F425194

General Info

Members Datasets Scaffolds Average Seq Length
369 249 738 316

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0302274|Ga0501034_0302274_209_1264
Length 351
Sequence MSGLRIASPPGMVRPDLRMEDHMHTSLPTRAFGRTGLEITRLGVGAWAMGGNMWGPQDDAESAAAIRHAVDLGINWIDTAAAYGVGHSEEVIGKTLRDLPADHRPYVFTKGGVIRDPDGTNPRRLANRQSLRTEIENSLRRLQVEAIDLYQVHWPADDVPLEDYWATMLELKSEGKVRHIGLSNHNAEQLARAEAMGHVETLQPPFSMIKRETAESILPWCAAHGTGTICYSPMQAGLLTGTFTRERAATLADNDWRKTNPEFTGDRLDRNLKLAASLKAVADKHNTSISTVALTWVLAWPGLTAAIVGARSPAQVDGWIDAAFIELDAEDLDTIASLIAQTGAGAGPTRP

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
161 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
245 2643221629 Devosia sp. Root105 Isolate Unclassified
246 2643221662 Devosia sp. Root413D1 Isolate Unclassified
247 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
248 2928058823 Ralstonia sp. 1138 Isolate Unclassified
249 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0.54
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.13
Nodule 0
Rhizoplane 8.13
Rhizosphere 78.32
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0302274 3300049571 Bacteria 1537
2 JGI24741J21665_1000029 3300001915 Bacteria 34366
3 JGI24740J21852_10001907 3300001979 Bacteria 9563
4 JGI24740J21852_10004481 3300001979 Bacteria 6011
5 JGI25156J39149_1004467 3300002705 Bacteria 4258
6 JGI25156J39149_1008910 3300002705 Bacteria 2484
7 JGI25154J39366_1000285 3300002738 Bacteria 30441
8 Ga0006562J51391_1125554 3300003578 Bacteria 2633
9 Ga0055538_1002955 3300003751 Bacteria 2295
10 Ga0055538_1002965 3300003751 Bacteria 2288
11 Ga0055539_1000236 3300003752 Bacteria 37511
12 Ga0055533_1001773 3300003756 Bacteria 5471
13 Ga0055533_1006708 3300003756 Bacteria 1655
14 Ga0055532_1000149 3300003758 Bacteria 66954
15 Ga0055525_1001067 3300003759 Bacteria 7003
16 Ga0055535_1000180 3300003761 Bacteria 66954
17 Ga0055542_1000489 3300003762 Bacteria 36510
18 Ga0055542_1001202 3300003762 Bacteria 14673
19 Ga0055529_1000245 3300003763 Bacteria 66949
20 Ga0055541_1007757 3300003841 Bacteria 1746
21 Ga0065712_10068420 3300005290 Bacteria 10770
22 Ga0070676_10112959 3300005328 Bacteria 1694
23 Ga0070683_100008713 3300005329 Bacteria 8626
24 Ga0070683_100068687 3300005329 Bacteria 3302
25 Ga0070670_100186091 3300005331 Bacteria 1803
26 Ga0068868_100010367 3300005338 Bacteria 6744
27 Ga0070661_100000048 3300005344 Bacteria 91068
28 Ga0070675_100085055 3300005354 Bacteria 2642
29 Ga0070688_100010609 3300005365 Bacteria 5088
30 Ga0070659_100001214 3300005366 Bacteria 18706
31 Ga0070709_10001238 3300005434 Bacteria 13960
32 Ga0070714_100006247 3300005435 Bacteria 9176
33 Ga0070714_100011458 3300005435 Bacteria 7032
34 Ga0070714_100087251 3300005435 Bacteria 2728
35 Ga0070714_100131254 3300005435 Bacteria 2239
36 Ga0070714_100235544 3300005435 Bacteria 1688
37 Ga0070713_100000817 3300005436 Bacteria 20005
38 Ga0070713_100034213 3300005436 Bacteria 4079
39 Ga0070713_100285006 3300005436 Bacteria 1516
40 Ga0070710_10000232 3300005437 Bacteria 26002
41 Ga0070708_100019105 3300005445 Bacteria 5750
42 Ga0070708_100029502 3300005445 Bacteria 4731
43 Ga0070663_100000001 3300005455 Bacteria 318372
44 Ga0070662_100134276 3300005457 Bacteria 1912
45 Ga0070685_10004966 3300005466 Bacteria 6735
46 Ga0070706_100017680 3300005467 Bacteria 6580
47 Ga0070684_100003709 3300005535 Bacteria 11521
48 Ga0068853_100238318 3300005539 Bacteria 1666
49 Ga0070672_100319562 3300005543 Bacteria 1319
50 Ga0068855_100034134 3300005563 Bacteria 6069
51 Ga0070664_100000016 3300005564 Bacteria 128509
52 Ga0070664_100138554 3300005564 Bacteria 2141
53 Ga0068857_100004048 3300005577 Bacteria 12338
54 Ga0068857_100010988 3300005577 Bacteria 7881
55 Ga0068854_100000124 3300005578 Bacteria 53140
56 Ga0068854_100415989 3300005578 Bacteria 1116
57 Ga0068856_100000047 3300005614 Bacteria 108894
58 Ga0070702_100051583 3300005615 Bacteria 2356
59 Ga0068859_100096079 3300005617 Bacteria 3016
60 Ga0068864_100012419 3300005618 Bacteria 7043
61 Ga0068861_100008259 3300005719 Bacteria 7164
62 Ga0068863_100041987 3300005841 Bacteria 4347
63 Ga0068862_100013189 3300005844 Bacteria 6835
64 Ga0081539_10007722 3300005985 Bacteria 9650
65 Ga0070717_10317360 3300006028 Bacteria 1388
66 Ga0075365_10009621 3300006038 Bacteria 5574
67 Ga0070712_100011842 3300006175 Bacteria 5541
68 Ga0070712_100012104 3300006175 Bacteria 5481
69 Ga0097621_100246382 3300006237 Bacteria 1564
70 Ga0075428_100002777 3300006844 Bacteria 19067
71 Ga0075428_100276331 3300006844 Bacteria 1807
72 Ga0075430_100001568 3300006846 Bacteria 18723
73 Ga0075431_100002004 3300006847 Bacteria 19429
74 Ga0075431_100066122 3300006847 Bacteria 3732
75 Ga0075433_10086030 3300006852 Bacteria 2776
76 Ga0075433_10243162 3300006852 Bacteria 1597
77 Ga0075434_100000757 3300006871 Bacteria 25482
78 Ga0075434_100033798 3300006871 Bacteria 5048
79 Ga0075429_100000968 3300006880 Bacteria 22787
80 Ga0068865_100058373 3300006881 Bacteria 2695
81 Ga0075436_100005668 3300006914 Bacteria 8572
82 Ga0097620_100096077 3300006931 Bacteria 3016
83 Ga0075435_100006330 3300007076 Bacteria 8361
84 Ga0075435_100115883 3300007076 Bacteria 2231
85 Ga0105240_10037313 3300009093 Bacteria 6246
86 Ga0105240_10543886 3300009093 Bacteria 1286
87 Ga0105245_10028023 3300009098 Bacteria 4965
88 Ga0114129_10015687 3300009147 Bacteria 10772
89 Ga0114129_10377897 3300009147 Bacteria 1872
90 Ga0105243_10002900 3300009148 Bacteria 14194
91 Ga0105243_10054852 3300009148 Bacteria 3165
92 Ga0105242_10241302 3300009176 Bacteria 1625
93 Ga0105248_10015867 3300009177 Bacteria 8302
94 Ga0105248_10081215 3300009177 Bacteria 3644
95 Ga0105237_10019240 3300009545 Bacteria 7055
96 Ga0105249_10017237 3300009553 Bacteria 6410
97 Ga0105239_10081084 3300010375 Bacteria 3571
98 Ga0105246_10493110 3300011119 Bacteria 1039
99 Ga0157373_10013875 3300013100 Bacteria 5909
100 Ga0157373_10199983 3300013100 Bacteria 1409
101 Ga0157371_10000080 3300013102 Bacteria 152121
102 Ga0157370_10000032 3300013104 Bacteria 138963
103 Ga0157369_10004526 3300013105 Bacteria 16359
104 Ga0157369_10024270 3300013105 Bacteria 6748
105 Ga0163162_10029462 3300013306 Bacteria 5432
106 Ga0163162_10249820 3300013306 Bacteria 1905
107 Ga0157372_10004343 3300013307 Bacteria 15138
108 Ga0157375_10019245 3300013308 Bacteria 6207
109 Ga0157375_10091097 3300013308 Bacteria 3110
110 Ga0157375_10270977 3300013308 Bacteria 1860
111 Ga0163163_10102680 3300014325 Bacteria 2883
112 Ga0163163_10130193 3300014325 Bacteria 2556
113 Ga0182008_10060178 3300014497 Bacteria 1873
114 Ga0157379_10096621 3300014968 Bacteria 2652
115 Ga0182007_10013458 3300015262 Bacteria 3119
116 Ga0209784_100006 3300025224 Bacteria 930704
117 Ga0209784_100472 3300025224 Bacteria 16603
118 Ga0209784_100785 3300025224 Bacteria 7603
119 Ga0209566_100002 3300025225 Bacteria 2614868
120 Ga0209566_100303 3300025225 Bacteria 44626
121 Ga0209674_100010 3300025226 Bacteria 1038638
122 Ga0209674_100176 3300025226 Bacteria 79399
123 Ga0209674_100206 3300025226 Bacteria 59401
124 Ga0209147_100018 3300025229 Bacteria 515719
125 Ga0209563_100041 3300025230 Bacteria 407467
126 Ga0209258_100028 3300025242 Bacteria 515719
127 Ga0209646_1000043 3300025246 Bacteria 343652
128 Ga0209677_100007 3300025253 Bacteria 1021332
129 Ga0209677_103421 3300025253 Bacteria 5178
130 Ga0209148_1000348 3300025254 Bacteria 60117
131 Ga0209759_1002472 3300025256 Bacteria 8089
132 Ga0209759_1002969 3300025256 Bacteria 7057
133 Ga0209759_1011498 3300025256 Bacteria 2511
134 Ga0209455_1000065 3300025272 Bacteria 321272
135 Ga0207692_10115891 3300025898 Unclassified 1493
136 Ga0207699_10019803 3300025906 Bacteria 3596
137 Ga0207645_10109108 3300025907 Bacteria 1790
138 Ga0207695_10000872 3300025913 Bacteria 54945
139 Ga0207695_10024388 3300025913 Bacteria 6809
140 Ga0207695_10100076 3300025913 Bacteria 2895
141 Ga0207693_10038530 3300025915 Bacteria 3764
142 Ga0207693_10211249 3300025915 Bacteria 1525
143 Ga0207663_10108627 3300025916 Bacteria 1878
144 Ga0207662_10003438 3300025918 Bacteria 8148
145 Ga0207649_10000200 3300025920 Bacteria 49831
146 Ga0207694_10203149 3300025924 Bacteria 1612
147 Ga0207650_10006219 3300025925 Bacteria 8135
148 Ga0207700_10001558 3300025928 Bacteria 13002
149 Ga0207700_10198985 3300025928 Bacteria 1687
150 Ga0207664_10001752 3300025929 Bacteria 14295
151 Ga0207690_10003490 3300025932 Bacteria 9376
152 Ga0207690_10129689 3300025932 Bacteria 1844
153 Ga0207706_10116292 3300025933 Bacteria 2352
154 Ga0207709_10068220 3300025935 Bacteria 2247
155 Ga0207709_10136816 3300025935 Bacteria 1678
156 Ga0207670_10031098 3300025936 Bacteria 3416
157 Ga0207704_10148694 3300025938 Bacteria 1650
158 Ga0207665_10001246 3300025939 Bacteria 17163
159 Ga0207691_10061739 3300025940 Bacteria 3404
160 Ga0207691_10250696 3300025940 Bacteria 1528
161 Ga0207711_10109943 3300025941 Bacteria 2450
162 Ga0207711_10254694 3300025941 Bacteria 1613
163 Ga0207661_10012522 3300025944 Bacteria 6166
164 Ga0207679_10000012 3300025945 Bacteria 339773
165 Ga0207679_10029010 3300025945 Bacteria 3848
166 Ga0207712_10002706 3300025961 Bacteria 11321
167 Ga0207640_10000047 3300025981 Bacteria 98563
168 Ga0207677_10005867 3300026023 Bacteria 6681
169 Ga0207703_10030591 3300026035 Bacteria 4256
170 Ga0207678_10000028 3300026067 Bacteria 115277
171 Ga0207678_10278291 3300026067 Bacteria 1436
172 Ga0207708_10006411 3300026075 Bacteria 8718
173 Ga0207702_10000255 3300026078 Bacteria 61384
174 Ga0207648_10157705 3300026089 Bacteria 2004
175 Ga0207648_10367560 3300026089 Bacteria 1299
176 Ga0207674_10003216 3300026116 Bacteria 20118
177 Ga0207674_10007892 3300026116 Bacteria 12363
178 Ga0207675_100005852 3300026118 Bacteria 11745
179 Ga0207683_10081941 3300026121 Bacteria 2865
180 Ga0268265_10034544 3300028380 Bacteria 3687
181 Ga0265322_10000307 3300028654 Bacteria 20653
182 Ga0265336_10003154 3300028666 Bacteria 6560
183 Ga0307515_10220632 3300028794 Bacteria 1715
184 Ga0265338_10013289 3300028800 Bacteria 9309
185 Ga0307511_10000897 3300030521 Bacteria 31344
186 Ga0265330_10000534 3300031235 Bacteria 24972
187 Ga0265332_10012005 3300031238 Bacteria 3846
188 Ga0265329_10007105 3300031242 Bacteria 4363
189 Ga0265316_10000112 3300031344 Bacteria 87681
190 Ga0307509_10078531 3300031507 Bacteria 3419
191 Ga0265342_10000183 3300031712 Bacteria 70222
192 Ga0307405_10083291 3300031731 Bacteria 2096
193 Ga0307406_10047373 3300031901 Bacteria 2709
194 Ga0307406_10069439 3300031901 Bacteria 2303
195 Ga0307407_10060242 3300031903 Bacteria 2214
196 Ga0307407_10247731 3300031903 Bacteria 1219
197 Ga0307409_100030616 3300031995 Bacteria 3869
198 Ga0307416_100020597 3300032002 Bacteria 4711
199 Ga0307510_10082148 3300033180 Bacteria 3119
200 Ga0373934_0000043 3300035086 Bacteria 41885
201 Ga0373923_0007365 3300035111 Bacteria 3864
202 Ga0373923_0017819 3300035111 Bacteria 2722
203 Ga0373936_0009481 3300035113 Bacteria 3671
204 Ga0373953_0000011 3300035117 Bacteria 45398
205 Ga0373953_0005149 3300035117 Bacteria 4223
206 Ga0373954_0003962 3300035118 Bacteria 6335
207 Ga0373956_0001215 3300035119 Bacteria 10668
208 Ga0373956_0049303 3300035119 Bacteria 1888
209 Ga0373957_0000354 3300035120 Bacteria 11692
210 Ga0373957_0050370 3300035120 Bacteria 1591
211 Ga0373943_0149146 3300035170 Bacteria 1266
212 Ga0373955_0000089 3300035172 Bacteria 36959
213 Ga0373955_0043643 3300035172 Bacteria 2412
214 Ga0373924_0000028 3300035410 Bacteria 37098
215 Ga0373924_0012574 3300035410 Bacteria 3165
216 Ga0373931_0344230 3300035691 Bacteria 932
217 Ga0373933_0000011 3300035724 Bacteria 110003
218 Ga0373933_0006131 3300035724 Bacteria 6546
219 Ga0373947_0216138 3300035725 Bacteria 1259
220 Ga0373937_0000021 3300036401 Bacteria 128447
221 Ga0373937_0343019 3300036401 Bacteria 1414
222 Ga0372808_002919 3300036459 Bacteria 2036
223 Ga0316582_0052294 3300036647 Bacteria 2596
224 Ga0373925_0031996 3300037068 Bacteria 3870
225 Ga0395900_0009063 3300037418 Bacteria 10199
226 Ga0395905_0134171 3300037471 Bacteria 2329
227 Ga0466986_0028249 3300044650 Bacteria 3785
228 Ga0466969_0034116 3300044656 Bacteria 2579
229 Ga0466972_0005336 3300044658 Bacteria 6438
230 Ga0466966_0048890 3300044684 Bacteria 2694
231 Ga0466966_0121235 3300044684 Bacteria 1606
232 Ga0466961_0000722 3300044693 Bacteria 20781
233 Ga0466961_0051579 3300044693 Unclassified 2627
234 Ga0466961_0099541 3300044693 Bacteria 1832
235 Ga0466963_0002331 3300044694 Bacteria 10587
236 Ga0466963_0020952 3300044694 Bacteria 4119
237 Ga0466971_0024304 3300044719 Bacteria 2704
238 Ga0466970_0000986 3300044765 Bacteria 13695
239 Ga0466970_0075400 3300044765 Bacteria 1817
240 Ga0466957_0003450 3300044842 Bacteria 8671
241 Ga0466957_0231116 3300044842 Bacteria 1224
242 Ga0466960_0020150 3300044901 Bacteria 2950
243 Ga0466959_0066377 3300045049 Bacteria 2617
244 Ga0466959_0076602 3300045049 Bacteria 2415
245 Ga0466959_0255250 3300045049 Bacteria 1208
246 Ga0466958_0003876 3300045836 Bacteria 7827
247 Ga0466958_0093857 3300045836 Bacteria 1858
248 Ga0466958_0283832 3300045836 Bacteria 1061
249 Ga0466967_0012358 3300045976 Bacteria 6526
250 Ga0466967_0059105 3300045976 Bacteria 3392
251 Ga0495592_0000013 3300046454 Bacteria 151780
252 Ga0495592_0148725 3300046454 Bacteria 1621
253 Ga0495629_0167133 3300046459 Bacteria 1527
254 Ga0495641_0051523 3300046461 Bacteria 1879
255 Ga0495651_0000022 3300046462 Bacteria 118601
256 Ga0495651_0012895 3300046462 Bacteria 6458
257 Ga0495651_0041639 3300046462 Bacteria 3567
258 Ga0495651_0144149 3300046462 Bacteria 1723
259 Ga0495653_0001350 3300046463 Bacteria 19054
260 Ga0495582_0028765 3300046473 Bacteria 3050
261 Ga0495605_0117687 3300046474 Bacteria 1207
262 Ga0495664_0006279 3300046477 Bacteria 6562
263 Ga0495664_0202031 3300046477 Bacteria 1204
264 Ga0495608_0000029 3300046511 Bacteria 151790
265 Ga0495608_0021608 3300046511 Bacteria 4416
266 Ga0495618_0052600 3300046514 Bacteria 2574
267 Ga0495628_0000192 3300046516 Bacteria 53360
268 Ga0495628_0018519 3300046516 Bacteria 5765
269 Ga0495630_0207999 3300046517 Bacteria 1493
270 Ga0495652_0000083 3300046529 Bacteria 102109
271 Ga0495652_0012883 3300046529 Bacteria 7534
272 Ga0495665_0002376 3300046531 Bacteria 10163
273 Ga0495587_0000022 3300046536 Bacteria 151790
274 Ga0495587_0087345 3300046536 Bacteria 1804
275 Ga0495645_0113300 3300046543 Bacteria 1917
276 Ga0495645_0172227 3300046543 Bacteria 1489
277 Ga0495667_0000028 3300046559 Bacteria 151705
278 Ga0495667_0046654 3300046559 Bacteria 2864
279 Ga0495667_0160865 3300046559 Bacteria 1444
280 Ga0495634_0036645 3300046642 Bacteria 3354
281 Ga0495635_0005724 3300046663 Bacteria 8656
282 Ga0495635_0069366 3300046663 Bacteria 2416
283 Ga0495657_0000036 3300046675 Bacteria 118645
284 Ga0495657_0044947 3300046675 Bacteria 2999
285 Ga0495599_0000587 3300046678 Bacteria 20764
286 Ga0495599_0101153 3300046678 Bacteria 1796
287 Ga0495623_0000084 3300046679 Bacteria 55932
288 Ga0495623_0035548 3300046679 Bacteria 3193
289 Ga0495623_0119077 3300046679 Bacteria 1591
290 Ga0495623_0145119 3300046679 Bacteria 1408
291 Ga0495646_0030966 3300046680 Bacteria 3338
292 Ga0495646_0037443 3300046680 Bacteria 3000
293 Ga0495646_0051390 3300046680 Unclassified 2494
294 Ga0495658_0071033 3300046683 Bacteria 2022
295 Ga0495600_0019889 3300046809 Bacteria 4291
296 Ga0495600_0024754 3300046809 Bacteria 3865
297 Ga0495600_0217644 3300046809 Bacteria 1222
298 Ga0495604_0000023 3300047317 Bacteria 151689
299 Ga0495604_0067299 3300047317 Bacteria 2722
300 Ga0495674_0241177 3300047319 Bacteria 1489
301 Ga0495676_0034091 3300047321 Bacteria 4275
302 Ga0495680_0000466 3300047322 Bacteria 45567
303 Ga0495680_0077041 3300047322 Bacteria 2526
304 Ga0495675_0001572 3300047444 Bacteria 13782
305 Ga0495675_0055838 3300047444 Bacteria 2504
306 Ga0495684_0092645 3300047471 Bacteria 2288
307 Ga0495593_0061529 3300047673 Bacteria 1963
308 Ga0495602_0000121 3300048088 Bacteria 73145
309 Ga0495602_0046061 3300048088 Bacteria 3942
310 Ga0496100_0216106 3300048903 Bacteria 1405
311 Ga0496101_0008122 3300048904 Bacteria 6847
312 Ga0496101_0010829 3300048904 Bacteria 6033
313 Ga0496101_0254716 3300048904 Bacteria 1368
314 Ga0496102_0023840 3300048905 Bacteria 5438
315 Ga0496102_0097547 3300048905 Bacteria 2726
316 Ga0496103_0012822 3300048906 Bacteria 4971
317 Ga0496104_0016281 3300048907 Bacteria 6750
318 Ga0496104_0018076 3300048907 Bacteria 6428
319 Ga0496104_0026722 3300048907 Bacteria 5334
320 Ga0496104_0041023 3300048907 Bacteria 4339
321 Ga0496104_0223070 3300048907 Bacteria 1797
322 Ga0496105_0025388 3300048908 Bacteria 4824
323 Ga0496105_0148701 3300048908 Bacteria 1926
324 Ga0496106_0011936 3300048909 Bacteria 6415
325 Ga0496106_0033309 3300048909 Bacteria 3844
326 Ga0496106_0044804 3300048909 Bacteria 3322
327 Ga0496107_0011526 3300048910 Bacteria 6159
328 Ga0496107_0020767 3300048910 Bacteria 4641
329 Ga0496108_0001455 3300048911 Bacteria 18720
330 Ga0496108_0010695 3300048911 Bacteria 7445
331 Ga0496108_0063187 3300048911 Bacteria 3118
332 Ga0496109_0050951 3300048912 Bacteria 3770
333 Ga0496112_0011094 3300048915 Bacteria 8211
334 Ga0496112_0037095 3300048915 Bacteria 4758
335 Ga0496112_0308553 3300048915 Bacteria 1527
336 Ga0496113_0011697 3300048916 Bacteria 5870
337 Ga0496113_0015942 3300048916 Bacteria 5181
338 Ga0496114_0317256 3300048917 Bacteria 1377
339 Ga0496117_0157218 3300048920 Bacteria 1337
340 Ga0496118_0099742 3300048921 Bacteria 1967
341 Ga0496125_0038273 3300048928 Bacteria 4155
342 Ga0501036_0233291 3300049572 Bacteria 1544
343 Ga0501067_0003797 3300049583 Bacteria 8328
344 Ga0501076_0281335 3300049592 Bacteria 1363
345 nmdc:mga0yw44_231687_c1 3300050492 Bacteria 1226
346 nmdc:mga05p37_15744_c1 3300050507 Bacteria 9093
347 nmdc:mga09592_6683_c1 3300050508 Bacteria 9392
348 nmdc:mga0qj67_589_c1 3300050509 Bacteria 24751
349 nmdc:mga0n895_44994_c1 3300050512 Bacteria 4306
350 nmdc:mga0n895_522_c1 3300050512 Bacteria 26183
351 nmdc:mga0n895_82295_c1 3300050512 Bacteria 3209
352 nmdc:mga0rr50_1375_c1 3300050513 Bacteria 13316
353 nmdc:mga0rr50_21306_c1 3300050513 Bacteria 4422
354 nmdc:mga08x19_123613_c1 3300050514 Bacteria 1736
355 nmdc:mga0a205_258221_c1 3300050515 Bacteria 1620
356 nmdc:mga0a205_54372_c1 3300050515 Bacteria 3865
357 Ga0495601_0081725 3300053077 Bacteria 2074
358 Ga0495612_0013788 3300053078 Bacteria 3255
359 Ga0495595_0000114 3300053084 Bacteria 36294
360 Ga0495619_0008345 3300053085 Bacteria 6548
361 Ga0495619_0042315 3300053085 Bacteria 2983
362 Ga0500562_013516 3300053108 Bacteria 2086
363 Ga0501082_0390014 3300060353 Unclassified 1215
364 2599448278 2599185178 Bacteria 5365746
365 2644166197 2643221629 Bacteria 5850260
366 2644346798 2643221662 Bacteria 5851492
367 2900578970 2900577576 Bacteria 5438534
368 2928060602 2928058823 Bacteria 5520022
369 8057573793 8057568493 Bacteria 7221719
370 Ga0501034_0302274
371 JGI24741J21665_1000029
372 JGI24740J21852_10001907
373 JGI24740J21852_10004481
374 JGI25156J39149_1004467
375 JGI25156J39149_1008910
376 JGI25154J39366_1000285
377 Ga0006562J51391_1125554
378 Ga0055538_1002955
379 Ga0055538_1002965
380 Ga0055539_1000236
381 Ga0055533_1001773
382 Ga0055533_1006708
383 Ga0055532_1000149
384 Ga0055525_1001067
385 Ga0055535_1000180
386 Ga0055542_1000489
387 Ga0055542_1001202
388 Ga0055529_1000245
389 Ga0055541_1007757
390 Ga0065712_10068420
391 Ga0070676_10112959
392 Ga0070683_100008713
393 Ga0070683_100068687
394 Ga0070670_100186091
395 Ga0068868_100010367
396 Ga0070661_100000048
397 Ga0070675_100085055
398 Ga0070688_100010609
399 Ga0070659_100001214
400 Ga0070709_10001238
401 Ga0070714_100006247
402 Ga0070714_100011458
403 Ga0070714_100087251
404 Ga0070714_100131254
405 Ga0070714_100235544
406 Ga0070713_100000817
407 Ga0070713_100034213
408 Ga0070713_100285006
409 Ga0070710_10000232
410 Ga0070708_100019105
411 Ga0070708_100029502
412 Ga0070663_100000001
413 Ga0070662_100134276
414 Ga0070685_10004966
415 Ga0070706_100017680
416 Ga0070684_100003709
417 Ga0068853_100238318
418 Ga0070672_100319562
419 Ga0068855_100034134
420 Ga0070664_100000016
421 Ga0070664_100138554
422 Ga0068857_100004048
423 Ga0068857_100010988
424 Ga0068854_100000124
425 Ga0068854_100415989
426 Ga0068856_100000047
427 Ga0070702_100051583
428 Ga0068859_100096079
429 Ga0068864_100012419
430 Ga0068861_100008259
431 Ga0068863_100041987
432 Ga0068862_100013189
433 Ga0081539_10007722
434 Ga0070717_10317360
435 Ga0075365_10009621
436 Ga0070712_100011842
437 Ga0070712_100012104
438 Ga0097621_100246382
439 Ga0075428_100002777
440 Ga0075428_100276331
441 Ga0075430_100001568
442 Ga0075431_100002004
443 Ga0075431_100066122
444 Ga0075433_10086030
445 Ga0075433_10243162
446 Ga0075434_100000757
447 Ga0075434_100033798
448 Ga0075429_100000968
449 Ga0068865_100058373
450 Ga0075436_100005668
451 Ga0097620_100096077
452 Ga0075435_100006330
453 Ga0075435_100115883
454 Ga0105240_10037313
455 Ga0105240_10543886
456 Ga0105245_10028023
457 Ga0114129_10015687
458 Ga0114129_10377897
459 Ga0105243_10002900
460 Ga0105243_10054852
461 Ga0105242_10241302
462 Ga0105248_10015867
463 Ga0105248_10081215
464 Ga0105237_10019240
465 Ga0105249_10017237
466 Ga0105239_10081084
467 Ga0105246_10493110
468 Ga0157373_10013875
469 Ga0157373_10199983
470 Ga0157371_10000080
471 Ga0157370_10000032
472 Ga0157369_10004526
473 Ga0157369_10024270
474 Ga0163162_10029462
475 Ga0163162_10249820
476 Ga0157372_10004343
477 Ga0157375_10019245
478 Ga0157375_10091097
479 Ga0157375_10270977
480 Ga0163163_10102680
481 Ga0163163_10130193
482 Ga0182008_10060178
483 Ga0157379_10096621
484 Ga0182007_10013458
485 Ga0209784_100006
486 Ga0209784_100472
487 Ga0209784_100785
488 Ga0209566_100002
489 Ga0209566_100303
490 Ga0209674_100010
491 Ga0209674_100176
492 Ga0209674_100206
493 Ga0209147_100018
494 Ga0209563_100041
495 Ga0209258_100028
496 Ga0209646_1000043
497 Ga0209677_100007
498 Ga0209677_103421
499 Ga0209148_1000348
500 Ga0209759_1002472
501 Ga0209759_1002969
502 Ga0209759_1011498
503 Ga0209455_1000065
504 Ga0207692_10115891
505 Ga0207699_10019803
506 Ga0207645_10109108
507 Ga0207695_10000872
508 Ga0207695_10024388
509 Ga0207695_10100076
510 Ga0207693_10038530
511 Ga0207693_10211249
512 Ga0207663_10108627
513 Ga0207662_10003438
514 Ga0207649_10000200
515 Ga0207694_10203149
516 Ga0207650_10006219
517 Ga0207700_10001558
518 Ga0207700_10198985
519 Ga0207664_10001752
520 Ga0207690_10003490
521 Ga0207690_10129689
522 Ga0207706_10116292
523 Ga0207709_10068220
524 Ga0207709_10136816
525 Ga0207670_10031098
526 Ga0207704_10148694
527 Ga0207665_10001246
528 Ga0207691_10061739
529 Ga0207691_10250696
530 Ga0207711_10109943
531 Ga0207711_10254694
532 Ga0207661_10012522
533 Ga0207679_10000012
534 Ga0207679_10029010
535 Ga0207712_10002706
536 Ga0207640_10000047
537 Ga0207677_10005867
538 Ga0207703_10030591
539 Ga0207678_10000028
540 Ga0207678_10278291
541 Ga0207708_10006411
542 Ga0207702_10000255
543 Ga0207648_10157705
544 Ga0207648_10367560
545 Ga0207674_10003216
546 Ga0207674_10007892
547 Ga0207675_100005852
548 Ga0207683_10081941
549 Ga0268265_10034544
550 Ga0265322_10000307
551 Ga0265336_10003154
552 Ga0307515_10220632
553 Ga0265338_10013289
554 Ga0307511_10000897
555 Ga0265330_10000534
556 Ga0265332_10012005
557 Ga0265329_10007105
558 Ga0265316_10000112
559 Ga0307509_10078531
560 Ga0265342_10000183
561 Ga0307405_10083291
562 Ga0307406_10047373
563 Ga0307406_10069439
564 Ga0307407_10060242
565 Ga0307407_10247731
566 Ga0307409_100030616
567 Ga0307416_100020597
568 Ga0307510_10082148
569 Ga0373934_0000043
570 Ga0373923_0007365
571 Ga0373923_0017819
572 Ga0373936_0009481
573 Ga0373953_0000011
574 Ga0373953_0005149
575 Ga0373954_0003962
576 Ga0373956_0001215
577 Ga0373956_0049303
578 Ga0373957_0000354
579 Ga0373957_0050370
580 Ga0373943_0149146
581 Ga0373955_0000089
582 Ga0373955_0043643
583 Ga0373924_0000028
584 Ga0373924_0012574
585 Ga0373931_0344230
586 Ga0373933_0000011
587 Ga0373933_0006131
588 Ga0373947_0216138
589 Ga0373937_0000021
590 Ga0373937_0343019
591 Ga0372808_002919
592 Ga0316582_0052294
593 Ga0373925_0031996
594 Ga0395900_0009063
595 Ga0395905_0134171
596 Ga0466986_0028249
597 Ga0466969_0034116
598 Ga0466972_0005336
599 Ga0466966_0048890
600 Ga0466966_0121235
601 Ga0466961_0000722
602 Ga0466961_0051579
603 Ga0466961_0099541
604 Ga0466963_0002331
605 Ga0466963_0020952
606 Ga0466971_0024304
607 Ga0466970_0000986
608 Ga0466970_0075400
609 Ga0466957_0003450
610 Ga0466957_0231116
611 Ga0466960_0020150
612 Ga0466959_0066377
613 Ga0466959_0076602
614 Ga0466959_0255250
615 Ga0466958_0003876
616 Ga0466958_0093857
617 Ga0466958_0283832
618 Ga0466967_0012358
619 Ga0466967_0059105
620 Ga0495592_0000013
621 Ga0495592_0148725
622 Ga0495629_0167133
623 Ga0495641_0051523
624 Ga0495651_0000022
625 Ga0495651_0012895
626 Ga0495651_0041639
627 Ga0495651_0144149
628 Ga0495653_0001350
629 Ga0495582_0028765
630 Ga0495605_0117687
631 Ga0495664_0006279
632 Ga0495664_0202031
633 Ga0495608_0000029
634 Ga0495608_0021608
635 Ga0495618_0052600
636 Ga0495628_0000192
637 Ga0495628_0018519
638 Ga0495630_0207999
639 Ga0495652_0000083
640 Ga0495652_0012883
641 Ga0495665_0002376
642 Ga0495587_0000022
643 Ga0495587_0087345
644 Ga0495645_0113300
645 Ga0495645_0172227
646 Ga0495667_0000028
647 Ga0495667_0046654
648 Ga0495667_0160865
649 Ga0495634_0036645
650 Ga0495635_0005724
651 Ga0495635_0069366
652 Ga0495657_0000036
653 Ga0495657_0044947
654 Ga0495599_0000587
655 Ga0495599_0101153
656 Ga0495623_0000084
657 Ga0495623_0035548
658 Ga0495623_0119077
659 Ga0495623_0145119
660 Ga0495646_0030966
661 Ga0495646_0037443
662 Ga0495646_0051390
663 Ga0495658_0071033
664 Ga0495600_0019889
665 Ga0495600_0024754
666 Ga0495600_0217644
667 Ga0495604_0000023
668 Ga0495604_0067299
669 Ga0495674_0241177
670 Ga0495676_0034091
671 Ga0495680_0000466
672 Ga0495680_0077041
673 Ga0495675_0001572
674 Ga0495675_0055838
675 Ga0495684_0092645
676 Ga0495593_0061529
677 Ga0495602_0000121
678 Ga0495602_0046061
679 Ga0496100_0216106
680 Ga0496101_0008122
681 Ga0496101_0010829
682 Ga0496101_0254716
683 Ga0496102_0023840
684 Ga0496102_0097547
685 Ga0496103_0012822
686 Ga0496104_0016281
687 Ga0496104_0018076
688 Ga0496104_0026722
689 Ga0496104_0041023
690 Ga0496104_0223070
691 Ga0496105_0025388
692 Ga0496105_0148701
693 Ga0496106_0011936
694 Ga0496106_0033309
695 Ga0496106_0044804
696 Ga0496107_0011526
697 Ga0496107_0020767
698 Ga0496108_0001455
699 Ga0496108_0010695
700 Ga0496108_0063187
701 Ga0496109_0050951
702 Ga0496112_0011094
703 Ga0496112_0037095
704 Ga0496112_0308553
705 Ga0496113_0011697
706 Ga0496113_0015942
707 Ga0496114_0317256
708 Ga0496117_0157218
709 Ga0496118_0099742
710 Ga0496125_0038273
711 Ga0501036_0233291
712 Ga0501067_0003797
713 Ga0501076_0281335
714 nmdc:mga0yw44_231687_c1
715 nmdc:mga05p37_15744_c1
716 nmdc:mga09592_6683_c1
717 nmdc:mga0qj67_589_c1
718 nmdc:mga0n895_44994_c1
719 nmdc:mga0n895_522_c1
720 nmdc:mga0n895_82295_c1
721 nmdc:mga0rr50_1375_c1
722 nmdc:mga0rr50_21306_c1
723 nmdc:mga08x19_123613_c1
724 nmdc:mga0a205_258221_c1
725 nmdc:mga0a205_54372_c1
726 Ga0495601_0081725
727 Ga0495612_0013788
728 Ga0495595_0000114
729 Ga0495619_0008345
730 Ga0495619_0042315
731 Ga0500562_013516
732 Ga0501082_0390014
733 2599448278
734 2644166197
735 2644346798
736 2900578970
737 2928060602
738 8057573793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

41

340

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9309 2 324
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9252 2 324
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.9192 1 329
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.9107 2 329
6ovq-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw 0.9031 1 328
ID Description Score Start End Superfamily
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9288 2 323 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9259 2 323 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.925 1 321 3.20.20.100
3n2tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9107 2 329 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9083 1 321 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A3D2J6A3-F1-model_v4 Aldo/keto reductase 0.9852 158 321 GO:0005829
AF-A0A0S8KEC8-F1-model_v4 Aldo/keto reductase 0.9728 1 321 GO:0005829
GO:0016491
AF-A0A7X8FWV5-F1-model_v4 Aldo/keto reductase 0.967 1 234 GO:0005829
GO:0016491
AF-A0A3M1A6V9-F1-model_v4 Aldo/keto reductase 0.9659 1 321 GO:0005829
GO:0016491
AF-I4KL52-F1-model_v4 deleted 0.9654 1 331

Map