F425173

General Info

Members Datasets Scaffolds Average Seq Length
369 209 738 212

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0062580|Ga0496102_0062580_2247_2966
Length 239
Sequence VIGRRARTSSGAGSDRVVHLVAGRCHDYPSEGLLGDVPQLADALAEQRGSRAARSLEPLELLVPLVAHLAVTPLDALQRAYVDTFDLSRKHALYLSYWTDGDTRRRGEVLGRFKAAYRASGFVVDTHGELPDYLPMVLEFAAVADPDAGRAILEEYRPSLELLRIALQERQSPWAAAAEAVCATLPGESPRDRAAVMAMAGVGGPPPVEAVGLDPYDPRLLPLRDVSSSSPPERTGALR

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
114 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
188 2643221711 Terrabacter sp. Root85 Isolate Unclassified
189 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
190 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
191 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
192 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
193 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
194 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
195 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
196 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
197 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
198 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
199 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
200 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
201 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
202 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
203 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
204 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
205 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
206 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
207 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
208 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
209 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.5
Metatranscriptomes 0.27
Isolates 6.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 13.28
Rhizosphere 81.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0062580 3300048905 Bacteria 3408
2 JGI24751J29686_10081328 3300002459 Bacteria 671
3 Ga0006562J51391_1019106 3300003578 Bacteria 8110
4 Ga0065714_10002995 3300005288 Bacteria 14950
5 Ga0070658_10049909 3300005327 Bacteria 3391
6 Ga0070676_10003874 3300005328 Bacteria 7858
7 Ga0070683_100009449 3300005329 Bacteria 8340
8 Ga0070670_100073241 3300005331 Bacteria 2942
9 Ga0070677_10007081 3300005333 Bacteria 3735
10 Ga0070666_10002686 3300005335 Bacteria 10731
11 Ga0070682_100034276 3300005337 Bacteria 3091
12 Ga0070660_100140254 3300005339 Bacteria 1939
13 Ga0070691_10135246 3300005341 Bacteria 1252
14 Ga0070692_10067229 3300005345 Bacteria 1902
15 Ga0070668_100038518 3300005347 Bacteria 3654
16 Ga0070668_100091977 3300005347 Bacteria 2392
17 Ga0070669_100006735 3300005353 Bacteria 8274
18 Ga0070675_100003512 3300005354 Bacteria 11887
19 Ga0070674_100026726 3300005356 Bacteria 3773
20 Ga0070673_100030336 3300005364 Bacteria 4044
21 Ga0070659_100407842 3300005366 Bacteria 1148
22 Ga0070667_100049824 3300005367 Bacteria 3529
23 Ga0070694_100770723 3300005444 Bacteria 787
24 Ga0070678_100003008 3300005456 Bacteria 9341
25 Ga0070678_100150307 3300005456 Bacteria 1875
26 Ga0070678_100176242 3300005456 Bacteria 1746
27 Ga0070684_100004672 3300005535 Bacteria 10459
28 Ga0070672_100314415 3300005543 Bacteria 1330
29 Ga0070665_100587977 3300005548 Bacteria 1126
30 Ga0070664_100036071 3300005564 Bacteria 4153
31 Ga0070664_100862540 3300005564 Bacteria 848
32 Ga0068857_100239925 3300005577 Bacteria 1659
33 Ga0068856_100525825 3300005614 Bacteria 1204
34 Ga0070702_100145837 3300005615 Bacteria 1513
35 Ga0068864_100558552 3300005618 Bacteria 1107
36 Ga0068864_100901907 3300005618 Bacteria 873
37 Ga0068861_100025364 3300005719 Bacteria 4299
38 Ga0068870_10049875 3300005840 Bacteria 2210
39 Ga0068858_100104257 3300005842 Bacteria 2646
40 Ga0068860_100027566 3300005843 Bacteria 5470
41 Ga0081455_10001405 3300005937 Bacteria 29762
42 Ga0081455_10012183 3300005937 Bacteria 8588
43 Ga0081455_10178291 3300005937 Bacteria 1611
44 Ga0081538_10000121 3300005981 Bacteria 78856
45 Ga0075369_10069867 3300006186 Bacteria 1545
46 Ga0068871_100229984 3300006358 Bacteria 1609
47 Ga0105251_10006813 3300009011 Bacteria 7193
48 Ga0111539_10557240 3300009094 Bacteria 1335
49 Ga0111539_11079433 3300009094 Bacteria 933
50 Ga0105245_10002262 3300009098 Bacteria 17436
51 Ga0105245_10364591 3300009098 Bacteria 1435
52 Ga0105243_10025147 3300009148 Bacteria 4547
53 Ga0105242_10122769 3300009176 Bacteria 2232
54 Ga0105242_10164689 3300009176 Bacteria 1944
55 Ga0105237_10468692 3300009545 Bacteria 1265
56 Ga0105238_10481020 3300009551 Bacteria 1241
57 Ga0105249_10050847 3300009553 Bacteria 3778
58 Ga0105249_10334548 3300009553 Bacteria 1529
59 Ga0105239_10001318 3300010375 Bacteria 33415
60 Ga0105246_10000827 3300011119 Bacteria 17608
61 Ga0105246_10036032 3300011119 Bacteria 3311
62 Ga0105246_10159639 3300011119 Bacteria 1716
63 Ga0105246_10197980 3300011119 Bacteria 1560
64 Ga0105246_10206554 3300011119 Bacteria 1530
65 Ga0105246_10296662 3300011119 Bacteria 1303
66 Ga0157326_1008557 3300012513 Bacteria 1117
67 Ga0157373_10003357 3300013100 Bacteria 12097
68 Ga0157371_10052641 3300013102 Bacteria 2891
69 Ga0157370_10018032 3300013104 Bacteria 7105
70 Ga0157369_10014543 3300013105 Bacteria 8879
71 Ga0157369_10070384 3300013105 Bacteria 3758
72 Ga0171462_1004 3300013250 Bacteria 678877
73 Ga0163162_10028167 3300013306 Bacteria 5556
74 Ga0157372_10013196 3300013307 Bacteria 8815
75 Ga0157372_10538075 3300013307 Bacteria 1362
76 Ga0157375_10984214 3300013308 Bacteria 984
77 Ga0157375_11249007 3300013308 Bacteria 872
78 Ga0163163_10165609 3300014325 Bacteria 2256
79 Ga0163163_10571228 3300014325 Bacteria 1194
80 Ga0163163_10672716 3300014325 Bacteria 1099
81 Ga0157380_10015072 3300014326 Bacteria 5672
82 Ga0157380_10744761 3300014326 Bacteria 990
83 Ga0157377_10187965 3300014745 Bacteria 1303
84 Ga0157379_10010469 3300014968 Bacteria 8084
85 Ga0207697_10001155 3300025315 Bacteria 14508
86 Ga0207655_1012131 3300025728 Bacteria 5065
87 Ga0207713_1040850 3300025735 Bacteria 1942
88 Ga0207682_10001933 3300025893 Bacteria 9415
89 Ga0207688_10023891 3300025901 Bacteria 3351
90 Ga0207688_10031227 3300025901 Bacteria 2940
91 Ga0207688_10069257 3300025901 Bacteria 1999
92 Ga0207647_10046248 3300025904 Bacteria 2712
93 Ga0207645_10006464 3300025907 Bacteria 8408
94 Ga0207643_10128429 3300025908 Bacteria 1506
95 Ga0207705_10246223 3300025909 Bacteria 1362
96 Ga0207671_10430880 3300025914 Bacteria 1049
97 Ga0207657_10174416 3300025919 Bacteria 1741
98 Ga0207681_10044831 3300025923 Bacteria 2965
99 Ga0207694_10276624 3300025924 Bacteria 1378
100 Ga0207650_10015817 3300025925 Bacteria 5260
101 Ga0207687_10020074 3300025927 Bacteria 4431
102 Ga0207687_10105557 3300025927 Bacteria 2082
103 Ga0207690_10004881 3300025932 Bacteria 7910
104 Ga0207686_10188197 3300025934 Bacteria 1469
105 Ga0207686_10376502 3300025934 Bacteria 1075
106 Ga0207709_10031875 3300025935 Bacteria 3083
107 Ga0207669_10110068 3300025937 Bacteria 1844
108 Ga0207669_10546810 3300025937 Bacteria 934
109 Ga0207669_10735461 3300025937 Bacteria 813
110 Ga0207691_10000237 3300025940 Bacteria 53889
111 Ga0207691_10073080 3300025940 Bacteria 3093
112 Ga0207691_10117277 3300025940 Bacteria 2362
113 Ga0207661_10108126 3300025944 Bacteria 2347
114 Ga0207651_10093077 3300025960 Bacteria 2212
115 Ga0207712_10174258 3300025961 Bacteria 1684
116 Ga0207668_10153982 3300025972 Bacteria 1783
117 Ga0207702_10820307 3300026078 Bacteria 920
118 Ga0207676_10010430 3300026095 Bacteria 6616
119 Ga0207676_10157688 3300026095 Bacteria 1963
120 Ga0207674_10021769 3300026116 Bacteria 6899
121 Ga0207675_100053684 3300026118 Bacteria 3760
122 Ga0207683_10001134 3300026121 Bacteria 24222
123 Ga0207683_10006261 3300026121 Bacteria 10197
124 Ga0207683_10208534 3300026121 Bacteria 1778
125 Ga0207698_11374230 3300026142 Bacteria 721
126 Ga0207428_10107415 3300027907 Bacteria 2150
127 Ga0268266_10146196 3300028379 Bacteria 2126
128 Ga0268264_10018494 3300028381 Bacteria 5699
129 Ga0307408_100007514 3300031548 Bacteria 7205
130 Ga0307408_100010637 3300031548 Bacteria 6070
131 Ga0307408_100013428 3300031548 Bacteria 5435
132 Ga0307408_100137488 3300031548 Bacteria 1913
133 Ga0307408_100368096 3300031548 Bacteria 1225
134 Ga0307405_10001158 3300031731 Bacteria 10849
135 Ga0307405_10184654 3300031731 Bacteria 1500
136 Ga0307405_10232911 3300031731 Bacteria 1359
137 Ga0307405_10316197 3300031731 Bacteria 1191
138 Ga0307405_10340838 3300031731 Bacteria 1152
139 Ga0307413_10002422 3300031824 Bacteria 7580
140 Ga0307413_10005051 3300031824 Bacteria 5831
141 Ga0307413_10011832 3300031824 Bacteria 4311
142 Ga0307413_10047517 3300031824 Bacteria 2560
143 Ga0307413_10126672 3300031824 Bacteria 1740
144 Ga0307410_10000549 3300031852 Bacteria 15431
145 Ga0307410_10036149 3300031852 Bacteria 3214
146 Ga0307410_10074909 3300031852 Bacteria 2358
147 Ga0307410_10092654 3300031852 Bacteria 2148
148 Ga0307410_10141819 3300031852 Bacteria 1778
149 Ga0307410_10493201 3300031852 Bacteria 1007
150 Ga0307406_10000068 3300031901 Bacteria 57569
151 Ga0307406_10006749 3300031901 Bacteria 6349
152 Ga0307406_10015235 3300031901 Bacteria 4444
153 Ga0307406_10339139 3300031901 Bacteria 1170
154 Ga0307406_10590344 3300031901 Bacteria 914
155 Ga0307407_10003621 3300031903 Bacteria 6388
156 Ga0307407_10007350 3300031903 Bacteria 4983
157 Ga0307407_10010148 3300031903 Bacteria 4426
158 Ga0307407_10011285 3300031903 Bacteria 4247
159 Ga0307412_10006147 3300031911 Bacteria 6768
160 Ga0307412_10152459 3300031911 Bacteria 1707
161 Ga0307412_10239474 3300031911 Bacteria 1402
162 Ga0307409_100000475 3300031995 Bacteria 17148
163 Ga0307409_100022973 3300031995 Bacteria 4310
164 Ga0307409_100047132 3300031995 Bacteria 3269
165 Ga0307409_100156651 3300031995 Bacteria 1986
166 Ga0307409_100243899 3300031995 Bacteria 1637
167 Ga0307416_100000212 3300032002 Bacteria 30433
168 Ga0307416_100036430 3300032002 Bacteria 3773
169 Ga0307416_100063755 3300032002 Bacteria 3019
170 Ga0307416_100195565 3300032002 Bacteria 1912
171 Ga0307416_101052805 3300032002 Bacteria 917
172 Ga0307416_101580476 3300032002 Bacteria 761
173 Ga0307414_10000982 3300032004 Bacteria 14543
174 Ga0307414_10089446 3300032004 Bacteria 2282
175 Ga0307414_10151831 3300032004 Bacteria 1828
176 Ga0307414_10448962 3300032004 Bacteria 1130
177 Ga0307411_10004079 3300032005 Bacteria 6921
178 Ga0307411_10012655 3300032005 Bacteria 4616
179 Ga0307411_10106195 3300032005 Bacteria 1998
180 Ga0307411_10410288 3300032005 Bacteria 1122
181 Ga0307411_10444306 3300032005 Bacteria 1083
182 Ga0307415_100005294 3300032126 Bacteria 6833
183 Ga0307415_100027504 3300032126 Bacteria 3604
184 Ga0307415_100063081 3300032126 Bacteria 2573
185 Ga0307415_100098746 3300032126 Bacteria 2135
186 Ga0316574_0074370 3300035398 Bacteria 2150
187 Ga0395900_0863141 3300037418 Bacteria 830
188 Ga0395898_0136759 3300037466 Bacteria 2346
189 Ga0451837_1847479 3300041494 Bacteria 1570
190 Ga0451853_0099403 3300041512 Bacteria 699
191 Ga0451853_3441559 3300041512 Bacteria 7559
192 Ga0439463_001848 3300042016 Bacteria 5494
193 Ga0439463_029439 3300042016 Bacteria 1383
194 Ga0439459_0069637 3300042438 Bacteria 811
195 Ga0439464_0023601 3300042439 Bacteria 1698
196 Ga0439460_0065849 3300042461 Bacteria 1114
197 Ga0439440_0000314 3300042993 Bacteria 7898
198 Ga0439440_0016304 3300042993 Bacteria 1624
199 Ga0439440_0065398 3300042993 Bacteria 936
200 Ga0495653_0196172 3300046463 Bacteria 1374
201 Ga0495580_0010950 3300046472 Bacteria 7036
202 Ga0495582_0145761 3300046473 Bacteria 1343
203 Ga0495639_0002917 3300046475 Bacteria 7451
204 Ga0495639_0230319 3300046475 Bacteria 913
205 Ga0495662_0343361 3300046476 Bacteria 734
206 Ga0495643_0057002 3300046522 Bacteria 2083
207 Ga0495642_0209928 3300046528 Bacteria 849
208 Ga0495665_0005931 3300046531 Bacteria 6582
209 Ga0495633_0209230 3300046558 Bacteria 894
210 Ga0495588_0003123 3300046674 Bacteria 7167
211 Ga0495588_0005945 3300046674 Bacteria 5470
212 Ga0495670_0205479 3300046691 Bacteria 1044
213 Ga0495581_0027437 3300047315 Bacteria 3302
214 Ga0495676_0325635 3300047321 Bacteria 1032
215 Ga0495680_0400148 3300047322 Bacteria 948
216 Ga0496100_0037985 3300048903 Bacteria 3048
217 Ga0496100_0381444 3300048903 Bacteria 1070
218 Ga0496101_0013646 3300048904 Bacteria 5449
219 Ga0496101_0014300 3300048904 Bacteria 5330
220 Ga0496101_0114256 3300048904 Bacteria 2035
221 Ga0496102_0017577 3300048905 Bacteria 6265
222 Ga0496102_0021949 3300048905 Bacteria 5653
223 Ga0496102_0113422 3300048905 Bacteria 2528
224 Ga0496102_1057991 3300048905 Bacteria 731
225 Ga0496103_0009882 3300048906 Bacteria 5645
226 Ga0496104_0001045 3300048907 Bacteria 23660
227 Ga0496104_0032581 3300048907 Bacteria 4851
228 Ga0496104_0083955 3300048907 Bacteria 3038
229 Ga0496104_0120154 3300048907 Bacteria 2523
230 Ga0496104_0154910 3300048907 Bacteria 2199
231 Ga0496105_0005870 3300048908 Bacteria 9361
232 Ga0496105_0040432 3300048908 Bacteria 3845
233 Ga0496105_0117004 3300048908 Bacteria 2198
234 Ga0496106_0056209 3300048909 Bacteria 2975
235 Ga0496106_0580921 3300048909 Bacteria 898
236 Ga0496107_0144845 3300048910 Bacteria 1756
237 Ga0496107_0205759 3300048910 Bacteria 1463
238 Ga0496108_0023810 3300048911 Bacteria 5039
239 Ga0496108_0063880 3300048911 Bacteria 3100
240 Ga0496108_0131163 3300048911 Bacteria 2154
241 Ga0496109_0010297 3300048912 Bacteria 7985
242 Ga0496109_0579769 3300048912 Bacteria 1057
243 Ga0496110_0026695 3300048913 Bacteria 4945
244 Ga0496110_0112107 3300048913 Bacteria 2452
245 Ga0496110_0249634 3300048913 Bacteria 1615
246 Ga0496110_0369166 3300048913 Bacteria 1307
247 Ga0496110_0510387 3300048913 Bacteria 1094
248 Ga0496110_0744512 3300048913 Bacteria 883
249 Ga0496111_0004274 3300048914 Bacteria 8999
250 Ga0496111_0038012 3300048914 Bacteria 3447
251 Ga0496111_0043511 3300048914 Bacteria 3227
252 Ga0496111_0065276 3300048914 Bacteria 2642
253 Ga0496111_0257277 3300048914 Bacteria 1295
254 Ga0496112_0190046 3300048915 Bacteria 2016
255 Ga0496112_0209361 3300048915 Bacteria 1908
256 Ga0496113_0100141 3300048916 Bacteria 2245
257 Ga0496113_0516610 3300048916 Bacteria 959
258 Ga0496114_0007756 3300048917 Bacteria 8492
259 Ga0496114_0043992 3300048917 Bacteria 3703
260 Ga0496114_0066197 3300048917 Bacteria 3029
261 Ga0496114_0111092 3300048917 Bacteria 2348
262 Ga0496114_0124633 3300048917 Bacteria 2219
263 Ga0496114_0148257 3300048917 Bacteria 2035
264 Ga0496124_0062013 3300048927 Bacteria 3131
265 Ga0496125_0266995 3300048928 Bacteria 1069
266 Ga0496126_0331066 3300048929 Bacteria 1250
267 Ga0501298_041680 3300049521 Bacteria 932
268 Ga0501031_0000082 3300049568 Bacteria 50347
269 Ga0501031_0145155 3300049568 Bacteria 1550
270 Ga0501032_0000035 3300049569 Bacteria 117554
271 Ga0501032_0025297 3300049569 Bacteria 4093
272 Ga0501032_0049603 3300049569 Bacteria 2832
273 Ga0501033_0001072 3300049570 Bacteria 24844
274 Ga0501033_0061245 3300049570 Bacteria 2774
275 Ga0501034_0000190 3300049571 Bacteria 115701
276 Ga0501034_0000925 3300049571 Bacteria 42868
277 Ga0501034_0016699 3300049571 Bacteria 7526
278 Ga0501034_0264638 3300049571 Bacteria 1662
279 Ga0501034_0509663 3300049571 Bacteria 1116
280 Ga0501036_0057956 3300049572 Bacteria 3281
281 Ga0501036_0073873 3300049572 Bacteria 2883
282 Ga0501036_0441850 3300049572 Bacteria 1084
283 Ga0501037_0000370 3300049573 Bacteria 37472
284 Ga0501038_0000172 3300049574 Bacteria 55198
285 Ga0501038_0002149 3300049574 Bacteria 18305
286 Ga0501038_0048134 3300049574 Bacteria 3691
287 Ga0501038_0377099 3300049574 Bacteria 1101
288 Ga0501038_0698859 3300049574 Bacteria 760
289 Ga0501039_0000269 3300049575 Bacteria 37904
290 Ga0501039_0026637 3300049575 Bacteria 4442
291 Ga0501039_0067844 3300049575 Bacteria 2770
292 Ga0501039_0096267 3300049575 Bacteria 2308
293 Ga0501039_0571427 3300049575 Bacteria 887
294 Ga0501040_0004011 3300049576 Bacteria 9566
295 Ga0501040_0060854 3300049576 Bacteria 2596
296 Ga0501040_0502223 3300049576 Bacteria 874
297 Ga0501041_0007529 3300049577 Bacteria 6392
298 Ga0501042_0020032 3300049578 Bacteria 4653
299 Ga0501042_0031200 3300049578 Bacteria 3770
300 Ga0501043_0000231 3300049579 Bacteria 50898
301 Ga0501043_0078045 3300049579 Bacteria 2602
302 Ga0501043_0274653 3300049579 Bacteria 1293
303 Ga0501046_0000279 3300049580 Bacteria 51800
304 Ga0501046_0045946 3300049580 Bacteria 3467
305 Ga0501047_0000458 3300049581 Bacteria 45091
306 Ga0501048_0000048 3300049582 Bacteria 59433
307 Ga0501048_0032520 3300049582 Bacteria 3769
308 Ga0501048_0119997 3300049582 Bacteria 1858
309 Ga0501067_0013822 3300049583 Bacteria 4470
310 Ga0501068_0039061 3300049584 Bacteria 2845
311 Ga0501068_0045263 3300049584 Bacteria 2651
312 Ga0501069_0000741 3300049585 Bacteria 15231
313 Ga0501070_0000504 3300049586 Bacteria 35626
314 Ga0501070_0162732 3300049586 Bacteria 1839
315 Ga0501070_0295399 3300049586 Bacteria 1320
316 Ga0501071_0013790 3300049587 Bacteria 5515
317 Ga0501071_0063357 3300049587 Bacteria 2681
318 Ga0501071_0118513 3300049587 Bacteria 1961
319 Ga0501071_0282552 3300049587 Bacteria 1256
320 Ga0501072_0038631 3300049588 Bacteria 3746
321 Ga0501072_0296541 3300049588 Bacteria 1285
322 Ga0501073_0001049 3300049589 Bacteria 19926
323 Ga0501074_0000061 3300049590 Bacteria 53799
324 Ga0501074_0077377 3300049590 Bacteria 2387
325 Ga0501075_0026064 3300049591 Bacteria 4299
326 Ga0501076_0004327 3300049592 Bacteria 10074
327 Ga0501076_0129824 3300049592 Bacteria 2043
328 Ga0501077_0051419 3300049593 Bacteria 2618
329 Ga0501079_0007986 3300049741 Bacteria 8020
330 Ga0501080_0000160 3300049742 Bacteria 48505
331 Ga0501080_0097799 3300049742 Bacteria 2725
332 Ga0501083_0004099 3300049744 Bacteria 10258
333 Ga0501083_0009646 3300049744 Bacteria 6820
334 Ga0501083_0043626 3300049744 Bacteria 3038
335 Ga0501270_018483 3300049767 Bacteria 1033
336 Ga0501035_0000404 3300049822 Bacteria 49157
337 Ga0501035_0027080 3300049822 Bacteria 5241
338 Ga0501035_0047877 3300049822 Bacteria 3836
339 Ga0501044_0000439 3300049823 Bacteria 50915
340 Ga0501044_0355848 3300049823 Bacteria 1383
341 Ga0501045_0046786 3300049824 Bacteria 3150
342 Ga0501212_030161 3300049851 Bacteria 872
343 nmdc:mga08y16_507031_c1 3300050511 Bacteria 1225
344 Ga0495655_0246121 3300053083 Bacteria 600
345 Ga0501084_0002451 3300054114 Bacteria 14931
346 Ga0501084_0009697 3300054114 Bacteria 7964
347 2537897718 2537561592 Bacteria 4348607
348 2644609353 2643221711 Bacteria 4865335
349 2691515514 2690315906 Bacteria 4517044
350 2753037591 2751185725 Bacteria 5740550
351 2753325459 2751185792 Bacteria 5739090
352 2775654770 2775506735 Bacteria 4556596
353 2808828004 2808606357 Bacteria 4466944
354 2808853360 2808606360 Bacteria 4404006
355 2808878144 2808606366 Bacteria 4415912
356 2808890996 2808606370 Bacteria 4942454
357 2808897348 2808606371 Bacteria 4251511
358 2812320236 2811994871 Bacteria 4497550
359 2819428767 2818991318 Bacteria 5266538
360 2819666188 2818991458 Bacteria 4794049
361 2819693037 2818991462 Bacteria 4320267
362 2819730329 2818991469 Bacteria 4644110
363 2837269631 2837268691 Bacteria 7850704
364 2883826441 2883821847 Bacteria 5121194
365 2884994219 2884994152 Bacteria 4492978
366 2902801064 2902799365 Bacteria 5419524
367 2939601984 2939598168 Bacteria 4687164
368 8004023558 8004021418 Bacteria 4313954
369 8004028381 8004025490 Bacteria 4327753
370 Ga0496102_0062580
371 JGI24751J29686_10081328
372 Ga0006562J51391_1019106
373 Ga0065714_10002995
374 Ga0070658_10049909
375 Ga0070676_10003874
376 Ga0070683_100009449
377 Ga0070670_100073241
378 Ga0070677_10007081
379 Ga0070666_10002686
380 Ga0070682_100034276
381 Ga0070660_100140254
382 Ga0070691_10135246
383 Ga0070692_10067229
384 Ga0070668_100038518
385 Ga0070668_100091977
386 Ga0070669_100006735
387 Ga0070675_100003512
388 Ga0070674_100026726
389 Ga0070673_100030336
390 Ga0070659_100407842
391 Ga0070667_100049824
392 Ga0070694_100770723
393 Ga0070678_100003008
394 Ga0070678_100150307
395 Ga0070678_100176242
396 Ga0070684_100004672
397 Ga0070672_100314415
398 Ga0070665_100587977
399 Ga0070664_100036071
400 Ga0070664_100862540
401 Ga0068857_100239925
402 Ga0068856_100525825
403 Ga0070702_100145837
404 Ga0068864_100558552
405 Ga0068864_100901907
406 Ga0068861_100025364
407 Ga0068870_10049875
408 Ga0068858_100104257
409 Ga0068860_100027566
410 Ga0081455_10001405
411 Ga0081455_10012183
412 Ga0081455_10178291
413 Ga0081538_10000121
414 Ga0075369_10069867
415 Ga0068871_100229984
416 Ga0105251_10006813
417 Ga0111539_10557240
418 Ga0111539_11079433
419 Ga0105245_10002262
420 Ga0105245_10364591
421 Ga0105243_10025147
422 Ga0105242_10122769
423 Ga0105242_10164689
424 Ga0105237_10468692
425 Ga0105238_10481020
426 Ga0105249_10050847
427 Ga0105249_10334548
428 Ga0105239_10001318
429 Ga0105246_10000827
430 Ga0105246_10036032
431 Ga0105246_10159639
432 Ga0105246_10197980
433 Ga0105246_10206554
434 Ga0105246_10296662
435 Ga0157326_1008557
436 Ga0157373_10003357
437 Ga0157371_10052641
438 Ga0157370_10018032
439 Ga0157369_10014543
440 Ga0157369_10070384
441 Ga0171462_1004
442 Ga0163162_10028167
443 Ga0157372_10013196
444 Ga0157372_10538075
445 Ga0157375_10984214
446 Ga0157375_11249007
447 Ga0163163_10165609
448 Ga0163163_10571228
449 Ga0163163_10672716
450 Ga0157380_10015072
451 Ga0157380_10744761
452 Ga0157377_10187965
453 Ga0157379_10010469
454 Ga0207697_10001155
455 Ga0207655_1012131
456 Ga0207713_1040850
457 Ga0207682_10001933
458 Ga0207688_10023891
459 Ga0207688_10031227
460 Ga0207688_10069257
461 Ga0207647_10046248
462 Ga0207645_10006464
463 Ga0207643_10128429
464 Ga0207705_10246223
465 Ga0207671_10430880
466 Ga0207657_10174416
467 Ga0207681_10044831
468 Ga0207694_10276624
469 Ga0207650_10015817
470 Ga0207687_10020074
471 Ga0207687_10105557
472 Ga0207690_10004881
473 Ga0207686_10188197
474 Ga0207686_10376502
475 Ga0207709_10031875
476 Ga0207669_10110068
477 Ga0207669_10546810
478 Ga0207669_10735461
479 Ga0207691_10000237
480 Ga0207691_10073080
481 Ga0207691_10117277
482 Ga0207661_10108126
483 Ga0207651_10093077
484 Ga0207712_10174258
485 Ga0207668_10153982
486 Ga0207702_10820307
487 Ga0207676_10010430
488 Ga0207676_10157688
489 Ga0207674_10021769
490 Ga0207675_100053684
491 Ga0207683_10001134
492 Ga0207683_10006261
493 Ga0207683_10208534
494 Ga0207698_11374230
495 Ga0207428_10107415
496 Ga0268266_10146196
497 Ga0268264_10018494
498 Ga0307408_100007514
499 Ga0307408_100010637
500 Ga0307408_100013428
501 Ga0307408_100137488
502 Ga0307408_100368096
503 Ga0307405_10001158
504 Ga0307405_10184654
505 Ga0307405_10232911
506 Ga0307405_10316197
507 Ga0307405_10340838
508 Ga0307413_10002422
509 Ga0307413_10005051
510 Ga0307413_10011832
511 Ga0307413_10047517
512 Ga0307413_10126672
513 Ga0307410_10000549
514 Ga0307410_10036149
515 Ga0307410_10074909
516 Ga0307410_10092654
517 Ga0307410_10141819
518 Ga0307410_10493201
519 Ga0307406_10000068
520 Ga0307406_10006749
521 Ga0307406_10015235
522 Ga0307406_10339139
523 Ga0307406_10590344
524 Ga0307407_10003621
525 Ga0307407_10007350
526 Ga0307407_10010148
527 Ga0307407_10011285
528 Ga0307412_10006147
529 Ga0307412_10152459
530 Ga0307412_10239474
531 Ga0307409_100000475
532 Ga0307409_100022973
533 Ga0307409_100047132
534 Ga0307409_100156651
535 Ga0307409_100243899
536 Ga0307416_100000212
537 Ga0307416_100036430
538 Ga0307416_100063755
539 Ga0307416_100195565
540 Ga0307416_101052805
541 Ga0307416_101580476
542 Ga0307414_10000982
543 Ga0307414_10089446
544 Ga0307414_10151831
545 Ga0307414_10448962
546 Ga0307411_10004079
547 Ga0307411_10012655
548 Ga0307411_10106195
549 Ga0307411_10410288
550 Ga0307411_10444306
551 Ga0307415_100005294
552 Ga0307415_100027504
553 Ga0307415_100063081
554 Ga0307415_100098746
555 Ga0316574_0074370
556 Ga0395900_0863141
557 Ga0395898_0136759
558 Ga0451837_1847479
559 Ga0451853_0099403
560 Ga0451853_3441559
561 Ga0439463_001848
562 Ga0439463_029439
563 Ga0439459_0069637
564 Ga0439464_0023601
565 Ga0439460_0065849
566 Ga0439440_0000314
567 Ga0439440_0016304
568 Ga0439440_0065398
569 Ga0495653_0196172
570 Ga0495580_0010950
571 Ga0495582_0145761
572 Ga0495639_0002917
573 Ga0495639_0230319
574 Ga0495662_0343361
575 Ga0495643_0057002
576 Ga0495642_0209928
577 Ga0495665_0005931
578 Ga0495633_0209230
579 Ga0495588_0003123
580 Ga0495588_0005945
581 Ga0495670_0205479
582 Ga0495581_0027437
583 Ga0495676_0325635
584 Ga0495680_0400148
585 Ga0496100_0037985
586 Ga0496100_0381444
587 Ga0496101_0013646
588 Ga0496101_0014300
589 Ga0496101_0114256
590 Ga0496102_0017577
591 Ga0496102_0021949
592 Ga0496102_0113422
593 Ga0496102_1057991
594 Ga0496103_0009882
595 Ga0496104_0001045
596 Ga0496104_0032581
597 Ga0496104_0083955
598 Ga0496104_0120154
599 Ga0496104_0154910
600 Ga0496105_0005870
601 Ga0496105_0040432
602 Ga0496105_0117004
603 Ga0496106_0056209
604 Ga0496106_0580921
605 Ga0496107_0144845
606 Ga0496107_0205759
607 Ga0496108_0023810
608 Ga0496108_0063880
609 Ga0496108_0131163
610 Ga0496109_0010297
611 Ga0496109_0579769
612 Ga0496110_0026695
613 Ga0496110_0112107
614 Ga0496110_0249634
615 Ga0496110_0369166
616 Ga0496110_0510387
617 Ga0496110_0744512
618 Ga0496111_0004274
619 Ga0496111_0038012
620 Ga0496111_0043511
621 Ga0496111_0065276
622 Ga0496111_0257277
623 Ga0496112_0190046
624 Ga0496112_0209361
625 Ga0496113_0100141
626 Ga0496113_0516610
627 Ga0496114_0007756
628 Ga0496114_0043992
629 Ga0496114_0066197
630 Ga0496114_0111092
631 Ga0496114_0124633
632 Ga0496114_0148257
633 Ga0496124_0062013
634 Ga0496125_0266995
635 Ga0496126_0331066
636 Ga0501298_041680
637 Ga0501031_0000082
638 Ga0501031_0145155
639 Ga0501032_0000035
640 Ga0501032_0025297
641 Ga0501032_0049603
642 Ga0501033_0001072
643 Ga0501033_0061245
644 Ga0501034_0000190
645 Ga0501034_0000925
646 Ga0501034_0016699
647 Ga0501034_0264638
648 Ga0501034_0509663
649 Ga0501036_0057956
650 Ga0501036_0073873
651 Ga0501036_0441850
652 Ga0501037_0000370
653 Ga0501038_0000172
654 Ga0501038_0002149
655 Ga0501038_0048134
656 Ga0501038_0377099
657 Ga0501038_0698859
658 Ga0501039_0000269
659 Ga0501039_0026637
660 Ga0501039_0067844
661 Ga0501039_0096267
662 Ga0501039_0571427
663 Ga0501040_0004011
664 Ga0501040_0060854
665 Ga0501040_0502223
666 Ga0501041_0007529
667 Ga0501042_0020032
668 Ga0501042_0031200
669 Ga0501043_0000231
670 Ga0501043_0078045
671 Ga0501043_0274653
672 Ga0501046_0000279
673 Ga0501046_0045946
674 Ga0501047_0000458
675 Ga0501048_0000048
676 Ga0501048_0032520
677 Ga0501048_0119997
678 Ga0501067_0013822
679 Ga0501068_0039061
680 Ga0501068_0045263
681 Ga0501069_0000741
682 Ga0501070_0000504
683 Ga0501070_0162732
684 Ga0501070_0295399
685 Ga0501071_0013790
686 Ga0501071_0063357
687 Ga0501071_0118513
688 Ga0501071_0282552
689 Ga0501072_0038631
690 Ga0501072_0296541
691 Ga0501073_0001049
692 Ga0501074_0000061
693 Ga0501074_0077377
694 Ga0501075_0026064
695 Ga0501076_0004327
696 Ga0501076_0129824
697 Ga0501077_0051419
698 Ga0501079_0007986
699 Ga0501080_0000160
700 Ga0501080_0097799
701 Ga0501083_0004099
702 Ga0501083_0009646
703 Ga0501083_0043626
704 Ga0501270_018483
705 Ga0501035_0000404
706 Ga0501035_0027080
707 Ga0501035_0047877
708 Ga0501044_0000439
709 Ga0501044_0355848
710 Ga0501045_0046786
711 Ga0501212_030161
712 nmdc:mga08y16_507031_c1
713 Ga0495655_0246121
714 Ga0501084_0002451
715 Ga0501084_0009697
716 2537897718
717 2644609353
718 2691515514
719 2753037591
720 2753325459
721 2775654770
722 2808828004
723 2808853360
724 2808878144
725 2808890996
726 2808897348
727 2812320236
728 2819428767
729 2819666188
730 2819693037
731 2819730329
732 2837269631
733 2883826441
734 2884994219
735 2902801064
736 2939601984
737 8004023558
738 8004028381

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02613

Nitrate_red_del

Nitrate reductase delta subunit

36

179

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o9x-assembly1.cif.gz_A crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus 0.7493 1 166
2o9x-assembly1.cif.gz_A crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus 0.7098 1 166
1s9u-assembly1.cif.gz_A atomic structure of a putative anaerobic dehydrogenase component 0.6561 5 166
1s9u-assembly1.cif.gz_A atomic structure of a putative anaerobic dehydrogenase component 0.5464 5 166
1n1c-assembly1.cif.gz_A crystal structure of the dimeric tord chaperone from shewanella massilia 0.3269 20 184
ID Description Score Start End Superfamily
af_O06561_3_176_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.8917 11 182 1.10.3480.10
af_P9WJQ1_274_409_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.8914 25 161 1.10.3480.10
af_O06561_3_176_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.8774 11 182 1.10.3480.10
af_P9WJQ1_274_409_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.8732 25 161 1.10.3480.10
af_P0AF26_5_149_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.8682 11 150 1.10.3480.10
ID Description Score Start End GO Terms
AF-A0A3N4SVW4-F1-model_v4 deleted 0.9359 1 169
AF-A0A1H0QB96-F1-model_v4 Respiratory nitrate reductase chaperone NarJ 0.9244 1 206 GO:0016530
GO:0042128
GO:0051082
GO:0051131
AF-A0A542IPS0-F1-model_v4 Respiratory nitrate reductase chaperone NarJ 0.9243 1 206 GO:0016530
GO:0042128
GO:0051082
GO:0051131
AF-A0A7X6NUS1-F1-model_v4 Nitrate reductase molybdenum cofactor assembly chaperone 0.9236 1 196 GO:0016530
GO:0042128
GO:0051082
GO:0051131
AF-A0A655A1B6-F1-model_v4 Nitrate reductase NarX (EC 1.7.99.4) 0.9231 4 166 GO:0005886
GO:0008940
GO:0009055
GO:0009325
GO:0019645
GO:0020037
GO:0042128
GO:0046872
GO:0051082
GO:0051131

Map