F425206

General Info

Members Datasets Scaffolds Average Seq Length
369 138 738 242

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_137971_c1|nmdc:mga09592_137971_c1_93_890
Length 265
Sequence MSTQMSTPTVTTDAQSIHGGDMQHSTRLTHFERFAMAWVMTLLVPGISLAQRTSVARDFPVYDNAGTPDLVMDAQRFVAQMEIVDRYFDPTDCAIAEGVVGGSGYRRLLRFDTVVMNRGDGDLIVGDRSDPNNRYAAYFVFHPCHGHYHIKDFSSYELLTPVGGFVVAGTKQGFCFEDSFKYEDGGKSSGYDCHDQGITAGWGDWYYKQLVGQWIDITGVPAGEYTVRVTLNSGGIFSEGENRYSNVTQVRIKVPDPRNKVAIVQ

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
123 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
129 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
130 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
131 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
132 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 99.73
Stem 0
Stem Tuber 0
Unclassified 25.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_137971_c1 3300050508 Bacteria 2101
2 MRS1b_contig_755022 2162886011 Unclassified 1151
3 CNAas_1001173 3300000532 Bacteria 2373
4 Ga0065714_10002183 3300005288 Bacteria 378167
5 Ga0065704_10082718 3300005289 Bacteria 3561
6 Ga0065704_10174140 3300005289 Unclassified 1274
7 Ga0065704_10204816 3300005289 Unclassified 1131
8 Ga0065704_10220817 3300005289 Bacteria 1075
9 Ga0065712_10000030 3300005290 Bacteria 237869
10 Ga0065712_10020985 3300005290 Unclassified 1341
11 Ga0065712_10117287 3300005290 Bacteria 1710
12 Ga0065712_10181725 3300005290 Bacteria 1171
13 Ga0065715_10093451 3300005293 Unclassified 4675
14 Ga0065715_10096921 3300005293 Bacteria 3791
15 Ga0065715_10099861 3300005293 Bacteria 3338
16 Ga0065715_10141798 3300005293 Bacteria 1842
17 Ga0065715_10196634 3300005293 Unclassified 1384
18 Ga0065715_10224874 3300005293 Unclassified 1257
19 Ga0065715_10296599 3300005293 Bacteria 1029
20 Ga0065707_10009015 3300005295 Bacteria 3668
21 Ga0065707_10084121 3300005295 Bacteria 7671
22 Ga0065707_10099064 3300005295 Bacteria 3034
23 Ga0065707_10133722 3300005295 Bacteria 1804
24 Ga0065707_10268538 3300005295 Bacteria 1077
25 Ga0070676_10024867 3300005328 Bacteria 3379
26 Ga0070690_100152424 3300005330 Unclassified 1578
27 Ga0070690_100301799 3300005330 Unclassified 1149
28 Ga0070670_100196036 3300005331 Unclassified 1755
29 Ga0070677_10016052 3300005333 Bacteria 2662
30 Ga0070677_10045692 3300005333 Bacteria 1748
31 Ga0068869_100033884 3300005334 Bacteria 3609
32 Ga0068869_100091763 3300005334 Unclassified 2285
33 Ga0068869_100192958 3300005334 Bacteria 1602
34 Ga0070666_10404142 3300005335 Unclassified 982
35 Ga0070680_100031194 3300005336 Bacteria 4285
36 Ga0070680_100237844 3300005336 Unclassified 1539
37 Ga0070692_10061250 3300005345 Bacteria 1983
38 Ga0070668_100506242 3300005347 Bacteria 1046
39 Ga0070669_100005503 3300005353 Bacteria 9140
40 Ga0070669_100034086 3300005353 Bacteria 3686
41 Ga0070669_100111023 3300005353 Bacteria 2081
42 Ga0070675_100000824 3300005354 Bacteria 21875
43 Ga0070675_100012182 3300005354 Bacteria 6742
44 Ga0070675_100073027 3300005354 Bacteria 2848
45 Ga0070675_100158984 3300005354 Bacteria 1942
46 Ga0070675_100553846 3300005354 Unclassified 1040
47 Ga0070674_100205608 3300005356 Unclassified 1523
48 Ga0070673_100108137 3300005364 Bacteria 2302
49 Ga0070673_100127835 3300005364 Bacteria 2128
50 Ga0070673_100353888 3300005364 Bacteria 1304
51 Ga0070688_100139125 3300005365 Bacteria 1647
52 Ga0070701_10032798 3300005438 Bacteria 2589
53 Ga0070701_10316905 3300005438 Bacteria 964
54 Ga0070705_100074603 3300005440 Bacteria 2063
55 Ga0070705_100137118 3300005440 Unclassified 1605
56 Ga0070705_100221222 3300005440 Bacteria 1311
57 Ga0070705_100296919 3300005440 Unclassified 1156
58 Ga0070700_100018126 3300005441 Bacteria 4041
59 Ga0070700_100072173 3300005441 Bacteria 2206
60 Ga0070700_100236134 3300005441 Bacteria 1304
61 Ga0070700_100306085 3300005441 Bacteria 1162
62 Ga0070694_100021468 3300005444 Bacteria 4126
63 Ga0070678_100017393 3300005456 Bacteria 4628
64 Ga0070678_100168550 3300005456 Bacteria 1781
65 Ga0070662_100101477 3300005457 Bacteria 2178
66 Ga0068867_100060121 3300005459 Bacteria 2818
67 Ga0068867_100076435 3300005459 Bacteria 2514
68 Ga0070706_100008703 3300005467 Bacteria 9459
69 Ga0070706_100308608 3300005467 Unclassified 1476
70 Ga0070706_100422326 3300005467 Bacteria 1241
71 Ga0070707_100231435 3300005468 Unclassified 1799
72 Ga0070698_100022402 3300005471 Bacteria 6610
73 Ga0070698_100074266 3300005471 Unclassified 3405
74 Ga0070698_100133888 3300005471 Bacteria 2433
75 Ga0070697_100000512 3300005536 Bacteria 29346
76 Ga0070672_100123172 3300005543 Bacteria 2124
77 Ga0070695_100095431 3300005545 Unclassified 1993
78 Ga0070695_100287365 3300005545 Unclassified 1211
79 Ga0070696_100040251 3300005546 Bacteria 3227
80 Ga0070696_100143144 3300005546 Bacteria 1749
81 Ga0070696_100166524 3300005546 Bacteria 1627
82 Ga0070696_100418833 3300005546 Unclassified 1051
83 Ga0070693_100153562 3300005547 Unclassified 1460
84 Ga0070704_100154079 3300005549 Unclassified 1810
85 Ga0070704_100183285 3300005549 Unclassified 1677
86 Ga0070704_100355928 3300005549 Bacteria 1237
87 Ga0070704_100373692 3300005549 Bacteria 1209
88 Ga0070704_100476644 3300005549 Unclassified 1079
89 Ga0068857_100134622 3300005577 Unclassified 2231
90 Ga0068854_100018111 3300005578 Unclassified 4723
91 Ga0068854_100391185 3300005578 Bacteria 1148
92 Ga0068859_100004552 3300005617 Bacteria 14139
93 Ga0068859_100035406 3300005617 Bacteria 5009
94 Ga0068859_100073029 3300005617 Bacteria 3468
95 Ga0068859_100248706 3300005617 Bacteria 1868
96 Ga0068859_100343041 3300005617 Unclassified 1588
97 Ga0068864_100137519 3300005618 Bacteria 2201
98 Ga0068864_100380706 3300005618 Unclassified 1337
99 Ga0068861_100002001 3300005719 Bacteria 13180
100 Ga0068861_100002496 3300005719 Bacteria 12003
101 Ga0068861_100137487 3300005719 Unclassified 1990
102 Ga0068861_100259233 3300005719 Bacteria 1488
103 Ga0068870_10007340 3300005840 Bacteria 4911
104 Ga0068870_10034259 3300005840 Bacteria 2598
105 Ga0068870_10117323 3300005840 Unclassified 1528
106 Ga0068863_100030545 3300005841 Bacteria 5144
107 Ga0068863_100260456 3300005841 Bacteria 1676
108 Ga0068863_100607744 3300005841 Unclassified 1083
109 Ga0068858_100026251 3300005842 Bacteria 5415
110 Ga0068858_100037321 3300005842 Unclassified 4506
111 Ga0068858_100163508 3300005842 Bacteria 2096
112 Ga0068858_100822460 3300005842 Unclassified 907
113 Ga0068860_100013666 3300005843 Bacteria 7959
114 Ga0068860_100154035 3300005843 Bacteria 2214
115 Ga0068862_100011675 3300005844 Bacteria 7248
116 Ga0068862_100013145 3300005844 Bacteria 6847
117 Ga0068862_100026309 3300005844 Bacteria 4890
118 Ga0068862_100058430 3300005844 Bacteria 3308
119 Ga0068862_100065463 3300005844 Unclassified 3130
120 Ga0068862_100449045 3300005844 Bacteria 1215
121 Ga0068862_101009754 3300005844 Unclassified 823
122 Ga0097621_100066257 3300006237 Bacteria 2974
123 Ga0097621_100422997 3300006237 Unclassified 1196
124 Ga0068871_100013489 3300006358 Bacteria 6066
125 Ga0068871_100641434 3300006358 Bacteria 969
126 Ga0075428_100000354 3300006844 Bacteria 45507
127 Ga0075428_100000985 3300006844 Bacteria 30151
128 Ga0075428_100006867 3300006844 Bacteria 12646
129 Ga0075428_100027834 3300006844 Bacteria 6254
130 Ga0075428_100086807 3300006844 Bacteria 3413
131 Ga0075428_100526319 3300006844 Bacteria 1264
132 Ga0075428_100633086 3300006844 Unclassified 1141
133 Ga0075428_100728547 3300006844 Bacteria 1056
134 Ga0075430_100120513 3300006846 Bacteria 2187
135 Ga0075430_100162015 3300006846 Bacteria 1862
136 Ga0075431_100024673 3300006847 Bacteria 6165
137 Ga0075431_100062318 3300006847 Unclassified 3848
138 Ga0075431_100074597 3300006847 Unclassified 3500
139 Ga0075431_100118075 3300006847 Bacteria 2737
140 Ga0075431_100221749 3300006847 Bacteria 1929
141 Ga0075431_100701986 3300006847 Bacteria 989
142 Ga0075431_100760147 3300006847 Unclassified 944
143 Ga0075433_10015134 3300006852 Bacteria 6320
144 Ga0075433_10029433 3300006852 Bacteria 4679
145 Ga0075433_10053506 3300006852 Bacteria 3520
146 Ga0075433_10241320 3300006852 Bacteria 1604
147 Ga0075434_100274298 3300006871 Bacteria 1706
148 Ga0075429_100017077 3300006880 Bacteria 6275
149 Ga0075429_100049288 3300006880 Unclassified 3662
150 Ga0075429_100087638 3300006880 Unclassified 2713
151 Ga0075429_100107588 3300006880 Bacteria 2437
152 Ga0075429_100111739 3300006880 Unclassified 2388
153 Ga0075429_100114182 3300006880 Bacteria 2361
154 Ga0068865_100137689 3300006881 Bacteria 1837
155 Ga0097620_100004552 3300006931 Bacteria 14139
156 Ga0097620_100035406 3300006931 Bacteria 5009
157 Ga0097620_100073030 3300006931 Bacteria 3468
158 Ga0097620_100248697 3300006931 Bacteria 1868
159 Ga0097620_100343054 3300006931 Unclassified 1588
160 Ga0097620_100712266 3300006931 Bacteria 1094
161 Ga0075435_100161408 3300007076 Bacteria 1888
162 Ga0111539_10000567 3300009094 Bacteria 47359
163 Ga0111539_10000604 3300009094 Bacteria 46424
164 Ga0111539_10004773 3300009094 Bacteria 17695
165 Ga0111539_10007780 3300009094 Bacteria 13684
166 Ga0111539_10010489 3300009094 Bacteria 11659
167 Ga0111539_10016883 3300009094 Bacteria 9041
168 Ga0111539_10056401 3300009094 Bacteria 4669
169 Ga0111539_10065500 3300009094 Bacteria 4292
170 Ga0111539_10066992 3300009094 Bacteria 4241
171 Ga0111539_10074682 3300009094 Bacteria 3994
172 Ga0111539_10096297 3300009094 Bacteria 3476
173 Ga0111539_10123214 3300009094 Unclassified 3038
174 Ga0111539_10474322 3300009094 Bacteria 1457
175 Ga0111539_11212307 3300009094 Bacteria 876
176 Ga0105245_10163693 3300009098 Bacteria 2112
177 Ga0105245_11017708 3300009098 Unclassified 873
178 Ga0105247_10048684 3300009101 Bacteria 2604
179 Ga0105247_10263576 3300009101 Bacteria 1182
180 Ga0114129_10027411 3300009147 Bacteria 8065
181 Ga0114129_10033486 3300009147 Bacteria 7262
182 Ga0114129_10097124 3300009147 Unclassified 4078
183 Ga0114129_10404600 3300009147 Bacteria 1798
184 Ga0114129_10598544 3300009147 Bacteria 1429
185 Ga0114129_11059595 3300009147 Unclassified 1017
186 Ga0105243_10000597 3300009148 Bacteria 36133
187 Ga0105243_10009732 3300009148 Bacteria 7322
188 Ga0105243_10147378 3300009148 Bacteria 2015
189 Ga0105241_10050877 3300009174 Bacteria 3158
190 Ga0105241_10058466 3300009174 Bacteria 2961
191 Ga0105242_10000596 3300009176 Bacteria 28370
192 Ga0105242_10227856 3300009176 Unclassified 1669
193 Ga0105242_10333801 3300009176 Unclassified 1395
194 Ga0105248_10191591 3300009177 Unclassified 2304
195 Ga0105248_10355769 3300009177 Bacteria 1649
196 Ga0105248_10418856 3300009177 Bacteria 1508
197 Ga0105248_10444882 3300009177 Bacteria 1460
198 Ga0105248_10499569 3300009177 Bacteria 1371
199 Ga0105249_10006265 3300009553 Bacteria 10334
200 Ga0105246_10040426 3300011119 Bacteria 3147
201 Ga0105246_10126814 3300011119 Bacteria 1900
202 Ga0105246_10136535 3300011119 Bacteria 1839
203 Ga0163162_10139809 3300013306 Bacteria 2534
204 Ga0163162_10903466 3300013306 Unclassified 996
205 Ga0163162_11486198 3300013306 Bacteria 772
206 Ga0157375_10032239 3300013308 Unclassified 4968
207 Ga0157375_10124955 3300013308 Unclassified 2686
208 Ga0157375_10262328 3300013308 Unclassified 1889
209 Ga0157375_10328170 3300013308 Bacteria 1695
210 Ga0163163_10374834 3300014325 Bacteria 1480
211 Ga0157380_10001053 3300014326 Bacteria 17653
212 Ga0157380_10003552 3300014326 Bacteria 10719
213 Ga0157380_10004140 3300014326 Bacteria 10024
214 Ga0157380_10029187 3300014326 Bacteria 4215
215 Ga0157380_10033459 3300014326 Bacteria 3958
216 Ga0157380_10185319 3300014326 Bacteria 1833
217 Ga0157380_10434342 3300014326 Bacteria 1256
218 Ga0157379_10012294 3300014968 Bacteria 7477
219 Ga0157379_10328184 3300014968 Bacteria 1398
220 Ga0157376_10646650 3300014969 Unclassified 1057
221 Ga0182007_10102789 3300015262 Unclassified 947
222 Ga0163161_10445670 3300017792 Bacteria 1046
223 Ga0207682_10071990 3300025893 Bacteria 1466
224 Ga0207682_10085593 3300025893 Bacteria 1358
225 Ga0207688_10193678 3300025901 Unclassified 1217
226 Ga0207645_10014500 3300025907 Bacteria 5272
227 Ga0207643_10003930 3300025908 Bacteria 7996
228 Ga0207643_10037511 3300025908 Bacteria 2720
229 Ga0207643_10108933 3300025908 Bacteria 1630
230 Ga0207643_10151774 3300025908 Bacteria 1389
231 Ga0207684_10008342 3300025910 Bacteria 9212
232 Ga0207654_10068462 3300025911 Bacteria 2100
233 Ga0207654_10128535 3300025911 Bacteria 1601
234 Ga0207660_10091425 3300025917 Bacteria 2257
235 Ga0207646_10202186 3300025922 Bacteria 1795
236 Ga0207646_10449212 3300025922 Unclassified 1163
237 Ga0207681_10006367 3300025923 Bacteria 7249
238 Ga0207681_10055595 3300025923 Bacteria 2697
239 Ga0207681_10096776 3300025923 Bacteria 2120
240 Ga0207681_10128916 3300025923 Bacteria 1867
241 Ga0207681_10350763 3300025923 Bacteria 1181
242 Ga0207650_10291643 3300025925 Unclassified 1330
243 Ga0207659_10007250 3300025926 Bacteria 6811
244 Ga0207659_10245401 3300025926 Unclassified 1451
245 Ga0207706_10110792 3300025933 Bacteria 2415
246 Ga0207706_10117818 3300025933 Bacteria 2336
247 Ga0207686_10000004 3300025934 Bacteria 349251
248 Ga0207686_10210998 3300025934 Bacteria 1396
249 Ga0207709_10000028 3300025935 Bacteria 334429
250 Ga0207709_10168980 3300025935 Bacteria 1533
251 Ga0207670_10330213 3300025936 Unclassified 1202
252 Ga0207669_10146573 3300025937 Bacteria 1647
253 Ga0207669_10200485 3300025937 Bacteria 1448
254 Ga0207691_10039860 3300025940 Bacteria 4344
255 Ga0207711_10128710 3300025941 Unclassified 2268
256 Ga0207711_10536907 3300025941 Bacteria 1091
257 Ga0207689_10040606 3300025942 Unclassified 3851
258 Ga0207689_10409186 3300025942 Unclassified 1131
259 Ga0207651_10018343 3300025960 Bacteria 4161
260 Ga0207651_10348024 3300025960 Unclassified 1247
261 Ga0207651_10371610 3300025960 Bacteria 1210
262 Ga0207712_10008261 3300025961 Bacteria 6581
263 Ga0207640_10015070 3300025981 Bacteria 4467
264 Ga0207640_10475102 3300025981 Bacteria 1036
265 Ga0207658_10368682 3300025986 Bacteria 1255
266 Ga0207703_10019861 3300026035 Bacteria 5252
267 Ga0207703_10184501 3300026035 Bacteria 1843
268 Ga0207708_10015624 3300026075 Bacteria 5694
269 Ga0207708_10136902 3300026075 Bacteria 1919
270 Ga0207708_10179970 3300026075 Bacteria 1678
271 Ga0207641_10230483 3300026088 Unclassified 1721
272 Ga0207641_10280348 3300026088 Unclassified 1567
273 Ga0207641_10298116 3300026088 Unclassified 1522
274 Ga0207641_10674538 3300026088 Unclassified 1016
275 Ga0207648_10123500 3300026089 Bacteria 2277
276 Ga0207648_10125281 3300026089 Bacteria 2260
277 Ga0207648_10184881 3300026089 Bacteria 1845
278 Ga0207648_10880713 3300026089 Bacteria 836
279 Ga0207676_10100703 3300026095 Bacteria 2394
280 Ga0207674_10167221 3300026116 Unclassified 2153
281 Ga0207674_10231123 3300026116 Bacteria 1797
282 Ga0207674_10252292 3300026116 Bacteria 1711
283 Ga0207674_10348151 3300026116 Bacteria 1432
284 Ga0207675_100004091 3300026118 Bacteria 14114
285 Ga0207675_100022647 3300026118 Bacteria 5847
286 Ga0207675_100045246 3300026118 Bacteria 4112
287 Ga0207675_100327493 3300026118 Bacteria 1497
288 Ga0207683_10004920 3300026121 Bacteria 11494
289 Ga0207683_10461419 3300026121 Bacteria 1171
290 Ga0207428_10000005 3300027907 Bacteria 520045
291 Ga0207428_10005725 3300027907 Bacteria 11552
292 Ga0207428_10026423 3300027907 Bacteria 4846
293 Ga0207428_10034674 3300027907 Bacteria 4132
294 Ga0207428_10090030 3300027907 Bacteria 2384
295 Ga0207428_10090388 3300027907 Bacteria 2378
296 Ga0207428_10167874 3300027907 Bacteria 1663
297 Ga0207428_10581143 3300027907 Bacteria 808
298 Ga0268265_10004648 3300028380 Bacteria 9479
299 Ga0268265_10039314 3300028380 Bacteria 3487
300 Ga0268265_10039438 3300028380 Bacteria 3482
301 Ga0268265_10067542 3300028380 Unclassified 2768
302 Ga0268265_10404848 3300028380 Bacteria 1262
303 Ga0268265_10470342 3300028380 Bacteria 1178
304 Ga0268264_10060393 3300028381 Unclassified 3177
305 Ga0268264_10364524 3300028381 Bacteria 1379
306 Ga0307408_100018628 3300031548 Bacteria 4664
307 Ga0307408_100095895 3300031548 Bacteria 2249
308 Ga0307408_100097842 3300031548 Bacteria 2229
309 Ga0307408_100553498 3300031548 Unclassified 1015
310 Ga0307405_10022593 3300031731 Bacteria 3559
311 Ga0307405_10062146 3300031731 Bacteria 2364
312 Ga0307410_10048903 3300031852 Bacteria 2836
313 Ga0307406_10086092 3300031901 Unclassified 2103
314 Ga0307412_10024605 3300031911 Unclassified 3719
315 Ga0307412_10322732 3300031911 Unclassified 1229
316 Ga0307416_100098211 3300032002 Bacteria 2539
317 Ga0307416_100239944 3300032002 Bacteria 1755
318 Ga0307411_10106601 3300032005 Bacteria 1995
319 Ga0307415_100567510 3300032126 Unclassified 1004
320 Ga0373951_0002042 3300035091 Bacteria 5170
321 Ga0439435_0001514 3300042436 Bacteria 4331
322 Ga0439444_0023904 3300042437 Bacteria 1100
323 Ga0439464_0001289 3300042439 Bacteria 5833
324 Ga0453683_0155669 3300044673 Bacteria 1445
325 Ga0495582_0181523 3300046473 Bacteria 1199
326 Ga0495588_0195595 3300046674 Bacteria 1068
327 Ga0496112_0824737 3300048915 Unclassified 852
328 Ga0501298_016474 3300049521 Unclassified 1340
329 Ga0501299_000985 3300049522 Unclassified 3544
330 Ga0501217_048677 3300049661 Unclassified 1101
331 Ga0501249_020837 3300049679 Unclassified 1428
332 Ga0501283_002820 3300049779 Bacteria 2273
333 nmdc:mga05p37_2312_c1 3300050507 Bacteria 22207
334 nmdc:mga05p37_242574_c1 3300050507 Bacteria 2166
335 nmdc:mga05p37_313360_c1 3300050507 Bacteria 1859
336 nmdc:mga05p37_462191_c1 3300050507 Unclassified 1466
337 nmdc:mga05p37_493712_c1 3300050507 Unclassified 1407
338 nmdc:mga05p37_93327_c1 3300050507 Unclassified 3709
339 nmdc:mga09592_105886_c1 3300050508 Unclassified 2412
340 nmdc:mga09592_121651_c1 3300050508 Bacteria 2242
341 nmdc:mga09592_545212_c1 3300050508 Bacteria 996
342 nmdc:mga09592_584450_c1 3300050508 Bacteria 958
343 nmdc:mga0qj67_101934_c1 3300050509 Bacteria 2314
344 nmdc:mga0qj67_365814_c1 3300050509 Bacteria 1165
345 nmdc:mga0qj67_675169_c1 3300050509 Bacteria 823
346 nmdc:mga0qj67_93209_c1 3300050509 Unclassified 2421
347 nmdc:mga06r32_19615_c1 3300050510 Bacteria 6209
348 nmdc:mga06r32_269363_c1 3300050510 Bacteria 1691
349 nmdc:mga06r32_282824_c1 3300050510 Unclassified 1646
350 nmdc:mga06r32_695026_c1 3300050510 Bacteria 983
351 nmdc:mga08y16_107688_c1 3300050511 Bacteria 2901
352 nmdc:mga08y16_129534_c1 3300050511 Bacteria 2625
353 nmdc:mga08y16_142735_c1 3300050511 Bacteria 2489
354 nmdc:mga08y16_1448_c1 3300050511 Bacteria 23762
355 nmdc:mga08y16_174097_c1 3300050511 Bacteria 2235
356 nmdc:mga08y16_25042_c1 3300050511 Bacteria 6295
357 nmdc:mga08y16_430800_c1 3300050511 Bacteria 1347
358 nmdc:mga08y16_52363_c1 3300050511 Bacteria 4271
359 nmdc:mga08y16_663602_c1 3300050511 Bacteria 1046
360 nmdc:mga08y16_7010_c1 3300050511 Bacteria 11818
361 nmdc:mga08y16_8078_c1 3300050511 Bacteria 11011
362 nmdc:mga08y16_86793_c1 3300050511 Bacteria 3261
363 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
364 nmdc:mga0rr50_130115_c1 3300050513 Bacteria 2014
365 nmdc:mga0a205_125609_c1 3300050515 Bacteria 2465
366 nmdc:mga0a205_234259_c1 3300050515 Bacteria 1718
367 nmdc:mga0a205_31324_c1 3300050515 Bacteria 3668
368 nmdc:mga0a205_37797_c1 3300050515 Unclassified 4642
369 nmdc:mga0a205_38614_c1 3300050515 Bacteria 4594
370 nmdc:mga09592_137971_c1
371 MRS1b_contig_755022
372 CNAas_1001173
373 Ga0065714_10002183
374 Ga0065704_10082718
375 Ga0065704_10174140
376 Ga0065704_10204816
377 Ga0065704_10220817
378 Ga0065712_10000030
379 Ga0065712_10020985
380 Ga0065712_10117287
381 Ga0065712_10181725
382 Ga0065715_10093451
383 Ga0065715_10096921
384 Ga0065715_10099861
385 Ga0065715_10141798
386 Ga0065715_10196634
387 Ga0065715_10224874
388 Ga0065715_10296599
389 Ga0065707_10009015
390 Ga0065707_10084121
391 Ga0065707_10099064
392 Ga0065707_10133722
393 Ga0065707_10268538
394 Ga0070676_10024867
395 Ga0070690_100152424
396 Ga0070690_100301799
397 Ga0070670_100196036
398 Ga0070677_10016052
399 Ga0070677_10045692
400 Ga0068869_100033884
401 Ga0068869_100091763
402 Ga0068869_100192958
403 Ga0070666_10404142
404 Ga0070680_100031194
405 Ga0070680_100237844
406 Ga0070692_10061250
407 Ga0070668_100506242
408 Ga0070669_100005503
409 Ga0070669_100034086
410 Ga0070669_100111023
411 Ga0070675_100000824
412 Ga0070675_100012182
413 Ga0070675_100073027
414 Ga0070675_100158984
415 Ga0070675_100553846
416 Ga0070674_100205608
417 Ga0070673_100108137
418 Ga0070673_100127835
419 Ga0070673_100353888
420 Ga0070688_100139125
421 Ga0070701_10032798
422 Ga0070701_10316905
423 Ga0070705_100074603
424 Ga0070705_100137118
425 Ga0070705_100221222
426 Ga0070705_100296919
427 Ga0070700_100018126
428 Ga0070700_100072173
429 Ga0070700_100236134
430 Ga0070700_100306085
431 Ga0070694_100021468
432 Ga0070678_100017393
433 Ga0070678_100168550
434 Ga0070662_100101477
435 Ga0068867_100060121
436 Ga0068867_100076435
437 Ga0070706_100008703
438 Ga0070706_100308608
439 Ga0070706_100422326
440 Ga0070707_100231435
441 Ga0070698_100022402
442 Ga0070698_100074266
443 Ga0070698_100133888
444 Ga0070697_100000512
445 Ga0070672_100123172
446 Ga0070695_100095431
447 Ga0070695_100287365
448 Ga0070696_100040251
449 Ga0070696_100143144
450 Ga0070696_100166524
451 Ga0070696_100418833
452 Ga0070693_100153562
453 Ga0070704_100154079
454 Ga0070704_100183285
455 Ga0070704_100355928
456 Ga0070704_100373692
457 Ga0070704_100476644
458 Ga0068857_100134622
459 Ga0068854_100018111
460 Ga0068854_100391185
461 Ga0068859_100004552
462 Ga0068859_100035406
463 Ga0068859_100073029
464 Ga0068859_100248706
465 Ga0068859_100343041
466 Ga0068864_100137519
467 Ga0068864_100380706
468 Ga0068861_100002001
469 Ga0068861_100002496
470 Ga0068861_100137487
471 Ga0068861_100259233
472 Ga0068870_10007340
473 Ga0068870_10034259
474 Ga0068870_10117323
475 Ga0068863_100030545
476 Ga0068863_100260456
477 Ga0068863_100607744
478 Ga0068858_100026251
479 Ga0068858_100037321
480 Ga0068858_100163508
481 Ga0068858_100822460
482 Ga0068860_100013666
483 Ga0068860_100154035
484 Ga0068862_100011675
485 Ga0068862_100013145
486 Ga0068862_100026309
487 Ga0068862_100058430
488 Ga0068862_100065463
489 Ga0068862_100449045
490 Ga0068862_101009754
491 Ga0097621_100066257
492 Ga0097621_100422997
493 Ga0068871_100013489
494 Ga0068871_100641434
495 Ga0075428_100000354
496 Ga0075428_100000985
497 Ga0075428_100006867
498 Ga0075428_100027834
499 Ga0075428_100086807
500 Ga0075428_100526319
501 Ga0075428_100633086
502 Ga0075428_100728547
503 Ga0075430_100120513
504 Ga0075430_100162015
505 Ga0075431_100024673
506 Ga0075431_100062318
507 Ga0075431_100074597
508 Ga0075431_100118075
509 Ga0075431_100221749
510 Ga0075431_100701986
511 Ga0075431_100760147
512 Ga0075433_10015134
513 Ga0075433_10029433
514 Ga0075433_10053506
515 Ga0075433_10241320
516 Ga0075434_100274298
517 Ga0075429_100017077
518 Ga0075429_100049288
519 Ga0075429_100087638
520 Ga0075429_100107588
521 Ga0075429_100111739
522 Ga0075429_100114182
523 Ga0068865_100137689
524 Ga0097620_100004552
525 Ga0097620_100035406
526 Ga0097620_100073030
527 Ga0097620_100248697
528 Ga0097620_100343054
529 Ga0097620_100712266
530 Ga0075435_100161408
531 Ga0111539_10000567
532 Ga0111539_10000604
533 Ga0111539_10004773
534 Ga0111539_10007780
535 Ga0111539_10010489
536 Ga0111539_10016883
537 Ga0111539_10056401
538 Ga0111539_10065500
539 Ga0111539_10066992
540 Ga0111539_10074682
541 Ga0111539_10096297
542 Ga0111539_10123214
543 Ga0111539_10474322
544 Ga0111539_11212307
545 Ga0105245_10163693
546 Ga0105245_11017708
547 Ga0105247_10048684
548 Ga0105247_10263576
549 Ga0114129_10027411
550 Ga0114129_10033486
551 Ga0114129_10097124
552 Ga0114129_10404600
553 Ga0114129_10598544
554 Ga0114129_11059595
555 Ga0105243_10000597
556 Ga0105243_10009732
557 Ga0105243_10147378
558 Ga0105241_10050877
559 Ga0105241_10058466
560 Ga0105242_10000596
561 Ga0105242_10227856
562 Ga0105242_10333801
563 Ga0105248_10191591
564 Ga0105248_10355769
565 Ga0105248_10418856
566 Ga0105248_10444882
567 Ga0105248_10499569
568 Ga0105249_10006265
569 Ga0105246_10040426
570 Ga0105246_10126814
571 Ga0105246_10136535
572 Ga0163162_10139809
573 Ga0163162_10903466
574 Ga0163162_11486198
575 Ga0157375_10032239
576 Ga0157375_10124955
577 Ga0157375_10262328
578 Ga0157375_10328170
579 Ga0163163_10374834
580 Ga0157380_10001053
581 Ga0157380_10003552
582 Ga0157380_10004140
583 Ga0157380_10029187
584 Ga0157380_10033459
585 Ga0157380_10185319
586 Ga0157380_10434342
587 Ga0157379_10012294
588 Ga0157379_10328184
589 Ga0157376_10646650
590 Ga0182007_10102789
591 Ga0163161_10445670
592 Ga0207682_10071990
593 Ga0207682_10085593
594 Ga0207688_10193678
595 Ga0207645_10014500
596 Ga0207643_10003930
597 Ga0207643_10037511
598 Ga0207643_10108933
599 Ga0207643_10151774
600 Ga0207684_10008342
601 Ga0207654_10068462
602 Ga0207654_10128535
603 Ga0207660_10091425
604 Ga0207646_10202186
605 Ga0207646_10449212
606 Ga0207681_10006367
607 Ga0207681_10055595
608 Ga0207681_10096776
609 Ga0207681_10128916
610 Ga0207681_10350763
611 Ga0207650_10291643
612 Ga0207659_10007250
613 Ga0207659_10245401
614 Ga0207706_10110792
615 Ga0207706_10117818
616 Ga0207686_10000004
617 Ga0207686_10210998
618 Ga0207709_10000028
619 Ga0207709_10168980
620 Ga0207670_10330213
621 Ga0207669_10146573
622 Ga0207669_10200485
623 Ga0207691_10039860
624 Ga0207711_10128710
625 Ga0207711_10536907
626 Ga0207689_10040606
627 Ga0207689_10409186
628 Ga0207651_10018343
629 Ga0207651_10348024
630 Ga0207651_10371610
631 Ga0207712_10008261
632 Ga0207640_10015070
633 Ga0207640_10475102
634 Ga0207658_10368682
635 Ga0207703_10019861
636 Ga0207703_10184501
637 Ga0207708_10015624
638 Ga0207708_10136902
639 Ga0207708_10179970
640 Ga0207641_10230483
641 Ga0207641_10280348
642 Ga0207641_10298116
643 Ga0207641_10674538
644 Ga0207648_10123500
645 Ga0207648_10125281
646 Ga0207648_10184881
647 Ga0207648_10880713
648 Ga0207676_10100703
649 Ga0207674_10167221
650 Ga0207674_10231123
651 Ga0207674_10252292
652 Ga0207674_10348151
653 Ga0207675_100004091
654 Ga0207675_100022647
655 Ga0207675_100045246
656 Ga0207675_100327493
657 Ga0207683_10004920
658 Ga0207683_10461419
659 Ga0207428_10000005
660 Ga0207428_10005725
661 Ga0207428_10026423
662 Ga0207428_10034674
663 Ga0207428_10090030
664 Ga0207428_10090388
665 Ga0207428_10167874
666 Ga0207428_10581143
667 Ga0268265_10004648
668 Ga0268265_10039314
669 Ga0268265_10039438
670 Ga0268265_10067542
671 Ga0268265_10404848
672 Ga0268265_10470342
673 Ga0268264_10060393
674 Ga0268264_10364524
675 Ga0307408_100018628
676 Ga0307408_100095895
677 Ga0307408_100097842
678 Ga0307408_100553498
679 Ga0307405_10022593
680 Ga0307405_10062146
681 Ga0307410_10048903
682 Ga0307406_10086092
683 Ga0307412_10024605
684 Ga0307412_10322732
685 Ga0307416_100098211
686 Ga0307416_100239944
687 Ga0307411_10106601
688 Ga0307415_100567510
689 Ga0373951_0002042
690 Ga0439435_0001514
691 Ga0439444_0023904
692 Ga0439464_0001289
693 Ga0453683_0155669
694 Ga0495582_0181523
695 Ga0495588_0195595
696 Ga0496112_0824737
697 Ga0501298_016474
698 Ga0501299_000985
699 Ga0501217_048677
700 Ga0501249_020837
701 Ga0501283_002820
702 nmdc:mga05p37_2312_c1
703 nmdc:mga05p37_242574_c1
704 nmdc:mga05p37_313360_c1
705 nmdc:mga05p37_462191_c1
706 nmdc:mga05p37_493712_c1
707 nmdc:mga05p37_93327_c1
708 nmdc:mga09592_105886_c1
709 nmdc:mga09592_121651_c1
710 nmdc:mga09592_545212_c1
711 nmdc:mga09592_584450_c1
712 nmdc:mga0qj67_101934_c1
713 nmdc:mga0qj67_365814_c1
714 nmdc:mga0qj67_675169_c1
715 nmdc:mga0qj67_93209_c1
716 nmdc:mga06r32_19615_c1
717 nmdc:mga06r32_269363_c1
718 nmdc:mga06r32_282824_c1
719 nmdc:mga06r32_695026_c1
720 nmdc:mga08y16_107688_c1
721 nmdc:mga08y16_129534_c1
722 nmdc:mga08y16_142735_c1
723 nmdc:mga08y16_1448_c1
724 nmdc:mga08y16_174097_c1
725 nmdc:mga08y16_25042_c1
726 nmdc:mga08y16_430800_c1
727 nmdc:mga08y16_52363_c1
728 nmdc:mga08y16_663602_c1
729 nmdc:mga08y16_7010_c1
730 nmdc:mga08y16_8078_c1
731 nmdc:mga08y16_86793_c1
732 nmdc:mga08y16_9_c1
733 nmdc:mga0rr50_130115_c1
734 nmdc:mga0a205_125609_c1
735 nmdc:mga0a205_234259_c1
736 nmdc:mga0a205_31324_c1
737 nmdc:mga0a205_37797_c1
738 nmdc:mga0a205_38614_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01186

Lysyl_oxidase

Lysyl oxidase

68

262

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ze3-assembly1.cif.gz_A crystal structure of human lysyl oxidase-like 2 (hloxl2) in a precursor state 0.7991 45 223
5kzs-assembly1.cif.gz_A listeria monocytogenes internalin-like protein lmo2027 0.6351 181 219
5ze3-assembly1.cif.gz_A crystal structure of human lysyl oxidase-like 2 (hloxl2) in a precursor state 0.62 45 223
3sd2-assembly1.cif.gz_A-2 crystal structure of a putative member of duf3244 protein family (bt_3571) from bacteroides thetaiotaomicron vpi-5482 at 1.40 a resolution 0.6138 90 225
5axh-assembly1.cif.gz_A crystal structure of thermophilic dextranase from thermoanaerobacter pseudethanolicus, d312g mutant in complex with isomaltohexaose 0.6077 58 227
ID Description Score Start End Superfamily
af_B2RQY6_125_354_3.90.310.10 Alpha Beta;Alpha-Beta Complex;Viral Glycoprotein Gp70;ENV polyprotein, receptor-binding domain 0.6851 116 142 3.90.310.10
af_Q8IDK5_19_216_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.5819 118 138 3.40.140.10
af_Q8IDK5_3_230_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.5819 118 138 3.40.140.10
3is0X03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.575 121 225 2.60.40.10
af_Q54M63_54_230_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.5682 120 139 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7Y5UAA2-F1-model_v4 Uncharacterized protein 0.8374 45 226 GO:0004720
GO:0005507
GO:0005615
AF-A0A4P5VRV3-F1-model_v4 CARDB domain-containing protein 0.8334 45 227 GO:0004720
GO:0005507
GO:0005615
AF-A0A150RAJ3-F1-model_v4 Lysyl oxidase 0.828 45 226 GO:0004720
GO:0005507
GO:0005615
AF-A0A819ZW07-F1-model_v4 Uncharacterized protein 0.8228 45 116
AF-A0A4U1GW14-F1-model_v4 deleted 0.8222 45 225

Map