F425191

General Info

Members Datasets Scaffolds Average Seq Length
369 218 738 294

Family's Representative Sequence

Representative Sequence 3300049521|Ga0501298_003375|Ga0501298_003375_180_1196
Length 338
Sequence MSRAAAPGSRESRVHYVGRPGSTPQASRLAQEKKAERIPVTGEQGPYGVKPAPLIETTKVGSLTIHGIQAGGQRLDGGAMFGVVPKPLWERRIPADERNRIQLGMRCLLVDHPSGPILIDTGAGNKEDQKFKDIYGIENEGTEGRTSLEDGLKELGLATTDIAIVINTHLHFDHAGGNTWLNEAGELGLSFPNARYVVKKGEYDYATHPNERTAASYFERNYMPVVRSHKFEFVVREKEIVKGIRVIPTPGHTPFHQSVLIESGGEKGFFLADMCPTSAHIPLPWIMGYDVEPLVTLETKRRIFRQAEDENWLLIFEHDASVPWGRIEHDGKSYRLKV

Samples

Sample ID Description Type Environment
1 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
204 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
209 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
210 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.64
Stem 0
Stem Tuber 0
Unclassified 2.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501298_003375 3300049521 Bacteria 2476
2 Ga0065715_10089831 3300005293 Bacteria 8382
3 Ga0070658_10066558 3300005327 Bacteria 2943
4 Ga0070658_10107769 3300005327 Bacteria 2305
5 Ga0070658_10268718 3300005327 Bacteria 1450
6 Ga0070676_10146443 3300005328 Bacteria 1508
7 Ga0070683_100000514 3300005329 Bacteria 27185
8 Ga0070683_100007640 3300005329 Bacteria 9148
9 Ga0070683_100042269 3300005329 Bacteria 4197
10 Ga0070683_100082545 3300005329 Bacteria 3010
11 Ga0070683_100082984 3300005329 Bacteria 3002
12 Ga0070683_100094317 3300005329 Bacteria 2813
13 Ga0070683_100428036 3300005329 Unclassified 1263
14 Ga0070670_100007272 3300005331 Bacteria 9388
15 Ga0070670_100018024 3300005331 Bacteria 6059
16 Ga0070670_100197677 3300005331 Bacteria 1747
17 Ga0070680_100000247 3300005336 Bacteria 35633
18 Ga0070680_100032339 3300005336 Bacteria 4211
19 Ga0070680_100041088 3300005336 Bacteria 3749
20 Ga0070680_100056329 3300005336 Bacteria 3214
21 Ga0070680_100099340 3300005336 Bacteria 2415
22 Ga0070680_100105958 3300005336 Bacteria 2337
23 Ga0070680_100360642 3300005336 Bacteria 1236
24 Ga0070682_100015886 3300005337 Bacteria 4370
25 Ga0068868_100023798 3300005338 Bacteria 4638
26 Ga0068868_100074269 3300005338 Bacteria 2715
27 Ga0070689_100014547 3300005340 Bacteria 5719
28 Ga0070689_100128040 3300005340 Bacteria 2034
29 Ga0070691_10013034 3300005341 Bacteria 3808
30 Ga0070687_100018262 3300005343 Bacteria 3241
31 Ga0070687_100027807 3300005343 Bacteria 2736
32 Ga0070661_100010685 3300005344 Bacteria 6387
33 Ga0070661_100115055 3300005344 Bacteria 2011
34 Ga0070692_10004843 3300005345 Bacteria 5661
35 Ga0070668_100006902 3300005347 Bacteria 8416
36 Ga0070668_100022953 3300005347 Bacteria 4717
37 Ga0070669_100003079 3300005353 Bacteria 12001
38 Ga0070669_100164071 3300005353 Bacteria 1728
39 Ga0070675_100002631 3300005354 Bacteria 13492
40 Ga0070675_100002663 3300005354 Bacteria 13424
41 Ga0070671_100046843 3300005355 Bacteria 3596
42 Ga0070671_100182935 3300005355 Bacteria 1775
43 Ga0070674_100074461 3300005356 Bacteria 2410
44 Ga0070674_100251283 3300005356 Bacteria 1389
45 Ga0070674_100385827 3300005356 Bacteria 1141
46 Ga0070673_100218969 3300005364 Bacteria 1647
47 Ga0070673_100271051 3300005364 Bacteria 1486
48 Ga0070673_100591330 3300005364 Unclassified 1011
49 Ga0070688_100049911 3300005365 Bacteria 2605
50 Ga0070659_100017542 3300005366 Bacteria 5392
51 Ga0070667_100031097 3300005367 Bacteria 4450
52 Ga0070667_100149750 3300005367 Bacteria 2049
53 Ga0070667_100278861 3300005367 Bacteria 1500
54 Ga0070713_100050602 3300005436 Bacteria 3433
55 Ga0070701_10029271 3300005438 Bacteria 2714
56 Ga0070700_100018621 3300005441 Bacteria 3994
57 Ga0070694_100087091 3300005444 Bacteria 2184
58 Ga0070694_100137069 3300005444 Bacteria 1774
59 Ga0070708_100000308 3300005445 Bacteria 36695
60 Ga0070708_100001912 3300005445 Bacteria 16029
61 Ga0070662_100012561 3300005457 Bacteria 5617
62 Ga0070662_100023509 3300005457 Bacteria 4234
63 Ga0070681_10000404 3300005458 Bacteria 35078
64 Ga0070681_10001575 3300005458 Bacteria 20246
65 Ga0070681_10008932 3300005458 Bacteria 9851
66 Ga0070681_10039580 3300005458 Bacteria 4725
67 Ga0070681_10045761 3300005458 Bacteria 4377
68 Ga0070681_10059952 3300005458 Bacteria 3784
69 Ga0070681_10145738 3300005458 Bacteria 2297
70 Ga0068867_100035566 3300005459 Bacteria 3614
71 Ga0068867_100082934 3300005459 Bacteria 2419
72 Ga0070685_10046885 3300005466 Bacteria 2483
73 Ga0070707_100001652 3300005468 Bacteria 21586
74 Ga0070707_100173327 3300005468 Bacteria 2102
75 Ga0070707_100208410 3300005468 Bacteria 1905
76 Ga0070698_100000416 3300005471 Bacteria 45414
77 Ga0070698_100224188 3300005471 Bacteria 1813
78 Ga0070699_100010664 3300005518 Bacteria 7953
79 Ga0070699_100088806 3300005518 Bacteria 2700
80 Ga0070679_100016670 3300005530 Bacteria 7097
81 Ga0070679_100035614 3300005530 Bacteria 4938
82 Ga0070679_100051815 3300005530 Bacteria 4089
83 Ga0070679_100088616 3300005530 Bacteria 3081
84 Ga0070679_100107927 3300005530 Bacteria 2770
85 Ga0070684_100007396 3300005535 Bacteria 8537
86 Ga0070684_100024884 3300005535 Bacteria 5025
87 Ga0070684_100035266 3300005535 Bacteria 4281
88 Ga0070684_100160570 3300005535 Bacteria 2039
89 Ga0070684_100544853 3300005535 Bacteria 1076
90 Ga0070697_100347345 3300005536 Bacteria 1281
91 Ga0068853_100160373 3300005539 Bacteria 2029
92 Ga0070672_100004984 3300005543 Bacteria 8750
93 Ga0070672_100007479 3300005543 Bacteria 7416
94 Ga0070672_100048262 3300005543 Bacteria 3307
95 Ga0070695_100005117 3300005545 Bacteria 7732
96 Ga0070704_100193440 3300005549 Bacteria 1637
97 Ga0068855_100028746 3300005563 Bacteria 6651
98 Ga0068855_100106164 3300005563 Bacteria 3228
99 Ga0068855_100226267 3300005563 Bacteria 2096
100 Ga0070664_100002711 3300005564 Bacteria 14296
101 Ga0070664_100013154 3300005564 Bacteria 6738
102 Ga0070664_100032351 3300005564 Bacteria 4374
103 Ga0070664_100045406 3300005564 Bacteria 3711
104 Ga0070664_100182898 3300005564 Bacteria 1864
105 Ga0068857_100012151 3300005577 Bacteria 7490
106 Ga0068857_100015739 3300005577 Bacteria 6617
107 Ga0068857_100604925 3300005577 Bacteria 1036
108 Ga0068856_100110443 3300005614 Bacteria 2746
109 Ga0068852_100350788 3300005616 Bacteria 1441
110 Ga0068852_100370800 3300005616 Bacteria 1402
111 Ga0068859_100041401 3300005617 Bacteria 4627
112 Ga0068859_100388029 3300005617 Bacteria 1492
113 Ga0068864_100136560 3300005618 Bacteria 2208
114 Ga0068866_10040968 3300005718 Bacteria 2295
115 Ga0068866_10207723 3300005718 Bacteria 1174
116 Ga0068861_100001019 3300005719 Bacteria 17119
117 Ga0068861_100029592 3300005719 Bacteria 4007
118 Ga0068861_100071886 3300005719 Bacteria 2683
119 Ga0068851_10072454 3300005834 Bacteria 1785
120 Ga0068863_100017257 3300005841 Bacteria 6923
121 Ga0068858_100099731 3300005842 Bacteria 2708
122 Ga0068860_100017652 3300005843 Bacteria 6953
123 Ga0068862_100000376 3300005844 Bacteria 48418
124 Ga0068862_100010289 3300005844 Bacteria 7718
125 Ga0097621_100173176 3300006237 Bacteria 1861
126 Ga0097621_100283857 3300006237 Bacteria 1458
127 Ga0075431_100018358 3300006847 Bacteria 7122
128 Ga0075433_10027210 3300006852 Bacteria 4847
129 Ga0075433_10087959 3300006852 Bacteria 2744
130 Ga0075434_100003975 3300006871 Bacteria 13242
131 Ga0075434_100092523 3300006871 Bacteria 3026
132 Ga0075429_100347937 3300006880 Bacteria 1298
133 Ga0068865_100001514 3300006881 Bacteria 13558
134 Ga0075436_100027864 3300006914 Bacteria 3888
135 Ga0097620_100041401 3300006931 Bacteria 4627
136 Ga0097620_100388066 3300006931 Bacteria 1492
137 Ga0111539_10035483 3300009094 Bacteria 6037
138 Ga0105245_10257308 3300009098 Bacteria 1698
139 Ga0105245_10578102 3300009098 Bacteria 1148
140 Ga0105247_10109723 3300009101 Bacteria 1774
141 Ga0114129_10047707 3300009147 Bacteria 6017
142 Ga0114129_10162456 3300009147 Bacteria 3050
143 Ga0105243_10202260 3300009148 Bacteria 1743
144 Ga0105241_10000729 3300009174 Bacteria 24921
145 Ga0105242_10041257 3300009176 Bacteria 3722
146 Ga0105242_10121177 3300009176 Bacteria 2245
147 Ga0105248_10009365 3300009177 Bacteria 10781
148 Ga0105237_10007205 3300009545 Bacteria 12209
149 Ga0105237_10236203 3300009545 Bacteria 1829
150 Ga0105249_10000454 3300009553 Bacteria 38498
151 Ga0105249_10020862 3300009553 Bacteria 5858
152 Ga0105239_10033512 3300010375 Bacteria 5640
153 Ga0105239_10641232 3300010375 Bacteria 1213
154 Ga0105246_10546471 3300011119 Bacteria 992
155 Ga0157371_10007275 3300013102 Bacteria 8992
156 Ga0157370_10042333 3300013104 Bacteria 4389
157 Ga0157370_10339876 3300013104 Bacteria 1384
158 Ga0157370_10438383 3300013104 Bacteria 1201
159 Ga0157370_10637256 3300013104 Bacteria 975
160 Ga0157369_10048124 3300013105 Bacteria 4627
161 Ga0157369_10107160 3300013105 Bacteria 2973
162 Ga0157369_10295234 3300013105 Bacteria 1687
163 Ga0157369_10473516 3300013105 Bacteria 1296
164 Ga0157374_10346404 3300013296 Bacteria 1476
165 Ga0157374_10591515 3300013296 Bacteria 1119
166 Ga0157378_10099051 3300013297 Bacteria 2659
167 Ga0157378_10118713 3300013297 Bacteria 2435
168 Ga0157378_10166573 3300013297 Bacteria 2065
169 Ga0163162_10001492 3300013306 Bacteria 21813
170 Ga0163162_10013828 3300013306 Bacteria 7885
171 Ga0157372_10006243 3300013307 Bacteria 12673
172 Ga0157372_10176910 3300013307 Bacteria 2470
173 Ga0157375_10025086 3300013308 Bacteria 5530
174 Ga0157375_10035398 3300013308 Bacteria 4766
175 Ga0157375_10242689 3300013308 Bacteria 1961
176 Ga0163163_10068100 3300014325 Bacteria 3541
177 Ga0157380_10007646 3300014326 Bacteria 7684
178 Ga0157380_10027037 3300014326 Bacteria 4360
179 Ga0157377_10005403 3300014745 Bacteria 6004
180 Ga0157377_10347210 3300014745 Bacteria 994
181 Ga0157379_10042699 3300014968 Bacteria 4049
182 Ga0163161_10033434 3300017792 Bacteria 3675
183 Ga0207697_10013577 3300025315 Bacteria 3397
184 Ga0207692_10166718 3300025898 Bacteria 1273
185 Ga0207642_10015472 3300025899 Bacteria 2843
186 Ga0207642_10102079 3300025899 Bacteria 1442
187 Ga0207647_10050396 3300025904 Bacteria 2578
188 Ga0207699_10135391 3300025906 Bacteria 1612
189 Ga0207645_10000246 3300025907 Bacteria 44995
190 Ga0207645_10008567 3300025907 Bacteria 7125
191 Ga0207645_10014452 3300025907 Bacteria 5282
192 Ga0207643_10018537 3300025908 Bacteria 3811
193 Ga0207654_10000860 3300025911 Bacteria 16810
194 Ga0207707_10004279 3300025912 Bacteria 12632
195 Ga0207707_10005095 3300025912 Bacteria 11524
196 Ga0207707_10012211 3300025912 Bacteria 7468
197 Ga0207707_10163505 3300025912 Bacteria 1946
198 Ga0207707_10408013 3300025912 Bacteria 1166
199 Ga0207693_10011606 3300025915 Bacteria 7128
200 Ga0207663_10157461 3300025916 Bacteria 1599
201 Ga0207660_10000668 3300025917 Bacteria 22904
202 Ga0207660_10324801 3300025917 Bacteria 1229
203 Ga0207662_10002032 3300025918 Bacteria 10012
204 Ga0207662_10003812 3300025918 Bacteria 7829
205 Ga0207657_10163247 3300025919 Bacteria 1808
206 Ga0207649_10019881 3300025920 Bacteria 3844
207 Ga0207649_10085359 3300025920 Bacteria 2054
208 Ga0207652_10011203 3300025921 Bacteria 7225
209 Ga0207652_10014328 3300025921 Bacteria 6420
210 Ga0207652_10032586 3300025921 Bacteria 4383
211 Ga0207646_10091296 3300025922 Bacteria 2726
212 Ga0207646_10161405 3300025922 Bacteria 2023
213 Ga0207681_10002554 3300025923 Bacteria 11555
214 Ga0207694_10435314 3300025924 Bacteria 1093
215 Ga0207650_10004487 3300025925 Bacteria 9540
216 Ga0207650_10018453 3300025925 Bacteria 4896
217 Ga0207659_10003254 3300025926 Bacteria 9727
218 Ga0207659_10024660 3300025926 Bacteria 4033
219 Ga0207644_10082527 3300025931 Bacteria 2378
220 Ga0207644_10086165 3300025931 Bacteria 2332
221 Ga0207690_10016435 3300025932 Bacteria 4501
222 Ga0207690_10190429 3300025932 Bacteria 1551
223 Ga0207690_10219927 3300025932 Bacteria 1453
224 Ga0207706_10000357 3300025933 Bacteria 49369
225 Ga0207706_10031835 3300025933 Bacteria 4698
226 Ga0207706_10146909 3300025933 Bacteria 2074
227 Ga0207706_10201131 3300025933 Bacteria 1747
228 Ga0207706_10305104 3300025933 Bacteria 1387
229 Ga0207709_10166348 3300025935 Bacteria 1543
230 Ga0207670_10034776 3300025936 Bacteria 3260
231 Ga0207670_10416498 3300025936 Bacteria 1077
232 Ga0207669_10126641 3300025937 Bacteria 1746
233 Ga0207669_10299700 3300025937 Bacteria 1221
234 Ga0207704_10024309 3300025938 Bacteria 3283
235 Ga0207691_10001550 3300025940 Bacteria 22813
236 Ga0207691_10042373 3300025940 Bacteria 4197
237 Ga0207711_10087112 3300025941 Bacteria 2739
238 Ga0207711_10486609 3300025941 Bacteria 1150
239 Ga0207661_10011833 3300025944 Bacteria 6336
240 Ga0207661_10013533 3300025944 Bacteria 5958
241 Ga0207661_10036618 3300025944 Bacteria 3832
242 Ga0207661_10056653 3300025944 Bacteria 3147
243 Ga0207661_10348326 3300025944 Bacteria 1336
244 Ga0207661_10460298 3300025944 Bacteria 1159
245 Ga0207679_10000484 3300025945 Bacteria 27676
246 Ga0207679_10009273 3300025945 Bacteria 6296
247 Ga0207667_10032465 3300025949 Bacteria 5626
248 Ga0207667_10039593 3300025949 Bacteria 5023
249 Ga0207667_10061469 3300025949 Bacteria 3929
250 Ga0207651_10036856 3300025960 Bacteria 3198
251 Ga0207651_10195141 3300025960 Bacteria 1618
252 Ga0207712_10001176 3300025961 Bacteria 18145
253 Ga0207712_10013123 3300025961 Bacteria 5308
254 Ga0207668_10003474 3300025972 Bacteria 9246
255 Ga0207668_10415650 3300025972 Bacteria 1140
256 Ga0207640_10228122 3300025981 Bacteria 1431
257 Ga0207658_10292231 3300025986 Bacteria 1401
258 Ga0207677_10086206 3300026023 Bacteria 2269
259 Ga0207703_10013898 3300026035 Bacteria 6276
260 Ga0207639_10353320 3300026041 Bacteria 1313
261 Ga0207708_10039083 3300026075 Bacteria 3614
262 Ga0207708_10162329 3300026075 Bacteria 1765
263 Ga0207708_10169538 3300026075 Bacteria 1728
264 Ga0207702_10328700 3300026078 Bacteria 1458
265 Ga0207641_10027354 3300026088 Bacteria 4709
266 Ga0207641_10669523 3300026088 Unclassified 1020
267 Ga0207648_10005220 3300026089 Bacteria 13139
268 Ga0207648_10050789 3300026089 Bacteria 3625
269 Ga0207674_10003135 3300026116 Bacteria 20383
270 Ga0207674_10015526 3300026116 Bacteria 8364
271 Ga0207674_10018565 3300026116 Bacteria 7555
272 Ga0207675_100000320 3300026118 Bacteria 45668
273 Ga0207675_100255520 3300026118 Bacteria 1697
274 Ga0207698_10400724 3300026142 Bacteria 1311
275 Ga0210000_1016662 3300027462 Bacteria 1111
276 Ga0209966_1013939 3300027695 Bacteria 1495
277 Ga0207428_10104356 3300027907 Bacteria 2188
278 Ga0268266_10194711 3300028379 Bacteria 1852
279 Ga0268265_10083569 3300028380 Bacteria 2528
280 Ga0268264_10134140 3300028381 Bacteria 2199
281 Ga0307413_10274486 3300031824 Unclassified 1264
282 Ga0307410_10019160 3300031852 Bacteria 4156
283 Ga0307410_10227842 3300031852 Bacteria 1437
284 Ga0307410_10342671 3300031852 Bacteria 1192
285 Ga0307407_10061814 3300031903 Bacteria 2191
286 Ga0307412_10131296 3300031911 Unclassified 1820
287 Ga0307409_100022353 3300031995 Bacteria 4359
288 Ga0307409_100113512 3300031995 Bacteria 2277
289 Ga0307409_100388932 3300031995 Unclassified 1328
290 Ga0307414_10101844 3300032004 Bacteria 2163
291 Ga0307414_10241061 3300032004 Bacteria 1497
292 Ga0373941_0000825 3300035115 Bacteria 6368
293 Ga0373954_0012759 3300035118 Bacteria 3741
294 Ga0373956_0018940 3300035119 Bacteria 2916
295 Ga0373943_0006279 3300035170 Bacteria 5337
296 Ga0373946_0005336 3300035171 Bacteria 4629
297 Ga0373935_0011291 3300035692 Bacteria 5365
298 Ga0373933_0001111 3300035724 Bacteria 16018
299 Ga0373947_0002685 3300035725 Bacteria 10692
300 Ga0373937_0000357 3300036401 Bacteria 42470
301 Ga0373937_0035172 3300036401 Bacteria 4558
302 Ga0373925_0014458 3300037068 Bacteria 5705
303 Ga0436365_0097405 3300039437 Bacteria 3153
304 Ga0439455_0014343 3300042012 Bacteria 1808
305 Ga0466959_0004093 3300045049 Bacteria 9709
306 Ga0451576_0123345 3300045051 Bacteria 2698
307 Ga0466967_0532847 3300045976 Bacteria 1155
308 Ga0495592_0002525 3300046454 Bacteria 12917
309 Ga0495603_0057778 3300046455 Bacteria 2294
310 Ga0495629_0025677 3300046459 Bacteria 4186
311 Ga0495651_0064430 3300046462 Bacteria 2800
312 Ga0495653_0000547 3300046463 Bacteria 28742
313 Ga0495580_0005504 3300046472 Bacteria 10461
314 Ga0495580_0096978 3300046472 Bacteria 2051
315 Ga0495639_0000549 3300046475 Bacteria 17446
316 Ga0495608_0000405 3300046511 Bacteria 30184
317 Ga0495618_0040041 3300046514 Bacteria 2948
318 Ga0495628_0000494 3300046516 Bacteria 36135
319 Ga0495630_0002236 3300046517 Bacteria 13469
320 Ga0495630_0067513 3300046517 Bacteria 2688
321 Ga0495652_0008315 3300046529 Bacteria 9480
322 Ga0495665_0000358 3300046531 Bacteria 23104
323 Ga0495665_0189403 3300046531 Bacteria 1068
324 Ga0495587_0000269 3300046536 Bacteria 37262
325 Ga0495645_0000748 3300046543 Bacteria 22220
326 Ga0495667_0000504 3300046559 Bacteria 24895
327 Ga0495667_0004921 3300046559 Bacteria 9034
328 Ga0495634_0066317 3300046642 Bacteria 2390
329 Ga0495635_0000200 3300046663 Bacteria 37911
330 Ga0495588_0007645 3300046674 Bacteria 4932
331 Ga0495657_0007722 3300046675 Bacteria 8274
332 Ga0495623_0000156 3300046679 Bacteria 42279
333 Ga0495623_0022588 3300046679 Bacteria 4062
334 Ga0495646_0006067 3300046680 Bacteria 7667
335 Ga0495658_0003085 3300046683 Bacteria 8333
336 Ga0495600_0011439 3300046809 Bacteria 5529
337 Ga0495581_0010474 3300047315 Bacteria 5360
338 Ga0495604_0004192 3300047317 Bacteria 11427
339 Ga0495672_0002799 3300047320 Bacteria 15557
340 Ga0495680_0004788 3300047322 Bacteria 12847
341 Ga0495675_0002012 3300047444 Bacteria 12138
342 Ga0495684_0001442 3300047471 Bacteria 19043
343 Ga0495593_0000356 3300047673 Bacteria 25268
344 Ga0495602_0003996 3300048088 Bacteria 15368
345 Ga0495602_0062164 3300048088 Bacteria 3241
346 Ga0495614_0008124 3300048089 Bacteria 4665
347 Ga0496100_0149172 3300048903 Bacteria 1666
348 Ga0496104_0140301 3300048907 Bacteria 2322
349 Ga0496112_0026167 3300048915 Bacteria 5610
350 Ga0496112_0392184 3300048915 Bacteria 1329
351 Ga0501034_0113821 3300049571 Bacteria 2695
352 Ga0501037_0069201 3300049573 Bacteria 2570
353 Ga0501223_019012 3300049663 Unclassified 1350
354 Ga0501233_053335 3300049668 Unclassified 985
355 Ga0501249_046978 3300049679 Bacteria 987
356 Ga0501257_003162 3300049686 Bacteria 3511
357 Ga0501225_0007561 3300049705 Bacteria 3147
358 Ga0501245_014395 3300049708 Unclassified 1179
359 Ga0501268_001209 3300049765 Bacteria 3148
360 Ga0501270_001173 3300049767 Unclassified 2447
361 nmdc:mga0qj67_57862_c1 3300050509 Bacteria 3073
362 nmdc:mga06r32_439030_c1 3300050510 Bacteria 1285
363 nmdc:mga08y16_76068_c1 3300050511 Bacteria 3499
364 nmdc:mga0n895_15808_c1 3300050512 Bacteria 6901
365 nmdc:mga0a205_20839_c2 3300050515 Bacteria 5385
366 nmdc:mga0a205_62105_c1 3300050515 Bacteria 3609
367 Ga0495601_0061218 3300053077 Bacteria 2390
368 Ga0495612_0000490 3300053078 Bacteria 15773
369 Ga0495619_0001014 3300053085 Bacteria 18393
370 Ga0501298_003375
371 Ga0065715_10089831
372 Ga0070658_10066558
373 Ga0070658_10107769
374 Ga0070658_10268718
375 Ga0070676_10146443
376 Ga0070683_100000514
377 Ga0070683_100007640
378 Ga0070683_100042269
379 Ga0070683_100082545
380 Ga0070683_100082984
381 Ga0070683_100094317
382 Ga0070683_100428036
383 Ga0070670_100007272
384 Ga0070670_100018024
385 Ga0070670_100197677
386 Ga0070680_100000247
387 Ga0070680_100032339
388 Ga0070680_100041088
389 Ga0070680_100056329
390 Ga0070680_100099340
391 Ga0070680_100105958
392 Ga0070680_100360642
393 Ga0070682_100015886
394 Ga0068868_100023798
395 Ga0068868_100074269
396 Ga0070689_100014547
397 Ga0070689_100128040
398 Ga0070691_10013034
399 Ga0070687_100018262
400 Ga0070687_100027807
401 Ga0070661_100010685
402 Ga0070661_100115055
403 Ga0070692_10004843
404 Ga0070668_100006902
405 Ga0070668_100022953
406 Ga0070669_100003079
407 Ga0070669_100164071
408 Ga0070675_100002631
409 Ga0070675_100002663
410 Ga0070671_100046843
411 Ga0070671_100182935
412 Ga0070674_100074461
413 Ga0070674_100251283
414 Ga0070674_100385827
415 Ga0070673_100218969
416 Ga0070673_100271051
417 Ga0070673_100591330
418 Ga0070688_100049911
419 Ga0070659_100017542
420 Ga0070667_100031097
421 Ga0070667_100149750
422 Ga0070667_100278861
423 Ga0070713_100050602
424 Ga0070701_10029271
425 Ga0070700_100018621
426 Ga0070694_100087091
427 Ga0070694_100137069
428 Ga0070708_100000308
429 Ga0070708_100001912
430 Ga0070662_100012561
431 Ga0070662_100023509
432 Ga0070681_10000404
433 Ga0070681_10001575
434 Ga0070681_10008932
435 Ga0070681_10039580
436 Ga0070681_10045761
437 Ga0070681_10059952
438 Ga0070681_10145738
439 Ga0068867_100035566
440 Ga0068867_100082934
441 Ga0070685_10046885
442 Ga0070707_100001652
443 Ga0070707_100173327
444 Ga0070707_100208410
445 Ga0070698_100000416
446 Ga0070698_100224188
447 Ga0070699_100010664
448 Ga0070699_100088806
449 Ga0070679_100016670
450 Ga0070679_100035614
451 Ga0070679_100051815
452 Ga0070679_100088616
453 Ga0070679_100107927
454 Ga0070684_100007396
455 Ga0070684_100024884
456 Ga0070684_100035266
457 Ga0070684_100160570
458 Ga0070684_100544853
459 Ga0070697_100347345
460 Ga0068853_100160373
461 Ga0070672_100004984
462 Ga0070672_100007479
463 Ga0070672_100048262
464 Ga0070695_100005117
465 Ga0070704_100193440
466 Ga0068855_100028746
467 Ga0068855_100106164
468 Ga0068855_100226267
469 Ga0070664_100002711
470 Ga0070664_100013154
471 Ga0070664_100032351
472 Ga0070664_100045406
473 Ga0070664_100182898
474 Ga0068857_100012151
475 Ga0068857_100015739
476 Ga0068857_100604925
477 Ga0068856_100110443
478 Ga0068852_100350788
479 Ga0068852_100370800
480 Ga0068859_100041401
481 Ga0068859_100388029
482 Ga0068864_100136560
483 Ga0068866_10040968
484 Ga0068866_10207723
485 Ga0068861_100001019
486 Ga0068861_100029592
487 Ga0068861_100071886
488 Ga0068851_10072454
489 Ga0068863_100017257
490 Ga0068858_100099731
491 Ga0068860_100017652
492 Ga0068862_100000376
493 Ga0068862_100010289
494 Ga0097621_100173176
495 Ga0097621_100283857
496 Ga0075431_100018358
497 Ga0075433_10027210
498 Ga0075433_10087959
499 Ga0075434_100003975
500 Ga0075434_100092523
501 Ga0075429_100347937
502 Ga0068865_100001514
503 Ga0075436_100027864
504 Ga0097620_100041401
505 Ga0097620_100388066
506 Ga0111539_10035483
507 Ga0105245_10257308
508 Ga0105245_10578102
509 Ga0105247_10109723
510 Ga0114129_10047707
511 Ga0114129_10162456
512 Ga0105243_10202260
513 Ga0105241_10000729
514 Ga0105242_10041257
515 Ga0105242_10121177
516 Ga0105248_10009365
517 Ga0105237_10007205
518 Ga0105237_10236203
519 Ga0105249_10000454
520 Ga0105249_10020862
521 Ga0105239_10033512
522 Ga0105239_10641232
523 Ga0105246_10546471
524 Ga0157371_10007275
525 Ga0157370_10042333
526 Ga0157370_10339876
527 Ga0157370_10438383
528 Ga0157370_10637256
529 Ga0157369_10048124
530 Ga0157369_10107160
531 Ga0157369_10295234
532 Ga0157369_10473516
533 Ga0157374_10346404
534 Ga0157374_10591515
535 Ga0157378_10099051
536 Ga0157378_10118713
537 Ga0157378_10166573
538 Ga0163162_10001492
539 Ga0163162_10013828
540 Ga0157372_10006243
541 Ga0157372_10176910
542 Ga0157375_10025086
543 Ga0157375_10035398
544 Ga0157375_10242689
545 Ga0163163_10068100
546 Ga0157380_10007646
547 Ga0157380_10027037
548 Ga0157377_10005403
549 Ga0157377_10347210
550 Ga0157379_10042699
551 Ga0163161_10033434
552 Ga0207697_10013577
553 Ga0207692_10166718
554 Ga0207642_10015472
555 Ga0207642_10102079
556 Ga0207647_10050396
557 Ga0207699_10135391
558 Ga0207645_10000246
559 Ga0207645_10008567
560 Ga0207645_10014452
561 Ga0207643_10018537
562 Ga0207654_10000860
563 Ga0207707_10004279
564 Ga0207707_10005095
565 Ga0207707_10012211
566 Ga0207707_10163505
567 Ga0207707_10408013
568 Ga0207693_10011606
569 Ga0207663_10157461
570 Ga0207660_10000668
571 Ga0207660_10324801
572 Ga0207662_10002032
573 Ga0207662_10003812
574 Ga0207657_10163247
575 Ga0207649_10019881
576 Ga0207649_10085359
577 Ga0207652_10011203
578 Ga0207652_10014328
579 Ga0207652_10032586
580 Ga0207646_10091296
581 Ga0207646_10161405
582 Ga0207681_10002554
583 Ga0207694_10435314
584 Ga0207650_10004487
585 Ga0207650_10018453
586 Ga0207659_10003254
587 Ga0207659_10024660
588 Ga0207644_10082527
589 Ga0207644_10086165
590 Ga0207690_10016435
591 Ga0207690_10190429
592 Ga0207690_10219927
593 Ga0207706_10000357
594 Ga0207706_10031835
595 Ga0207706_10146909
596 Ga0207706_10201131
597 Ga0207706_10305104
598 Ga0207709_10166348
599 Ga0207670_10034776
600 Ga0207670_10416498
601 Ga0207669_10126641
602 Ga0207669_10299700
603 Ga0207704_10024309
604 Ga0207691_10001550
605 Ga0207691_10042373
606 Ga0207711_10087112
607 Ga0207711_10486609
608 Ga0207661_10011833
609 Ga0207661_10013533
610 Ga0207661_10036618
611 Ga0207661_10056653
612 Ga0207661_10348326
613 Ga0207661_10460298
614 Ga0207679_10000484
615 Ga0207679_10009273
616 Ga0207667_10032465
617 Ga0207667_10039593
618 Ga0207667_10061469
619 Ga0207651_10036856
620 Ga0207651_10195141
621 Ga0207712_10001176
622 Ga0207712_10013123
623 Ga0207668_10003474
624 Ga0207668_10415650
625 Ga0207640_10228122
626 Ga0207658_10292231
627 Ga0207677_10086206
628 Ga0207703_10013898
629 Ga0207639_10353320
630 Ga0207708_10039083
631 Ga0207708_10162329
632 Ga0207708_10169538
633 Ga0207702_10328700
634 Ga0207641_10027354
635 Ga0207641_10669523
636 Ga0207648_10005220
637 Ga0207648_10050789
638 Ga0207674_10003135
639 Ga0207674_10015526
640 Ga0207674_10018565
641 Ga0207675_100000320
642 Ga0207675_100255520
643 Ga0207698_10400724
644 Ga0210000_1016662
645 Ga0209966_1013939
646 Ga0207428_10104356
647 Ga0268266_10194711
648 Ga0268265_10083569
649 Ga0268264_10134140
650 Ga0307413_10274486
651 Ga0307410_10019160
652 Ga0307410_10227842
653 Ga0307410_10342671
654 Ga0307407_10061814
655 Ga0307412_10131296
656 Ga0307409_100022353
657 Ga0307409_100113512
658 Ga0307409_100388932
659 Ga0307414_10101844
660 Ga0307414_10241061
661 Ga0373941_0000825
662 Ga0373954_0012759
663 Ga0373956_0018940
664 Ga0373943_0006279
665 Ga0373946_0005336
666 Ga0373935_0011291
667 Ga0373933_0001111
668 Ga0373947_0002685
669 Ga0373937_0000357
670 Ga0373937_0035172
671 Ga0373925_0014458
672 Ga0436365_0097405
673 Ga0439455_0014343
674 Ga0466959_0004093
675 Ga0451576_0123345
676 Ga0466967_0532847
677 Ga0495592_0002525
678 Ga0495603_0057778
679 Ga0495629_0025677
680 Ga0495651_0064430
681 Ga0495653_0000547
682 Ga0495580_0005504
683 Ga0495580_0096978
684 Ga0495639_0000549
685 Ga0495608_0000405
686 Ga0495618_0040041
687 Ga0495628_0000494
688 Ga0495630_0002236
689 Ga0495630_0067513
690 Ga0495652_0008315
691 Ga0495665_0000358
692 Ga0495665_0189403
693 Ga0495587_0000269
694 Ga0495645_0000748
695 Ga0495667_0000504
696 Ga0495667_0004921
697 Ga0495634_0066317
698 Ga0495635_0000200
699 Ga0495588_0007645
700 Ga0495657_0007722
701 Ga0495623_0000156
702 Ga0495623_0022588
703 Ga0495646_0006067
704 Ga0495658_0003085
705 Ga0495600_0011439
706 Ga0495581_0010474
707 Ga0495604_0004192
708 Ga0495672_0002799
709 Ga0495680_0004788
710 Ga0495675_0002012
711 Ga0495684_0001442
712 Ga0495593_0000356
713 Ga0495602_0003996
714 Ga0495602_0062164
715 Ga0495614_0008124
716 Ga0496100_0149172
717 Ga0496104_0140301
718 Ga0496112_0026167
719 Ga0496112_0392184
720 Ga0501034_0113821
721 Ga0501037_0069201
722 Ga0501223_019012
723 Ga0501233_053335
724 Ga0501249_046978
725 Ga0501257_003162
726 Ga0501225_0007561
727 Ga0501245_014395
728 Ga0501268_001209
729 Ga0501270_001173
730 nmdc:mga0qj67_57862_c1
731 nmdc:mga06r32_439030_c1
732 nmdc:mga08y16_76068_c1
733 nmdc:mga0n895_15808_c1
734 nmdc:mga0a205_20839_c2
735 nmdc:mga0a205_62105_c1
736 Ga0495601_0061218
737 Ga0495612_0000490
738 Ga0495619_0001014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

105

318

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3esh-assembly1.cif.gz_A crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 0.8329 11 294
3esh-assembly1.cif.gz_A crystal structure of a probable metal-dependent hydrolase from staphylococcus aureus. northeast structural genomics target zr314 0.83 11 294
1p9e-assembly1.cif.gz_A crystal structure analysis of methyl parathion hydrolase from pseudomonas sp wbc-3 0.8132 5 289
4le6-assembly1.cif.gz_A-2 crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes 0.8055 5 290
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.7886 8 290
ID Description Score Start End Superfamily
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8607 12 283 3.60.15.10
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8575 12 283 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8003 5 294 3.60.15.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7813 5 290 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.778 5 289 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A1G0LC21-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9583 73 291
AF-A0A2V7G8V8-F1-model_v4 MBL fold metallo-hydrolase 0.9559 81 291 GO:0016787
AF-A0A257RPH2-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.953 129 290
AF-A0A1G0VI05-F1-model_v4 MBL fold metallo-hydrolase 0.9506 101 291 GO:0016787
AF-A0A2V9DAC1-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9505 102 290

Map