652 Ga0209967_10026523 410
43 3300027378 Ga0209981_1003241 Ga0209981_10032412 410
44 3300027471 Ga0209995_1000423 Ga0209995_10004235 410
45 3300027526 Ga0209968_1004294 Ga0209968_10042942 410
46 3300027543 Ga0209999_1000832 Ga0209999_10008322 410
47 3300027552 Ga0209982_1000444 Ga0209982_10004442 410
48 3300027617 Ga0210002_1003787 Ga0210002_10037872 410
49 3300027665 Ga0209983_1002294 Ga0209983_10022942 410
50 3300027682 Ga0209971_1000424 Ga0209971_100042410 410
51 3300027695 Ga0209966_1001034 Ga0209966_10010344 410
52 3300027717 Ga0209998_10000197 Ga0209998_100001972 410
53 3300027876 Ga0209974_10004276 Ga0209974_100042762 410
54 3300031242 Ga0265329_10026106 Ga0265329_100261062 410
55 3300045051 Ga0451576_0038024 Ga0451576_0038024_1011_2264 410
56 3300049743 Ga0501081_0081385 Ga0501081_0081385_357_1610 410
57 3300005617 Ga0068859_100407275 Ga0068859_1004072751 411
58 3300006931 Ga0097620_100407324 Ga0097620_1004073241 411
59 3300049572 Ga0501036_0261472 Ga0501036_0261472_161_1414 411
60 3300005339 Ga0070660_100193619 Ga0070660_1001936192 412
61 3300005530 Ga0070679_100064189 Ga0070679_1000641895 412
62 3300025919 Ga0207657_10052604 Ga0207657_100526042 412
63 3300044842 Ga0466957_0005832 Ga0466957_0005832_884_2173 412
64 3300044901 Ga0466960_0014006 Ga0466960_0014006_1847_3112 413
65 3300005467 Ga0070706_100041615 Ga0070706_1000416152 414
66 3300005548 Ga0070665_100000301 Ga0070665_10000030127 415
67 3300028379 Ga0268266_10001381 Ga0268266_1000138110 415
68 3300031665 Ga0316575_10017761 Ga0316575_100177613 415
69 3300037466 Ga0395898_0117105 Ga0395898_0117105_713_1963 415
70 3300005353 Ga0070669_100137025 Ga0070669_1001370252 416
71 3300005440 Ga0070705_100151528 Ga0070705_1001515282 416
72 3300005543 Ga0070672_100042963 Ga0070672_1000429633 416
73 3300005549 Ga0070704_100009864 Ga0070704_1000098642 416
74 3300005617 Ga0068859_100000002 Ga0068859_100000002445 416
75 3300005843 Ga0068860_100319940 Ga0068860_1003199401 416
76 3300006931 Ga0097620_100000002 Ga0097620_10000000216 416
77 3300009094 Ga0111539_10067790 Ga0111539_100677902 416
78 3300009094 Ga0111539_10102437 Ga0111539_101024373 416
79 3300009147 Ga0114129_10386397 Ga0114129_103863971 416
80 3300013105 Ga0157369_10007537 Ga0157369_100075379 416
81 3300013296 Ga0157374_10127274 Ga0157374_101272742 416
82 3300025933 Ga0207706_10070480 Ga0207706_100704801 416
83 3300025940 Ga0207691_10057138 Ga0207691_100571381 416
84 3300026075 Ga0207708_10128813 Ga0207708_101288132 416
85 3300031238 Ga0265332_10000393 Ga0265332_1000039315 416
86 3300031239 Ga0265328_10003760 Ga0265328_100037607 416
87 3300031240 Ga0265320_10034704 Ga0265320_100347042 416
88 3300031242 Ga0265329_10008310 Ga0265329_100083102 416
89 3300031250 Ga0265331_10000282 Ga0265331_1000028230 416
90 3300031250 Ga0265331_10001956 Ga0265331_100019565 416
91 3300031251 Ga0265327_10029265 Ga0265327_100292652 416
92 3300031344 Ga0265316_10000114 Ga0265316_1000011454 416
93 3300031595 Ga0265313_10000622 Ga0265313_100006222 416
94 3300031711 Ga0265314_10001579 Ga0265314_1000157910 416
95 3300031712 Ga0265342_10010559 Ga0265342_100105592 416
96 3300031712 Ga0265342_10011327 Ga0265342_100113275 416
97 3300046462 Ga0495651_0115697 Ga0495651_0115697_702_1952 416
98 3300050511 nmdc:mga08y16_55028_c1 nmdc:mga08y16_55028_c1_2193_3443 416
99 3300005328 Ga0070676_10001390 Ga0070676_1000139016 417
100 3300005328 Ga0070676_10034613 Ga0070676_100346132 417
101 3300005328 Ga0070676_10037013 Ga0070676_100370132 417
102 3300005330 Ga0070690_100007000 Ga0070690_1000070004 417
103 3300005330 Ga0070690_100034794 Ga0070690_1000347942 417
104 3300005331 Ga0070670_100122781 Ga0070670_1001227811 417
105 3300005331 Ga0070670_100200469 Ga0070670_1002004692 417
106 3300005334 Ga0068869_100060025 Ga0068869_1000600254 417
107 3300005335 Ga0070666_10003153 Ga0070666_100031534 417
108 3300005340 Ga0070689_100050766 Ga0070689_1000507662 417
109 3300005354 Ga0070675_100007080 Ga0070675_1000070802 417
110 3300005354 Ga0070675_100033596 Ga0070675_1000335963 417
111 3300005364 Ga0070673_100003042 Ga0070673_1000030425 417
112 3300005364 Ga0070673_100103945 Ga0070673_1001039452 417
113 3300005367 Ga0070667_100001973 Ga0070667_1000019731 417
114 3300005367 Ga0070667_100002334 Ga0070667_1000023348 417
115 3300005456 Ga0070678_100003792 Ga0070678_1000037924 417
116 3300005459 Ga0068867_100021587 Ga0068867_1000215872 417
117 3300005459 Ga0068867_100036910 Ga0068867_1000369102 417
118 3300005466 Ga0070685_10031350 Ga0070685_100313502 417
119 3300005543 Ga0070672_100090889 Ga0070672_1000908892 417
120 3300005543 Ga0070672_100112074 Ga0070672_1001120742 417
121 3300005549 Ga0070704_100025422 Ga0070704_1000254223 417
122 3300005616 Ga0068852_100036432 Ga0068852_1000364322 417
123 3300005617 Ga0068859_100018356 Ga0068859_1000183564 417
124 3300005618 Ga0068864_100001927 Ga0068864_10000192712 417
125 3300005841 Ga0068863_100011011 Ga0068863_1000110114 417
126 3300005842 Ga0068858_100000473 Ga0068858_1000004736 417
127 3300005843 Ga0068860_100036280 Ga0068860_1000362802 417
128 3300006237 Ga0097621_100001985 Ga0097621_10000198512 417
129 3300006358 Ga0068871_100012608 Ga0068871_1000126083 417
130 3300006871 Ga0075434_100330886 Ga0075434_1003308861 417
131 3300006931 Ga0097620_100018356 Ga0097620_1000183564 417
132 3300009094 Ga0111539_10108180 Ga0111539_101081805 417
133 3300009094 Ga0111539_10543375 Ga0111539_105433751 417
134 3300009177 Ga0105248_10063295 Ga0105248_100632954 417
135 3300011119 Ga0105246_10164171 Ga0105246_101641711 417
136 3300013296 Ga0157374_10002745 Ga0157374_1000274511 417
137 3300013306 Ga0163162_10003958 Ga0163162_100039584 417
138 3300013308 Ga0157375_10000116 Ga0157375_1000011659 417
139 3300013308 Ga0157375_10008806 Ga0157375_100088066 417
140 3300014325 Ga0163163_10027724 Ga0163163_100277244 417
141 3300014745 Ga0157377_10119820 Ga0157377_101198201 417
142 3300014968 Ga0157379_10000427 Ga0157379_100004274 417
143 3300014968 Ga0157379_10036124 Ga0157379_100361242 417
144 3300014969 Ga0157376_10030375 Ga0157376_100303752 417
145 3300017792 Ga0163161_10006494 Ga0163161_100064942 417
146 3300017792 Ga0163161_10087292 Ga0163161_100872922 417
147 3300025903 Ga0207680_10001303 Ga0207680_100013034 417
148 3300025907 Ga0207645_10021178 Ga0207645_100211782 417
149 3300025923 Ga0207681_10209978 Ga0207681_102099781 417
150 3300025925 Ga0207650_10069985 Ga0207650_100699854 417
151 3300025925 Ga0207650_10203991 Ga0207650_102039911 417
152 3300025926 Ga0207659_10000493 Ga0207659_1000049320 417
153 3300025931 Ga0207644_10006051 Ga0207644_100060512 417
154 3300025931 Ga0207644_10114308 Ga0207644_101143082 417
155 3300025933 Ga0207706_10213760 Ga0207706_102137601 417
156 3300025933 Ga0207706_10260530 Ga0207706_102605301 417
157 3300025936 Ga0207670_10017626 Ga0207670_100176264 417
158 3300025937 Ga0207669_10010519 Ga0207669_100105194 417
159 3300025940 Ga0207691_10012081 Ga0207691_100120815 417
160 3300025940 Ga0207691_10018063 Ga0207691_100180632 417
161 3300025940 Ga0207691_10051347 Ga0207691_100513474 417
162 3300025941 Ga0207711_10036584 Ga0207711_100365844 417
163 3300025942 Ga0207689_10064926 Ga0207689_100649262 417
164 3300025960 Ga0207651_10009355 Ga0207651_100093553 417
165 3300025960 Ga0207651_10185271 Ga0207651_101852712 417
166 3300025986 Ga0207658_10001193 Ga0207658_1000119317 417
167 3300025986 Ga0207658_10001416 Ga0207658_1000141613 417
168 3300026023 Ga0207677_10006648 Ga0207677_100066487 417
169 3300026035 Ga0207703_10000556 Ga0207703_1000055634 417
170 3300026088 Ga0207641_10002344 Ga0207641_1000234411 417
171 3300026089 Ga0207648_10011134 Ga0207648_100111342 417
172 3300026089 Ga0207648_10028232 Ga0207648_100282324 417
173 3300026095 Ga0207676_10001650 Ga0207676_1000165012 417
174 3300026116 Ga0207674_10002762 Ga0207674_1000276215 417
175 3300026121 Ga0207683_10033454 Ga0207683_100334542 417
176 3300026142 Ga0207698_10021486 Ga0207698_100214864 417
177 3300028379 Ga0268266_10203751 Ga0268266_102037512 417
178 3300028381 Ga0268264_10027719 Ga0268264_100277192 417
179 3300031852 Ga0307410_10158513 Ga0307410_101585132 417
180 3300031911 Ga0307412_10106342 Ga0307412_101063422 417
181 3300035171 Ga0373946_0083824 Ga0373946_0083824_51_1304 417
182 3300036401 Ga0373937_0118189 Ga0373937_0118189_1202_2455 417
183 3300044842 Ga0466957_0140235 Ga0466957_0140235_115_1395 417
184 3300046454 Ga0495592_0047123 Ga0495592_0047123_1867_3120 417
185 3300046462 Ga0495651_0030155 Ga0495651_0030155_2917_4170 417
186 3300046463 Ga0495653_0069880 Ga0495653_0069880_95_1348 417
187 3300046514 Ga0495618_0035157 Ga0495618_0035157_254_1531 417
188 3300046529 Ga0495652_0038653 Ga0495652_0038653_2776_4029 417
189 3300046536 Ga0495587_0062767 Ga0495587_0062767_312_1565 417
190 3300046615 Ga0495656_0007522 Ga0495656_0007522_1890_3146 417
191 3300047444 Ga0495675_0016767 Ga0495675_0016767_1220_2473 417
192 3300048911 Ga0496108_0031934 Ga0496108_0031934_277_1530 417
193 3300048912 Ga0496109_0018129 Ga0496109_0018129_1890_3143 417
194 3300053077 Ga0495601_0070647 Ga0495601_0070647_593_1846 417
195 3300005937 Ga0081455_10034229 Ga0081455_100342292 418
196 3300014325 Ga0163163_10000414 Ga0163163_1000041425 418
197 3300035725 Ga0373947_0095812 Ga0373947_0095812_379_1668 418
198 3300046675 Ga0495657_0054069 Ga0495657_0054069_76_1332 418
199 3300005455 Ga0070663_100250441 Ga0070663_1002504411 419
200 3300005615 Ga0070702_100072361 Ga0070702_1000723612 419
201 3300009148 Ga0105243_10038280 Ga0105243_100382801 419
202 3300013308 Ga0157375_10255669 Ga0157375_102556692 419
203 3300014325 Ga0163163_10064006 Ga0163163_100640062 419
204 3300017792 Ga0163161_10015962 Ga0163161_100159624 419
205 3300025935 Ga0207709_10130332 Ga0207709_101303321 419
206 3300025937 Ga0207669_10112567 Ga0207669_101125672 419
207 3300026067 Ga0207678_10060928 Ga0207678_100609282 419
208 3300044694 Ga0466963_0018557 Ga0466963_0018557_86_1348 419
209 3300045836 Ga0466958_0011558 Ga0466958_0011558_2756_4018 419
210 3300047317 Ga0495604_0169710 Ga0495604_0169710_71_1330 419
211 3300048905 Ga0496102_0067403 Ga0496102_0067403_1562_2830 419
212 3300048908 Ga0496105_0063504 Ga0496105_0063504_1161_2429 419
213 3300048911 Ga0496108_0072591 Ga0496108_0072591_1396_2664 419
214 3300048911 Ga0496108_0169226 Ga0496108_0169226_494_1756 419
215 3300048912 Ga0496109_0071739 Ga0496109_0071739_1735_3003 419
216 3300048916 Ga0496113_0093583 Ga0496113_0093583_312_1580 419
217 3300048917 Ga0496114_0013552 Ga0496114_0013552_2206_3474 419
218 3300049575 Ga0501039_0059055 Ga0501039_0059055_1168_2433 419
219 3300049579 Ga0501043_0147784 Ga0501043_0147784_256_1521 419
220 3300001979 JGI24740J21852_10022019 JGI24740J21852_100220192 420
221 3300002067 JGI24735J21928_10010659 JGI24735J21928_100106592 420
222 3300005327 Ga0070658_10049408 Ga0070658_100494082 420
223 3300005329 Ga0070683_100044045 Ga0070683_1000440454 420
224 3300005331 Ga0070670_100016336 Ga0070670_1000163362 420
225 3300005336 Ga0070680_100017656 Ga0070680_1000176562 420
226 3300005339 Ga0070660_100005375 Ga0070660_1000053758 420
227 3300005340 Ga0070689_100025014 Ga0070689_1000250143 420
228 3300005355 Ga0070671_100096531 Ga0070671_1000965312 420
229 3300005364 Ga0070673_100036063 Ga0070673_1000360638 420
230 3300005366 Ga0070659_100057752 Ga0070659_1000577522 420
231 3300005458 Ga0070681_10045263 Ga0070681_100452634 420
232 3300005471 Ga0070698_100005333 Ga0070698_10000533314 420
233 3300005530 Ga0070679_100028242 Ga0070679_1000282423 420
234 3300005530 Ga0070679_100031513 Ga0070679_1000315133 420
235 3300005535 Ga0070684_100004037 Ga0070684_1000040374 420
236 3300005539 Ga0068853_100002852 Ga0068853_1000028522 420
237 3300005548 Ga0070665_100133704 Ga0070665_1001337041 420
238 3300005616 Ga0068852_100021159 Ga0068852_1000211592 420
239 3300005841 Ga0068863_100071654 Ga0068863_1000716544 420
240 3300006871 Ga0075434_100005159 Ga0075434_1000051596 420
241 3300007076 Ga0075435_100095090 Ga0075435_1000950902 420
242 3300009093 Ga0105240_10003129 Ga0105240_1000312911 420
243 3300009094 Ga0111539_10399804 Ga0111539_103998042 420
244 3300009545 Ga0105237_10010328 Ga0105237_100103283 420
245 3300009551 Ga0105238_10003515 Ga0105238_100035157 420
246 3300010375 Ga0105239_10008528 Ga0105239_100085284 420
247 3300013104 Ga0157370_10005678 Ga0157370_1000567810 420
248 3300013105 Ga0157369_10006417 Ga0157369_100064177 420
249 3300025904 Ga0207647_10007195 Ga0207647_100071956 420
250 3300025912 Ga0207707_10002862 Ga0207707_1000286212 420
251 3300025912 Ga0207707_10049931 Ga0207707_100499313 420
252 3300025917 Ga0207660_10002524 Ga0207660_100025249 420
253 3300025919 Ga0207657_10001783 Ga0207657_1000178315 420
254 3300025921 Ga0207652_10001344 Ga0207652_1000134414 420
255 3300025921 Ga0207652_10017558 Ga0207652_100175583 420
256 3300025924 Ga0207694_10005570 Ga0207694_100055708 420
257 3300025925 Ga0207650_10049556 Ga0207650_100495562 420
258 3300025931 Ga0207644_10029304 Ga0207644_100293046 420
259 3300025932 Ga0207690_10044112 Ga0207690_100441122 420
260 3300025936 Ga0207670_10008474 Ga0207670_100084745 420
261 3300025936 Ga0207670_10011900 Ga0207670_100119004 420
262 3300025949 Ga0207667_10004104 Ga0207667_100041049 420
263 3300026041 Ga0207639_10013756 Ga0207639_100137562 420
264 3300026088 Ga0207641_10085577 Ga0207641_100855771 420
265 3300028379 Ga0268266_10106999 Ga0268266_101069991 420
266 3300045976 Ga0466967_0067429 Ga0466967_0067429_1424_2722 420
267 3300048915 Ga0496112_0178666 Ga0496112_0178666_309_1577 420
268 3300050511 nmdc:mga08y16_381442_c1 nmdc:mga08y16_381442_c1_24_1322 420
269 3300050512 nmdc:mga0n895_1136_c1 nmdc:mga0n895_1136_c1_10851_12149 420
270 3300050513 nmdc:mga0rr50_19177_c1 nmdc:mga0rr50_19177_c1_2878_4176 420
271 3300050515 nmdc:mga0a205_1181_c1 nmdc:mga0a205_1181_c1_12492_13790 420
272 3300053085 Ga0495619_0028988 Ga0495619_0028988_1972_3234 420
273 3300005344 Ga0070661_100234933 Ga0070661_1002349332 421
274 3300005834 Ga0068851_10039399 Ga0068851_100393993 421
275 3300010375 Ga0105239_10041074 Ga0105239_100410742 421
276 3300011119 Ga0105246_10010132 Ga0105246_100101324 421
277 3300013296 Ga0157374_10011366 Ga0157374_100113662 421
278 3300013306 Ga0163162_10283901 Ga0163162_102839012 421
279 3300013308 Ga0157375_10064442 Ga0157375_100644423 421
280 3300014325 Ga0163163_10051699 Ga0163163_100516992 421
281 3300014968 Ga0157379_10056360 Ga0157379_100563603 421
282 3300025938 Ga0207704_10009957 Ga0207704_100099572 421
283 3300025945 Ga0207679_10026416 Ga0207679_100264162 421
284 3300026121 Ga0207683_10130073 Ga0207683_101300732 421
285 3300033180 Ga0307510_10031798 Ga0307510_100317984 421
286 3300035116 Ga0373945_0007830 Ga0373945_0007830_1957_3222 421
287 3300035170 Ga0373943_0010543 Ga0373943_0010543_2000_3265 421
288 3300035692 Ga0373935_0005064 Ga0373935_0005064_5217_6482 421
289 3300035695 Ga0373927_0027083 Ga0373927_0027083_2173_3438 421
290 3300035725 Ga0373947_0018676 Ga0373947_0018676_1269_2534 421
291 3300037068 Ga0373925_0007669 Ga0373925_0007669_2793_4058 421
292 3300037068 Ga0373925_0131626 Ga0373925_0131626_533_1798 421
293 3300046517 Ga0495630_0032315 Ga0495630_0032315_1606_2871 421
294 3300046526 Ga0495666_0005629 Ga0495666_0005629_2364_3629 421
295 3300046660 Ga0495625_0033360 Ga0495625_0033360_537_1802 421
296 3300048903 Ga0496100_0016857 Ga0496100_0016857_2539_3804 421
297 3300048904 Ga0496101_0003672 Ga0496101_0003672_123_1388 421
298 3300048905 Ga0496102_0036756 Ga0496102_0036756_2159_3424 421
299 3300048906 Ga0496103_0074033 Ga0496103_0074033_223_1488 421
300 3300048907 Ga0496104_0049569 Ga0496104_0049569_1816_3081 421
301 3300048908 Ga0496105_0021966 Ga0496105_0021966_2354_3619 421
302 3300048909 Ga0496106_0010840 Ga0496106_0010840_3417_4682 421
303 3300048910 Ga0496107_0012231 Ga0496107_0012231_3059_4324 421
304 3300048911 Ga0496108_0001296 Ga0496108_0001296_5772_7037 421
305 3300048912 Ga0496109_0079718 Ga0496109_0079718_955_2220 421
306 3300048913 Ga0496110_0035033 Ga0496110_0035033_899_2164 421
307 3300048915 Ga0496112_0021548 Ga0496112_0021548_3106_4371 421
308 3300048916 Ga0496113_0035786 Ga0496113_0035786_1967_3232 421
309 3300048916 Ga0496113_0195429 Ga0496113_0195429_183_1448 421
310 3300048917 Ga0496114_0057403 Ga0496114_0057403_683_1948 421
311 3300048917 Ga0496114_0096666 Ga0496114_0096666_493_1758 421
312 3300048918 Ga0496115_0001600 Ga0496115_0001600_12516_13781 421
313 3300001989 JGI24739J22299_10002652 JGI24739J22299_100026523 422
314 3300002067 JGI24735J21928_10008756 JGI24735J21928_100087563 422
315 3300005355 Ga0070671_100038827 Ga0070671_1000388272 422
316 3300005355 Ga0070671_100157130 Ga0070671_1001571302 422
317 3300005457 Ga0070662_100185279 Ga0070662_1001852792 422
318 3300005563 Ga0068855_100014146 Ga0068855_1000141468 422
319 3300005577 Ga0068857_100009531 Ga0068857_1000095318 422
320 3300005578 Ga0068854_100156616 Ga0068854_1001566162 422
321 3300005614 Ga0068856_100037016 Ga0068856_1000370162 422
322 3300005617 Ga0068859_100137829 Ga0068859_1001378292 422
323 3300005844 Ga0068862_100196767 Ga0068862_1001967672 422
324 3300006173 Ga0070716_100016475 Ga0070716_1000164752 422
325 3300006175 Ga0070712_100070858 Ga0070712_1000708582 422
326 3300006931 Ga0097620_100137818 Ga0097620_1001378182 422
327 3300009093 Ga0105240_10001782 Ga0105240_1000178220 422
328 3300009551 Ga0105238_10014217 Ga0105238_100142175 422
329 3300010375 Ga0105239_10001976 Ga0105239_1000197615 422
330 3300013306 Ga0163162_10146531 Ga0163162_101465311 422
331 3300013308 Ga0157375_10136091 Ga0157375_101360912 422
332 3300025904 Ga0207647_10000757 Ga0207647_1000075721 422
333 3300025913 Ga0207695_10018454 Ga0207695_100184548 422
334 3300025915 Ga0207693_10022056 Ga0207693_100220564 422
335 3300025924 Ga0207694_10008016 Ga0207694_100080164 422
336 3300025931 Ga0207644_10132200 Ga0207644_101322002 422
337 3300025933 Ga0207706_10147785 Ga0207706_101477852 422
338 3300025936 Ga0207670_10019810 Ga0207670_100198106 422
339 3300025939 Ga0207665_10027438 Ga0207665_100274383 422
340 3300025949 Ga0207667_10013726 Ga0207667_100137265 422
341 3300026116 Ga0207674_10098067 Ga0207674_100980672 422
342 3300028380 Ga0268265_10281085 Ga0268265_102810852 422
343 3300028800 Ga0265338_10045169 Ga0265338_100451692 422
344 3300035170 Ga0373943_0113290 Ga0373943_0113290_61_1329 422
345 3300035725 Ga0373947_0060173 Ga0373947_0060173_937_2205 422
346 3300037068 Ga0373925_0076567 Ga0373925_0076567_584_1852 422
347 3300037068 Ga0373925_0102000 Ga0373925_0102000_446_1714 422
348 3300046459 Ga0495629_0033781 Ga0495629_0033781_294_1562 422
349 3300046461 Ga0495641_0023481 Ga0495641_0023481_141_1475 422
350 3300046473 Ga0495582_0057783 Ga0495582_0057783_716_1984 422
351 3300046533 Ga0495640_0030671 Ga0495640_0030671_537_1871 422
352 3300046689 Ga0495613_0040449 Ga0495613_0040449_1934_3268 422
353 3300053158 Ga0500627_0052818 Ga0500627_0052818_401_1672 422
354 3300001979 JGI24740J21852_10002108 JGI24740J21852_100021084 423
355 3300005340 Ga0070689_100015260 Ga0070689_1000152605 423
356 3300005539 Ga0068853_100010069 Ga0068853_1000100695 423
357 3300005563 Ga0068855_100354614 Ga0068855_1003546141 423
358 3300005614 Ga0068856_100014210 Ga0068856_1000142104 423
359 3300005834 Ga0068851_10002336 Ga0068851_1000233610 423
360 3300009093 Ga0105240_10184071 Ga0105240_101840711 423
361 3300009551 Ga0105238_10002126 Ga0105238_1000212615 423
362 3300010375 Ga0105239_10175944 Ga0105239_101759441 423
363 3300025911 Ga0207654_10000152 Ga0207654_1000015215 423
364 3300025913 Ga0207695_10006393 Ga0207695_1000639311 423
365 3300025924 Ga0207694_10000106 Ga0207694_1000010626 423
366 3300025949 Ga0207667_10048203 Ga0207667_100482035 423
367 3300026041 Ga0207639_10006415 Ga0207639_100064154 423
368 3300026067 Ga0207678_10041965 Ga0207678_100419652 423
369 3300026078 Ga0207702_10000004 Ga0207702_1000000426 423
370 3300045051 Ga0451576_0267845 Ga0451576_0267845_283_1593 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

313

396

0.94

PF01326

PPDK_N

Pyruvate phosphate dikinase, AMP/ATP-binding domain

39

281

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8em8-assembly1.cif.gz_A co-crystal structure of the cgmp-dependent protein kinase pkg from plasmodium falciparum in complex with ry-1-165 0.9619 288 387
5l0n-assembly1.cif.gz_A pkg i's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with rp-cgmp 0.9596 287 395
5dyk-assembly1.cif.gz_A crystal structure of the cgmp-dependent protein kinase pkg from plasmodium falciparum - apo form 0.9557 288 387
4ku8-assembly3.cif.gz_C structures of pkgi reveal a cgmp-selective activation mechanism 0.9517 287 396
3co2-assembly1.cif.gz_C mlotik1 ion channel cyclic-nucleotide binding domain mutant 0.9437 287 398
ID Description Score Start End Superfamily
af_Q8I719_160_276_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9563 288 387 2.60.120.10
af_Q8WZA2_373_503_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9533 314 396 2.60.120.10
4wbbA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9511 294 394 2.60.120.10
5jr7D02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9504 294 393 2.60.120.10
af_Q9HEW1_180_318_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9476 288 391 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W1K5U3-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9882 287 420 GO:0004862
GO:0005829
GO:0005952
GO:0030552
GO:0034236
AF-A0A0S7Z0X4-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9767 286 422 GO:0005829
AF-A0A521S685-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9693 287 418 GO:0005221
GO:0044877
AF-A0A250WPY2-F1-model_v4 cGMP-dependent protein kinase (EC 2.7.11.12) 0.9672 287 387 GO:0004691
GO:0004692
GO:0005524
GO:0005952
AF-A0A521C9S2-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.962 287 420 GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
83.94 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map