F425178

General Info

Members Datasets Scaffolds Average Seq Length
369 197 183 444

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0012172|Ga0496111_0012172_3462_4955
Length 478
Sequence MLNKAAHKEKLKKLILSGHYTILCIKHGGFNLATRVPFSFILVIGLMLFALFFGAGNLIFPPMLGQSAGMNIWSANAGFLITGVGLPLLGVLALGFSGKDDLQSLASRVHPVFGIVFTTVLYLAIGPLFALPRSGNVSFEIGVKPFLSENSGPLPLLIFTIIFFSITCLFSINPAKVVGIVGKILTPIKITFIGILVVVAFNHPIGDFQSPIKNYSVQPFFNGFREGYLTMDTLASFVFGIIIINAIKEKGAKTKKQIMVVCAKATGIAAFFLATMYSALSYMGASSVEKLGHLENGGTILAKVSDYYFGAYGGILLGLMITVACLTTSVGLVTSCSSFFHKLFPKVPYKTIAISLSIFSAIVANIGLTQLIAVSVPLLTAIYPLAIVLIFLTFFHSLFKGKAEVYQGSLLLTFIISLFDGLNRAGIHFSSINNFFNEILPMYDVGLGWIIPAIVGGFIGFSSSILRGKFGLNPPTSS

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
3 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
4 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
5 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
6 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
7 2554235283 Bacillus safensis VK Isolate Rhizosphere
8 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
9 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
10 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
11 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
12 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
13 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
14 2643221729 Bacillus sp. Root11 Isolate Unclassified
15 2643221730 Bacillus sp. Root131 Isolate Unclassified
16 2643221731 Bacillus sp. Root147 Isolate Unclassified
17 2643221732 Bacillus sp. Root239 Isolate Unclassified
18 2643221735 Bacillus sp. Root920 Isolate Unclassified
19 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
20 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
21 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
22 2684622632 Bacillus cereus 905 Isolate Unclassified
23 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
24 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
25 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
26 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
27 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
28 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
29 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
30 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
31 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
32 2738541295 Bacillus sp. OK085 Isolate Unclassified
33 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
34 2738541358 Bacillus sp. OV752 Isolate Unclassified
35 2738543006 Bacillus sp. OK077 Isolate Unclassified
36 2738543010 Bacillus sp. YR335 Isolate Unclassified
37 2738543017 Bacillus sp. OV186 Isolate Unclassified
38 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
39 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
40 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
41 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
42 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
43 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
44 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
45 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
46 2811994870 Bacillus sp. JB4 Isolate Unclassified
47 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
48 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
49 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
50 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
51 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
52 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
53 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
54 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
55 2842682962 Bacillus sp. R-72492 Isolate Unclassified
56 2842882022 Bacillus sp. R-71893 Isolate Unclassified
57 2849139964 Bacillus sp. R-71875 Isolate Unclassified
58 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
59 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
60 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
61 2857581216 Bacillus sp. R-71922 Isolate Unclassified
62 2857586860 Bacillus sp. R-71935 Isolate Unclassified
63 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
64 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
65 2860837431 Bacillus sp. WR11 Isolate Unclassified
66 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
67 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
68 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
69 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
70 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
71 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
72 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
73 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
74 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
75 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
76 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
77 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
78 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
79 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
80 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
81 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
82 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
83 2919720352 Priestia megaterium 4340 Isolate Unclassified
84 2919726948 Bacillus pumilus 4489 Isolate Unclassified
85 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
86 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
87 2929004312 Priestia megaterium 1104 Isolate Unclassified
88 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
89 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
90 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
91 2938917290 Bacillus sp. CR71 Isolate Unclassified
92 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
93 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
94 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
95 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
96 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
97 2965761152 Bacillus sp. COPE52 Isolate Unclassified
98 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
99 2969141011 Bacillus velezensis MH25 Isolate Unclassified
100 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
101 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
102 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
103 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
104 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
105 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
106 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
107 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
108 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
109 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
110 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
111 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
112 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
113 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
114 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
115 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
116 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
117 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
118 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
119 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
120 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
121 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
122 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
123 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
183 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
184 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
185 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
186 8022653035 Bacillus sp. Rc4 Isolate Unclassified
187 8022792930 Bacillus sp. Xin Isolate Rhizosphere
188 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
189 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
190 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
191 8023438354 Bacillus sp. BH2 Isolate Unclassified
192 8023444577 Bacillus sp. BH32 Isolate Unclassified
193 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
194 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
195 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
196 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
197 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 46.07
Metatranscriptomes 3.25
Isolates 50.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.34
Nodule 0.27
Rhizoplane 10.57
Rhizosphere 34.96
Stem 0
Stem Tuber 0
Unclassified 36.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1002099 3300002987 Bacteria 7822
2 JGI25159J45721_1007631 3300002987 Bacteria 3076
3 JGI25151J46595_10000046 3300003187 Bacteria 168647
4 JGI25151J46595_10003522 3300003187 Bacteria 8619
5 JGI25151J46595_10003573 3300003187 Bacteria 8526
6 JGI25151J46595_10004131 3300003187 Bacteria 7765
7 JGI25151J46595_10004500 3300003187 Bacteria 7366
8 JGI25151J46595_10005816 3300003187 Bacteria 6310
9 JGI25151J46595_10006406 3300003187 Bacteria 5917
10 JGI25151J46595_10006805 3300003187 Bacteria 5688
11 JGI25151J46595_10006978 3300003187 Bacteria 5593
12 JGI25151J46595_10009190 3300003187 Bacteria 4700
13 JGI25151J46595_10009730 3300003187 Bacteria 4529
14 JGI25151J46595_10039308 3300003187 Bacteria 1749
15 rootH1_10012595 3300003316 Bacteria 17709
16 rootH1_10012595 3300003323 Bacteria 1107
17 rootH1_10042671 3300003316 Bacteria 12660
18 rootH1_10059339 3300003316 Bacteria 3072
19 rootH1_10161720 3300003316 Bacteria 1963
20 Ga0006562J51391_1000108 3300003578 Bacteria 1686
21 Ga0006562J51391_1000170 3300003578 Bacteria 4710
22 Ga0055532_1000238 3300003758 Bacteria 40402
23 Ga0055532_1000609 3300003758 Bacteria 14303
24 Ga0055532_1002339 3300003758 Bacteria 4019
25 Ga0055535_1005228 3300003761 Bacteria 2907
26 Ga0055528_1025278 3300003790 Bacteria 1749
27 Ga0055541_1000368 3300003841 Bacteria 13903
28 Ga0055541_1001268 3300003841 Bacteria 5558
29 Ga0105244_10005905 3300009036 Bacteria 8036
30 Ga0105244_10068620 3300009036 Bacteria 1771
31 Ga0105250_10006066 3300009092 Bacteria 5322
32 Ga0105250_10024129 3300009092 Bacteria 2451
33 Ga0105250_10044952 3300009092 Bacteria 1771
34 Ga0105242_10053234 3300009176 Bacteria 3304
35 Ga0105242_10112454 3300009176 Bacteria 2324
36 Ga0157371_10001279 3300013102 Bacteria 26535
37 Ga0157374_10007063 3300013296 Bacteria 9560
38 Ga0157374_10048356 3300013296 Bacteria 3946
39 Ga0157374_10062107 3300013296 Bacteria 3500
40 Ga0157378_10129078 3300013297 Bacteria 2338
41 Ga0157376_10103935 3300014969 Bacteria 2488
42 Ga0209566_100029 3300025225 Bacteria 349213
43 Ga0209566_100052 3300025225 Bacteria 231848
44 Ga0209566_100710 3300025225 Bacteria 19042
45 Ga0209147_100010 3300025229 Bacteria 741391
46 Ga0209147_100029 3300025229 Bacteria 376498
47 Ga0209147_100513 3300025229 Bacteria 22526
48 Ga0209147_100563 3300025229 Bacteria 20851
49 Ga0209147_100732 3300025229 Bacteria 16365
50 Ga0209147_101254 3300025229 Bacteria 9982
51 Ga0209147_102392 3300025229 Bacteria 4713
52 Ga0209258_101667 3300025242 Bacteria 7099
53 Ga0209258_102659 3300025242 Bacteria 4416
54 Ga0209673_1029543 3300025273 Bacteria 1743
55 Ga0209130_1000381 3300025284 Bacteria 49461
56 Ga0209130_1002292 3300025284 Bacteria 9820
57 Ga0209130_1006068 3300025284 Bacteria 4012
58 Ga0209130_1010314 3300025284 Bacteria 2584
59 Ga0209130_1014605 3300025284 Bacteria 1964
60 Ga0209675_1018959 3300025291 Bacteria 1909
61 Ga0209025_1000001 3300025294 Bacteria 1888151
62 Ga0209025_1000258 3300025294 Bacteria 124837
63 Ga0209025_1000882 3300025294 Bacteria 46966
64 Ga0209025_1002368 3300025294 Bacteria 20183
65 Ga0209025_1003363 3300025294 Bacteria 15317
66 Ga0209025_1003837 3300025294 Bacteria 13684
67 Ga0209025_1004761 3300025294 Bacteria 11521
68 Ga0209025_1004789 3300025294 Bacteria 11476
69 Ga0209025_1004843 3300025294 Bacteria 11364
70 Ga0209025_1005016 3300025294 Bacteria 11054
71 Ga0209025_1005468 3300025294 Bacteria 10343
72 Ga0209025_1006305 3300025294 Bacteria 9262
73 Ga0209025_1006361 3300025294 Bacteria 9194
74 Ga0209025_1006893 3300025294 Bacteria 8662
75 Ga0209025_1007790 3300025294 Bacteria 7879
76 Ga0209025_1008566 3300025294 Bacteria 7334
77 Ga0209025_1008634 3300025294 Bacteria 7286
78 Ga0209025_1010518 3300025294 Bacteria 6260
79 Ga0209025_1010569 3300025294 Bacteria 6239
80 Ga0209025_1013126 3300025294 Bacteria 5232
81 Ga0209025_1020758 3300025294 Bacteria 3571
82 Ga0209025_1025816 3300025294 Bacteria 2974
83 Ga0209025_1036550 3300025294 Bacteria 2197
84 Ga0207696_1001067 3300025711 Bacteria 16172
85 Ga0207696_1005952 3300025711 Bacteria 4983
86 Ga0207696_1006984 3300025711 Bacteria 4473
87 Ga0207696_1008950 3300025711 Bacteria 3768
88 Ga0207696_1011370 3300025711 Bacteria 3210
89 Ga0207696_1020157 3300025711 Bacteria 2156
90 Ga0207655_1001899 3300025728 Bacteria 17934
91 Ga0207655_1003676 3300025728 Bacteria 11305
92 Ga0207655_1006018 3300025728 Bacteria 8112
93 Ga0207655_1008871 3300025728 Bacteria 6319
94 Ga0207655_1024544 3300025728 Bacteria 2951
95 Ga0207655_1040197 3300025728 Bacteria 2022
96 Ga0207713_1003173 3300025735 Bacteria 11382
97 Ga0207713_1004003 3300025735 Bacteria 9757
98 Ga0207713_1007577 3300025735 Bacteria 6373
99 Ga0209371_1004908 3300027312 Bacteria 5572
100 Ga0268256_1004695 3300030500 Bacteria 5571
101 Ga0307408_100012934 3300031548 Bacteria 5533
102 Ga0237819_00621 3300038705 Bacteria 11581
103 Ga0495584_0015547 3300046491 Bacteria 3879
104 Ga0495585_0023872 3300046492 Bacteria 3508
105 Ga0495622_0063763 3300046557 Bacteria 1705
106 Ga0495661_0078360 3300046665 Bacteria 1912
107 Ga0496100_0001110 3300048903 Bacteria 13044
108 Ga0496100_0001230 3300048903 Bacteria 12448
109 Ga0496101_0002290 3300048904 Bacteria 11695
110 Ga0496101_0005175 3300048904 Bacteria 8298
111 Ga0496101_0018985 3300048904 Bacteria 4684
112 Ga0496102_0005757 3300048905 Bacteria 10533
113 Ga0496102_0025052 3300048905 Bacteria 5307
114 Ga0496102_0077285 3300048905 Bacteria 3063
115 Ga0496102_0126362 3300048905 Bacteria 2390
116 Ga0496103_0002426 3300048906 Bacteria 11726
117 Ga0496104_0009856 3300048907 Bacteria 8525
118 Ga0496104_0025371 3300048907 Bacteria 5463
119 Ga0496104_0065844 3300048907 Bacteria 3439
120 Ga0496105_0000441 3300048908 Bacteria 27304
121 Ga0496105_0000851 3300048908 Bacteria 20827
122 Ga0496105_0015527 3300048908 Bacteria 6070
123 Ga0496106_0003510 3300048909 Bacteria 11690
124 Ga0496106_0025394 3300048909 Bacteria 4409
125 Ga0496106_0104249 3300048909 Bacteria 2202
126 Ga0496107_0000102 3300048910 Bacteria 41673
127 Ga0496107_0012121 3300048910 Bacteria 6013
128 Ga0496107_0060058 3300048910 Bacteria 2751
129 Ga0496108_0000406 3300048911 Bacteria 35524
130 Ga0496108_0002847 3300048911 Bacteria 13895
131 Ga0496108_0268292 3300048911 Bacteria 1485
132 Ga0496109_0012258 3300048912 Bacteria 7400
133 Ga0496109_0051179 3300048912 Bacteria 3761
134 Ga0496109_0157904 3300048912 Bacteria 2124
135 Ga0496110_0002151 3300048913 Bacteria 14704
136 Ga0496110_0032638 3300048913 Bacteria 4499
137 Ga0496110_0089420 3300048913 Bacteria 2752
138 Ga0496111_0004044 3300048914 Bacteria 9212
139 Ga0496111_0012172 3300048914 Bacteria 5819
140 Ga0496111_0078106 3300048914 Bacteria 2413
141 Ga0496112_0083229 3300048915 Bacteria 3164
142 Ga0496113_0004680 3300048916 Bacteria 8445
143 Ga0496116_0008400 3300048919 Bacteria 8964
144 Ga0496116_0008474 3300048919 Bacteria 8913
145 Ga0496116_0025175 3300048919 Bacteria 4380
146 Ga0496116_0025223 3300048919 Bacteria 4374
147 Ga0496117_0000409 3300048920 Bacteria 72196
148 Ga0496118_0054133 3300048921 Bacteria 3042
149 Ga0496118_0115480 3300048921 Bacteria 1767
150 Ga0496119_0000054 3300048922 Bacteria 181312
151 Ga0496119_0003531 3300048922 Bacteria 16145
152 Ga0496119_0012156 3300048922 Bacteria 7025
153 Ga0496119_0022309 3300048922 Bacteria 4538
154 Ga0496119_0031368 3300048922 Bacteria 3566
155 Ga0496120_0000037 3300048923 Bacteria 204517
156 Ga0496120_0000767 3300048923 Bacteria 46379
157 Ga0496120_0004126 3300048923 Bacteria 12526
158 Ga0496121_0016785 3300048924 Bacteria 7530
159 Ga0496122_0000139 3300048925 Bacteria 169425
160 Ga0496122_0012593 3300048925 Bacteria 8394
161 Ga0496122_0020776 3300048925 Bacteria 5910
162 Ga0496122_0026589 3300048925 Bacteria 4980
163 Ga0496122_0031287 3300048925 Bacteria 4433
164 Ga0496123_0004974 3300048926 Bacteria 13626
165 Ga0496125_0000084 3300048928 Bacteria 223170
166 Ga0496125_0009165 3300048928 Bacteria 10229
167 Ga0496125_0009167 3300048928 Bacteria 10226
168 Ga0496125_0045908 3300048928 Bacteria 3671
169 Ga0496126_0000266 3300048929 Bacteria 111148
170 Ga0496126_0000516 3300048929 Bacteria 75076
171 Ga0496126_0007688 3300048929 Bacteria 11766
172 Ga0496126_0030670 3300048929 Bacteria 5091
173 Ga0501306_004389 3300049127 Bacteria 1577
174 Ga0501315_003095 3300049531 Bacteria 1636
175 Ga0501317_002909 3300049533 Bacteria 1663
176 Ga0501317_003569 3300049533 Bacteria 1561
177 Ga0501318_002306 3300049534 Bacteria 1636
178 Ga0501323_004279 3300049539 Bacteria 1503
179 Ga0501323_005170 3300049539 Bacteria 1416
180 Ga0501330_000388 3300049546 Bacteria 1813
181 Ga0501332_01247 3300049548 Bacteria 1307
182 Ga0501335_001757 3300049551 Bacteria 1700
183 Ga0500566_0003669 3300053094 Bacteria 9165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0000139 Ga0496122_0000139_60560_61876 379
2 3300048929 Ga0496126_0000516 Ga0496126_0000516_60533_61849 379
3 3300049546 Ga0501330_000388 Ga0501330_000388_374_1753 388
4 3300003187 JGI25151J46595_10009190 JGI25151J46595_100091901 399
5 3300009036 Ga0105244_10005905 Ga0105244_100059058 399
6 3300009092 Ga0105250_10006066 Ga0105250_100060661 399
7 3300025294 Ga0209025_1000258 Ga0209025_100025869 399
8 3300025711 Ga0207696_1001067 Ga0207696_100106710 399
9 3300025728 Ga0207655_1006018 Ga0207655_10060182 399
10 3300038705 Ga0237819_00621 Ga0237819_00621_705_2102 399
11 3300025294 Ga0209025_1004843 Ga0209025_10048434 400
12 3300025728 Ga0207655_1003676 Ga0207655_10036765 402
13 3300025735 Ga0207713_1004003 Ga0207713_10040033 402
14 3300046665 Ga0495661_0078360 Ga0495661_0078360_340_1665 402
15 3300049548 Ga0501332_01247 Ga0501332_01247_33_1280 404
16 3300003841 Ga0055541_1001268 Ga0055541_10012682 407
17 3300025225 Ga0209566_100029 Ga0209566_100029263 407
18 3300025225 Ga0209566_100710 Ga0209566_10071012 407
19 3300025229 Ga0209147_100563 Ga0209147_1005632 408
20 iso_pu_bacteria 8007371054 8007375431 409
21 iso_pu_bacteria 2599185353 2600198299 410
22 iso_pu_bacteria 2600254943 2600401081 410
23 3300048919 Ga0496116_0008474 Ga0496116_0008474_6720_8033 413
24 iso_pu_bacteria 2808606364 2808867897 414
25 3300009036 Ga0105244_10068620 Ga0105244_100686202 415
26 3300009092 Ga0105250_10044952 Ga0105250_100449522 415
27 3300025242 Ga0209258_101667 Ga0209258_1016672 415
28 3300025294 Ga0209025_1010518 Ga0209025_10105182 415
29 3300025711 Ga0207696_1005952 Ga0207696_10059524 415
30 3300025728 Ga0207655_1040197 Ga0207655_10401972 415
31 3300025735 Ga0207713_1007577 Ga0207713_10075772 415
32 3300031548 Ga0307408_100012934 Ga0307408_1000129343 415
33 3300048919 Ga0496116_0025175 Ga0496116_0025175_2445_3758 415
34 3300048921 Ga0496118_0054133 Ga0496118_0054133_1169_2482 415
35 3300048923 Ga0496120_0004126 Ga0496120_0004126_1367_2680 415
36 3300048928 Ga0496125_0009167 Ga0496125_0009167_21_1334 415
37 3300048929 Ga0496126_0007688 Ga0496126_0007688_10343_11656 415
38 3300049551 Ga0501335_001757 Ga0501335_001757_290_1615 415
39 iso_pu_bacteria 2857460504 2857463770 416
40 iso_pu_bacteria 8022948649 8022949050 416
41 3300027312 Ga0209371_1004908 Ga0209371_10049082 418
42 3300030500 Ga0268256_1004695 Ga0268256_10046952 418
43 3300048913 Ga0496110_0032638 Ga0496110_0032638_2283_3581 418
44 3300048919 Ga0496116_0025223 Ga0496116_0025223_881_2194 418
45 3300048920 Ga0496117_0000409 Ga0496117_0000409_44228_45535 418
46 3300048922 Ga0496119_0000054 Ga0496119_0000054_123141_124448 418
47 3300048922 Ga0496119_0022309 Ga0496119_0022309_2591_3898 418
48 3300048923 Ga0496120_0000037 Ga0496120_0000037_146414_147721 418
49 3300048923 Ga0496120_0000767 Ga0496120_0000767_6865_8172 418
50 3300048925 Ga0496122_0012593 Ga0496122_0012593_174_1481 418
51 3300048926 Ga0496123_0004974 Ga0496123_0004974_6914_8221 418
52 3300048928 Ga0496125_0000084 Ga0496125_0000084_64916_66223 418
53 3300048929 Ga0496126_0000266 Ga0496126_0000266_56644_57951 418
54 3300025294 Ga0209025_1025816 Ga0209025_10258162 420
55 3300048913 Ga0496110_0002151 Ga0496110_0002151_11953_13248 420
56 3300048914 Ga0496111_0004044 Ga0496111_0004044_580_1875 420
57 3300049539 Ga0501323_005170 Ga0501323_005170_22_1317 420
58 iso_pu_bacteria 2738541295 2738814773 420
59 iso_pu_bacteria 2857465823 2857471375 421
60 iso_pu_bacteria 2857591370 2857592453 421
61 iso_pu_bacteria 8054280661 8054282585 421
62 3300053094 Ga0500566_0003669 Ga0500566_0003669_135_1547 422
63 3300013102 Ga0157371_10001279 Ga0157371_100012798 423
64 iso_pu_bacteria 2916971899 2916976341 423
65 iso_pu_bacteria 3001267043 3001270260 423
66 3300003758 Ga0055532_1000609 Ga0055532_10006091 424
67 3300009092 Ga0105250_10024129 Ga0105250_100241291 424
68 3300025229 Ga0209147_100029 Ga0209147_100029173 424
69 3300048911 Ga0496108_0268292 Ga0496108_0268292_119_1426 424
70 iso_pu_bacteria 2831905167 2831906042 424
71 iso_pu_bacteria 2816332295 2817481212 425
72 iso_pu_bacteria 2893684298 2893686447 425
73 iso_pu_bacteria 3001272096 3001275613 425
74 iso_pu_bacteria 3006858327 3006861628 425
75 iso_pu_bacteria 3006879489 3006882213 425
76 iso_pu_bacteria 2540341094 2540607548 426
77 iso_pu_bacteria 2540341094 2540607844 426
78 iso_pu_bacteria 2721755693 2723603369 426
79 iso_pu_bacteria 2728369359 2730139402 426
80 iso_pu_bacteria 2802428803 2802436077 426
81 iso_pu_bacteria 2808606399 2809055693 426
82 iso_pu_bacteria 2808606399 2809056211 426
83 iso_pu_bacteria 2860837431 2860840301 426
84 iso_pu_bacteria 2860837431 2860840622 426
85 iso_pu_bacteria 2881644220 2881645669 426
86 iso_pu_bacteria 2889276214 2889279332 426
87 iso_pu_bacteria 2904595352 2904596664 426
88 iso_pu_bacteria 2929004312 2929006663 426
89 iso_pu_bacteria 2960319331 2960319585 426
90 iso_pu_bacteria 2960375949 2960381204 426
91 iso_pu_bacteria 2962290636 2962293833 426
92 iso_pu_bacteria 2969136845 2969139522 426
93 iso_pu_bacteria 2969136845 2969139827 426
94 iso_pu_bacteria 2969765954 2969769958 426
95 iso_pu_bacteria 2969770375 2969772768 426
96 iso_pu_bacteria 2969770375 2969773131 426
97 iso_pu_bacteria 2980492589 2980495304 426
98 iso_pu_bacteria 2980492589 2980495616 426
99 iso_pu_bacteria 648028048 648169722 426
100 iso_pu_bacteria 8022653035 8022654470 426
101 iso_pu_bacteria 8022653035 8022654780 426
102 iso_pu_bacteria 8022893055 8022898485 426
103 iso_pu_bacteria 8022914991 8022917636 426
104 3300025225 Ga0209566_100052 Ga0209566_100052168 427
105 3300025242 Ga0209258_102659 Ga0209258_1026592 427
106 3300049531 Ga0501315_003095 Ga0501315_003095_196_1536 427
107 3300049533 Ga0501317_002909 Ga0501317_002909_198_1538 427
108 3300049534 Ga0501318_002306 Ga0501318_002306_196_1536 427
109 iso_pu_bacteria 2511231119 2511700621 427
110 iso_pu_bacteria 2545555800 2545557323 427
111 iso_pu_bacteria 2576861599 2578931587 427
112 iso_pu_bacteria 2593339198 2595319321 427
113 iso_pu_bacteria 2630968484 2631984474 427
114 iso_pu_bacteria 2648501850 2651532657 427
115 iso_pu_bacteria 2671180330 2672338165 427
116 iso_pu_bacteria 2671180844 2674418551 427
117 iso_pu_bacteria 2695420354 2695628617 427
118 iso_pu_bacteria 2716884898 2717915691 427
119 iso_pu_bacteria 2816332186 2816861362 427
120 iso_pu_bacteria 2842682962 2842687113 427
121 iso_pu_bacteria 2849139964 2849143762 427
122 iso_pu_bacteria 2857581216 2857585972 427
123 iso_pu_bacteria 2877768649 2877771529 427
124 iso_pu_bacteria 2880169592 2880172383 427
125 iso_pu_bacteria 2897109615 2897112657 427
126 iso_pu_bacteria 2904560550 2904563982 427
127 iso_pu_bacteria 2919414237 2919415939 427
128 iso_pu_bacteria 2928510474 2928514498 427
129 iso_pu_bacteria 2969141011 2969143977 427
130 iso_pu_bacteria 2969765954 2969769705 427
131 iso_pu_bacteria 2971893375 2971896196 427
132 iso_pu_bacteria 2977254563 2977257233 427
133 iso_pu_bacteria 3006984091 3006985080 427
134 iso_pu_bacteria 8022630665 8022632255 427
135 iso_pu_bacteria 8051952484 8051954842 427
136 iso_pu_bacteria 8052174270 8052176441 427
137 3300025294 Ga0209025_1036550 Ga0209025_10365502 428
138 iso_pu_bacteria 2554235283 2555469912 428
139 iso_pu_bacteria 2643221735 2644741501 428
140 iso_pu_bacteria 2684623153 2686997924 428
141 iso_pu_bacteria 2687453109 2687499266 428
142 iso_pu_bacteria 2744054657 2745166968 428
143 iso_pu_bacteria 2811994870 2812317119 428
144 iso_pu_bacteria 2816332295 2817480165 428
145 iso_pu_bacteria 2816332336 2817618189 428
146 iso_pu_bacteria 2818991468 2819724198 428
147 iso_pu_bacteria 2823526263 2823529081 428
148 iso_pu_bacteria 2852673933 2852676037 428
149 iso_pu_bacteria 2908665501 2908667712 428
150 iso_pu_bacteria 2919093281 2919095506 428
151 iso_pu_bacteria 2919726948 2919728786 428
152 iso_pu_bacteria 2954773129 2954773377 428
153 iso_pu_bacteria 3006858327 3006860512 428
154 iso_pu_bacteria 8057632132 8057635774 428
155 3300003761 Ga0055535_1005228 Ga0055535_10052282 429
156 iso_pu_bacteria 2551306519 2553393744 429
157 iso_pu_bacteria 2671180330 2672338060 429
158 iso_pu_bacteria 2744054657 2745169911 429
159 iso_pu_bacteria 2816332336 2817619111 429
160 iso_pu_bacteria 2857581216 2857586289 429
161 iso_pu_bacteria 3006988479 3006990312 429
162 iso_pu_bacteria 8022792930 8022794139 429
163 3300048924 Ga0496121_0016785 Ga0496121_0016785_1247_2623 430
164 iso_pu_bacteria 3001892409 3001898722 430
165 iso_pu_bacteria 2738541299 2738837784 431
166 iso_pu_bacteria 2738543010 2739234084 431
167 iso_pu_bacteria 2816332186 2816861464 431
168 iso_pu_bacteria 2816332336 2817618686 431
169 iso_pu_bacteria 2842682962 2842687222 431
170 iso_pu_bacteria 2849139964 2849143649 431
171 3300003187 JGI25151J46595_10000046 JGI25151J46595_10000046132 432
172 3300003578 Ga0006562J51391_1000170 Ga0006562J51391_10001703 432
173 3300025294 Ga0209025_1000001 Ga0209025_1000001135 432
174 3300025294 Ga0209025_1020758 Ga0209025_10207582 432
175 iso_pu_bacteria 2512564013 2512641062 432
176 iso_pu_bacteria 2738541295 2738817300 432
177 iso_pu_bacteria 2738543017 2739269611 432
178 iso_pu_bacteria 2857586860 2857588747 432
179 iso_pu_bacteria 2915597211 2915597636 432
180 iso_pu_bacteria 2929183550 2929189125 432
181 iso_pu_bacteria 8022792930 8022795060 432
182 iso_pu_bacteria 8022948649 8022953387 432
183 iso_pu_bacteria 8057582654 8057585972 432
184 3300003187 JGI25151J46595_10005816 JGI25151J46595_100058162 433
185 3300003316 rootH1_10042671 rootH1_1004267111 433
186 3300003578 Ga0006562J51391_1000108 Ga0006562J51391_10001081 433
187 3300009176 Ga0105242_10112454 Ga0105242_101124541 433
188 3300013296 Ga0157374_10007063 Ga0157374_100070635 433
189 3300046492 Ga0495585_0023872 Ga0495585_0023872_470_1825 433
190 3300048904 Ga0496101_0005175 Ga0496101_0005175_3781_5136 433
191 3300048905 Ga0496102_0005757 Ga0496102_0005757_3999_5354 433
192 3300048907 Ga0496104_0009856 Ga0496104_0009856_2134_3489 433
193 3300048908 Ga0496105_0000441 Ga0496105_0000441_17178_18533 433
194 3300048909 Ga0496106_0003510 Ga0496106_0003510_7934_9289 433
195 3300048910 Ga0496107_0000102 Ga0496107_0000102_36152_37507 433
196 3300048911 Ga0496108_0000406 Ga0496108_0000406_8836_10191 433
197 3300048912 Ga0496109_0051179 Ga0496109_0051179_273_1628 433
198 3300048919 Ga0496116_0008400 Ga0496116_0008400_1347_2702 433
199 3300048922 Ga0496119_0003531 Ga0496119_0003531_8818_10173 433
200 3300048925 Ga0496122_0026589 Ga0496122_0026589_2520_3875 433
201 iso_pu_bacteria 2744054657 2745169938 433
202 iso_pu_bacteria 2757320391 2757565062 433
203 iso_pu_bacteria 2775507192 2777836712 433
204 iso_pu_bacteria 2904524088 2904529091 433
205 iso_pu_bacteria 2919143609 2919149229 433
206 iso_pu_bacteria 2919517244 2919522400 433
207 iso_pu_bacteria 2928093941 2928099691 433
208 iso_pu_bacteria 2990275345 2990278144 433
209 iso_pu_bacteria 3006969106 3006973296 433
210 iso_pu_bacteria 3006978542 3006980732 433
211 3300025294 Ga0209025_1002368 Ga0209025_100236811 434
212 3300048905 Ga0496102_0025052 Ga0496102_0025052_2273_3610 434
213 iso_pu_bacteria 2671180330 2672335318 434
214 3300003841 Ga0055541_1000368 Ga0055541_10003689 435
215 iso_pu_bacteria 2510917027 2511178088 435
216 iso_pu_bacteria 2593339131 2595089293 435
217 iso_pu_bacteria 2643221731 2644717659 435
218 iso_pu_bacteria 2643221731 2644718467 435
219 iso_pu_bacteria 2643221732 2644724597 435
220 iso_pu_bacteria 2643221732 2644727003 435
221 iso_pu_bacteria 2684622632 2685151088 435
222 iso_pu_bacteria 2718218445 2721505691 435
223 iso_pu_bacteria 2751185905 2753808765 435
224 iso_pu_bacteria 2775507177 2777763978 435
225 iso_pu_bacteria 2818991465 2819706747 435
226 iso_pu_bacteria 2818991465 2819707626 435
227 iso_pu_bacteria 2842882022 2842882054 435
228 iso_pu_bacteria 2842882022 2842882866 435
229 iso_pu_bacteria 2904524088 2904526465 435
230 iso_pu_bacteria 2904524088 2904527290 435
231 iso_pu_bacteria 2915606848 2915607657 435
232 iso_pu_bacteria 2919143609 2919144118 435
233 iso_pu_bacteria 2919143609 2919144937 435
234 iso_pu_bacteria 2919517244 2919519315 435
235 iso_pu_bacteria 2919517244 2919520131 435
236 iso_pu_bacteria 2919720352 2919720440 435
237 iso_pu_bacteria 2919720352 2919721263 435
238 iso_pu_bacteria 2928093941 2928094986 435
239 iso_pu_bacteria 2928093941 2928095782 435
240 iso_pu_bacteria 2929004312 2929007935 435
241 iso_pu_bacteria 2929004312 2929008401 435
242 iso_pu_bacteria 2929004312 2929009504 435
243 iso_pu_bacteria 2936340661 2936343497 435
244 iso_pu_bacteria 2960319331 2960320893 435
245 iso_pu_bacteria 2960319331 2960322964 435
246 iso_pu_bacteria 2960375949 2960376501 435
247 iso_pu_bacteria 2960375949 2960378754 435
248 iso_pu_bacteria 8022792930 8022797229 435
249 iso_pu_bacteria 8022792930 8022797348 435
250 iso_pu_bacteria 8022893055 8022894899 435
251 iso_pu_bacteria 8022914991 8022919701 435
252 iso_pu_bacteria 8023438354 8023439866 435
253 iso_pu_bacteria 8057582654 8057584599 435
254 3300003187 JGI25151J46595_10006406 JGI25151J46595_100064062 436
255 3300003187 JGI25151J46595_10006805 JGI25151J46595_100068052 436
256 3300025284 Ga0209130_1010314 Ga0209130_10103142 436
257 3300025294 Ga0209025_1000882 Ga0209025_100088222 436
258 3300025294 Ga0209025_1004761 Ga0209025_100476114 436
259 3300025294 Ga0209025_1006305 Ga0209025_10063053 436
260 3300048914 Ga0496111_0012172 Ga0496111_0012172_3462_4955 436
261 3300003187 JGI25151J46595_10009730 JGI25151J46595_100097304 437
262 3300003316 rootH1_10012595 rootH1_100125953 437
263 3300013296 Ga0157374_10062107 Ga0157374_100621071 437
264 3300014969 Ga0157376_10103935 Ga0157376_101039353 437
265 3300025229 Ga0209147_100732 Ga0209147_10073218 437
266 3300025294 Ga0209025_1003363 Ga0209025_100336315 437
267 3300025711 Ga0207696_1008950 Ga0207696_10089501 437
268 3300025728 Ga0207655_1001899 Ga0207655_100189922 437
269 3300025735 Ga0207713_1003173 Ga0207713_10031739 437
270 3300048903 Ga0496100_0001230 Ga0496100_0001230_10020_11366 437
271 3300048904 Ga0496101_0002290 Ga0496101_0002290_1791_3137 437
272 3300048905 Ga0496102_0077285 Ga0496102_0077285_1663_3009 437
273 3300048906 Ga0496103_0002426 Ga0496103_0002426_655_2001 437
274 3300048907 Ga0496104_0025371 Ga0496104_0025371_2440_3786 437
275 3300048908 Ga0496105_0000851 Ga0496105_0000851_16409_17755 437
276 3300048909 Ga0496106_0104249 Ga0496106_0104249_38_1384 437
277 3300048910 Ga0496107_0012121 Ga0496107_0012121_2300_3646 437
278 3300048911 Ga0496108_0002847 Ga0496108_0002847_11468_12814 437
279 3300048912 Ga0496109_0157904 Ga0496109_0157904_87_1433 437
280 3300048914 Ga0496111_0078106 Ga0496111_0078106_543_1889 437
281 3300048922 Ga0496119_0012156 Ga0496119_0012156_4480_5826 437
282 3300048925 Ga0496122_0031287 Ga0496122_0031287_2396_3742 437
283 3300048928 Ga0496125_0009165 Ga0496125_0009165_4313_5659 437
284 iso_pu_bacteria 2857465823 2857469312 437
285 iso_pu_bacteria 2857604169 2857608938 437
286 3300025728 Ga0207655_1024544 Ga0207655_10245442 438
287 iso_pu_bacteria 2551306519 2553394824 438
288 iso_pu_bacteria 2643221729 2644704348 438
289 iso_pu_bacteria 2643221730 2644709042 438
290 iso_pu_bacteria 2684622632 2685149768 438
291 iso_pu_bacteria 2695420987 2698323409 438
292 iso_pu_bacteria 2703719227 2705993765 438
293 iso_pu_bacteria 2718218445 2721505143 438
294 iso_pu_bacteria 2738541358 2739158468 438
295 iso_pu_bacteria 2738543006 2739210951 438
296 iso_pu_bacteria 2816332186 2816866203 438
297 iso_pu_bacteria 2818991443 2819579078 438
298 iso_pu_bacteria 2842682962 2842687733 438
299 iso_pu_bacteria 2849139964 2849145598 438
300 iso_pu_bacteria 2929233124 2929235054 438
301 iso_pu_bacteria 2938917290 2938919230 438
302 iso_pu_bacteria 2947426588 2947428585 438
303 iso_pu_bacteria 2965761152 2965763103 438
304 iso_pu_bacteria 2979083700 2979085541 438
305 iso_pu_bacteria 8022621104 8022625949 438
306 iso_pu_bacteria 8023438354 8023444482 438
307 iso_pu_bacteria 8023444577 8023448309 438
308 3300002987 JGI25159J45721_1007631 JGI25159J45721_10076315 439
309 3300003187 JGI25151J46595_10003522 JGI25151J46595_100035228 439
310 3300003187 JGI25151J46595_10003573 JGI25151J46595_100035736 439
311 3300003187 JGI25151J46595_10004500 JGI25151J46595_100045004 439
312 3300003187 JGI25151J46595_10006978 JGI25151J46595_100069787 439
313 3300003316 rootH1_10059339 rootH1_100593391 439
314 3300003316 rootH1_10161720 rootH1_101617202 439
315 3300003758 Ga0055532_1000238 Ga0055532_100023823 439
316 3300003758 Ga0055532_1002339 Ga0055532_10023393 439
317 3300003790 Ga0055528_1025278 Ga0055528_10252781 439
318 3300009176 Ga0105242_10053234 Ga0105242_100532341 439
319 3300013296 Ga0157374_10048356 Ga0157374_100483562 439
320 3300013297 Ga0157378_10129078 Ga0157378_101290781 439
321 3300025229 Ga0209147_100010 Ga0209147_10001022 439
322 3300025229 Ga0209147_100513 Ga0209147_10051316 439
323 3300025229 Ga0209147_101254 Ga0209147_1012542 439
324 3300025273 Ga0209673_1029543 Ga0209673_10295432 439
325 3300025284 Ga0209130_1002292 Ga0209130_10022924 439
326 3300025294 Ga0209025_1003837 Ga0209025_10038371 439
327 3300025294 Ga0209025_1004789 Ga0209025_10047897 439
328 3300025294 Ga0209025_1005468 Ga0209025_10054683 439
329 3300025294 Ga0209025_1006893 Ga0209025_10068932 439
330 3300025294 Ga0209025_1008634 Ga0209025_10086342 439
331 3300025294 Ga0209025_1010569 Ga0209025_10105694 439
332 3300025294 Ga0209025_1013126 Ga0209025_10131264 439
333 3300025711 Ga0207696_1006984 Ga0207696_10069843 439
334 3300025711 Ga0207696_1020157 Ga0207696_10201571 439
335 3300046491 Ga0495584_0015547 Ga0495584_0015547_686_2041 439
336 3300046557 Ga0495622_0063763 Ga0495622_0063763_104_1486 439
337 3300048903 Ga0496100_0001110 Ga0496100_0001110_3169_4551 439
338 3300048904 Ga0496101_0018985 Ga0496101_0018985_1267_2649 439
339 3300048905 Ga0496102_0126362 Ga0496102_0126362_909_2291 439
340 3300048907 Ga0496104_0065844 Ga0496104_0065844_268_1650 439
341 3300048908 Ga0496105_0015527 Ga0496105_0015527_1846_3228 439
342 3300048909 Ga0496106_0025394 Ga0496106_0025394_2901_4283 439
343 3300048910 Ga0496107_0060058 Ga0496107_0060058_406_1788 439
344 3300048912 Ga0496109_0012258 Ga0496109_0012258_194_1576 439
345 3300048913 Ga0496110_0089420 Ga0496110_0089420_242_1624 439
346 3300048915 Ga0496112_0083229 Ga0496112_0083229_284_1666 439
347 3300048916 Ga0496113_0004680 Ga0496113_0004680_301_1683 439
348 3300048921 Ga0496118_0115480 Ga0496118_0115480_257_1639 439
349 3300048922 Ga0496119_0031368 Ga0496119_0031368_1065_2447 439
350 3300048925 Ga0496122_0020776 Ga0496122_0020776_3186_4568 439
351 3300048928 Ga0496125_0045908 Ga0496125_0045908_1335_2717 439
352 3300048929 Ga0496126_0030670 Ga0496126_0030670_3000_4382 439
353 3300049127 Ga0501306_004389 Ga0501306_004389_162_1544 439
354 3300049533 Ga0501317_003569 Ga0501317_003569_17_1399 439
355 3300049539 Ga0501323_004279 Ga0501323_004279_17_1399 439
356 3300025711 Ga0207696_1011370 Ga0207696_10113702 440
357 3300025728 Ga0207655_1008871 Ga0207655_10088714 440
358 3300025229 Ga0209147_102392 Ga0209147_1023921 441
359 3300025284 Ga0209130_1006068 Ga0209130_10060682 441
360 3300025291 Ga0209675_1018959 Ga0209675_10189592 441
361 3300025294 Ga0209025_1005016 Ga0209025_10050168 441
362 3300002987 JGI25159J45721_1002099 JGI25159J45721_10020995 442
363 3300003187 JGI25151J46595_10004131 JGI25151J46595_100041317 442
364 3300003187 JGI25151J46595_10039308 JGI25151J46595_100393082 442
365 3300025284 Ga0209130_1000381 Ga0209130_100038146 442
366 3300025284 Ga0209130_1014605 Ga0209130_10146052 442
367 3300025294 Ga0209025_1006361 Ga0209025_10063614 442
368 3300025294 Ga0209025_1007790 Ga0209025_10077903 442
369 3300025294 Ga0209025_1008566 Ga0209025_10085663 442

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05525

Branch_AA_trans

Branched-chain amino acid transport protein

39

466

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qoa-assembly2.cif.gz_B structure of codb, a cytosine transporter in an outward-facing conformation 0.7133 4 422
6csf-assembly2.cif.gz_M crystal structure of sodium/alanine symporter agcs with d-alanine bound 0.6995 4 372
6csf-assembly1.cif.gz_C crystal structure of sodium/alanine symporter agcs with d-alanine bound 0.6933 4 367
7qoa-assembly2.cif.gz_B structure of codb, a cytosine transporter in an outward-facing conformation 0.6917 4 422
4doj-assembly1.cif.gz_B crystal structure of betp in outward-facing conformation 0.6706 10 367
ID Description Score Start End Superfamily
af_P0AD99_6_430_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8806 6 419 1.20.1740.10
af_Q2G1H2_6_444_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8763 6 425 1.20.1740.10
af_Q2G171_2_420_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8745 18 425 1.20.1740.10
af_Q2FYM4_4_445_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.865 10 425 1.20.1740.10
af_P0AD99_6_430_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8572 6 419 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A7X8EUQ5-F1-model_v4 Branched-chain amino acid transport system carrier protein 0.9859 1 317 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015818
GO:0015820
AF-A0A3C0WZU3-F1-model_v4 Branched-chain amino acid transport system carrier protein 0.9805 2 347 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015818
GO:0015820
AF-A0A355PR96-F1-model_v4 Branched-chain amino acid transport system carrier protein 0.9782 3 303 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015818
GO:0015820
AF-A0A7X8EUQ5-F1-model_v4 Branched-chain amino acid transport system carrier protein 0.9768 1 317 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015818
GO:0015820
AF-A0A842J0D6-F1-model_v4 Branched-chain amino acid transport system II carrier protein 0.9754 10 324 GO:0005304
GO:0005886
GO:0015188
GO:0015190
GO:0015818
GO:0015820

Feature Viewer

pLDDT pTM Quality
84.99 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map