F425173
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 369 | 209 | 738 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0062580|Ga0496102_0062580_2247_2966 |
| Length | 239 |
| Sequence | VIGRRARTSSGAGSDRVVHLVAGRCHDYPSEGLLGDVPQLADALAEQRGSRAARSLEPLELLVPLVAHLAVTPLDALQRAYVDTFDLSRKHALYLSYWTDGDTRRRGEVLGRFKAAYRASGFVVDTHGELPDYLPMVLEFAAVADPDAGRAILEEYRPSLELLRIALQERQSPWAAAAEAVCATLPGESPRDRAAVMAMAGVGGPPPVEAVGLDPYDPRLLPLRDVSSSSPPERTGALR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 99 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 100 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 101 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 108 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 112 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 113 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 114 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 115 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 116 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 117 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 118 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 137 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 138 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 139 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 142 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 143 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 144 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 145 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 146 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 147 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 148 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 149 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 150 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 184 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 188 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 189 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 190 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 191 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 192 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 193 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 194 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 195 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 196 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 197 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 198 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 199 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 200 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 201 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 202 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 203 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 204 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 205 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 206 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 207 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 208 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 209 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.5 |
| Metatranscriptomes | 0.27 |
| Isolates | 6.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0 |
| Rhizoplane | 13.28 |
| Rhizosphere | 81.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0062580 | 3300048905 | Bacteria | 3408 |
| 2 | JGI24751J29686_10081328 | 3300002459 | Bacteria | 671 |
| 3 | Ga0006562J51391_1019106 | 3300003578 | Bacteria | 8110 |
| 4 | Ga0065714_10002995 | 3300005288 | Bacteria | 14950 |
| 5 | Ga0070658_10049909 | 3300005327 | Bacteria | 3391 |
| 6 | Ga0070676_10003874 | 3300005328 | Bacteria | 7858 |
| 7 | Ga0070683_100009449 | 3300005329 | Bacteria | 8340 |
| 8 | Ga0070670_100073241 | 3300005331 | Bacteria | 2942 |
| 9 | Ga0070677_10007081 | 3300005333 | Bacteria | 3735 |
| 10 | Ga0070666_10002686 | 3300005335 | Bacteria | 10731 |
| 11 | Ga0070682_100034276 | 3300005337 | Bacteria | 3091 |
| 12 | Ga0070660_100140254 | 3300005339 | Bacteria | 1939 |
| 13 | Ga0070691_10135246 | 3300005341 | Bacteria | 1252 |
| 14 | Ga0070692_10067229 | 3300005345 | Bacteria | 1902 |
| 15 | Ga0070668_100038518 | 3300005347 | Bacteria | 3654 |
| 16 | Ga0070668_100091977 | 3300005347 | Bacteria | 2392 |
| 17 | Ga0070669_100006735 | 3300005353 | Bacteria | 8274 |
| 18 | Ga0070675_100003512 | 3300005354 | Bacteria | 11887 |
| 19 | Ga0070674_100026726 | 3300005356 | Bacteria | 3773 |
| 20 | Ga0070673_100030336 | 3300005364 | Bacteria | 4044 |
| 21 | Ga0070659_100407842 | 3300005366 | Bacteria | 1148 |
| 22 | Ga0070667_100049824 | 3300005367 | Bacteria | 3529 |
| 23 | Ga0070694_100770723 | 3300005444 | Bacteria | 787 |
| 24 | Ga0070678_100003008 | 3300005456 | Bacteria | 9341 |
| 25 | Ga0070678_100150307 | 3300005456 | Bacteria | 1875 |
| 26 | Ga0070678_100176242 | 3300005456 | Bacteria | 1746 |
| 27 | Ga0070684_100004672 | 3300005535 | Bacteria | 10459 |
| 28 | Ga0070672_100314415 | 3300005543 | Bacteria | 1330 |
| 29 | Ga0070665_100587977 | 3300005548 | Bacteria | 1126 |
| 30 | Ga0070664_100036071 | 3300005564 | Bacteria | 4153 |
| 31 | Ga0070664_100862540 | 3300005564 | Bacteria | 848 |
| 32 | Ga0068857_100239925 | 3300005577 | Bacteria | 1659 |
| 33 | Ga0068856_100525825 | 3300005614 | Bacteria | 1204 |
| 34 | Ga0070702_100145837 | 3300005615 | Bacteria | 1513 |
| 35 | Ga0068864_100558552 | 3300005618 | Bacteria | 1107 |
| 36 | Ga0068864_100901907 | 3300005618 | Bacteria | 873 |
| 37 | Ga0068861_100025364 | 3300005719 | Bacteria | 4299 |
| 38 | Ga0068870_10049875 | 3300005840 | Bacteria | 2210 |
| 39 | Ga0068858_100104257 | 3300005842 | Bacteria | 2646 |
| 40 | Ga0068860_100027566 | 3300005843 | Bacteria | 5470 |
| 41 | Ga0081455_10001405 | 3300005937 | Bacteria | 29762 |
| 42 | Ga0081455_10012183 | 3300005937 | Bacteria | 8588 |
| 43 | Ga0081455_10178291 | 3300005937 | Bacteria | 1611 |
| 44 | Ga0081538_10000121 | 3300005981 | Bacteria | 78856 |
| 45 | Ga0075369_10069867 | 3300006186 | Bacteria | 1545 |
| 46 | Ga0068871_100229984 | 3300006358 | Bacteria | 1609 |
| 47 | Ga0105251_10006813 | 3300009011 | Bacteria | 7193 |
| 48 | Ga0111539_10557240 | 3300009094 | Bacteria | 1335 |
| 49 | Ga0111539_11079433 | 3300009094 | Bacteria | 933 |
| 50 | Ga0105245_10002262 | 3300009098 | Bacteria | 17436 |
| 51 | Ga0105245_10364591 | 3300009098 | Bacteria | 1435 |
| 52 | Ga0105243_10025147 | 3300009148 | Bacteria | 4547 |
| 53 | Ga0105242_10122769 | 3300009176 | Bacteria | 2232 |
| 54 | Ga0105242_10164689 | 3300009176 | Bacteria | 1944 |
| 55 | Ga0105237_10468692 | 3300009545 | Bacteria | 1265 |
| 56 | Ga0105238_10481020 | 3300009551 | Bacteria | 1241 |
| 57 | Ga0105249_10050847 | 3300009553 | Bacteria | 3778 |
| 58 | Ga0105249_10334548 | 3300009553 | Bacteria | 1529 |
| 59 | Ga0105239_10001318 | 3300010375 | Bacteria | 33415 |
| 60 | Ga0105246_10000827 | 3300011119 | Bacteria | 17608 |
| 61 | Ga0105246_10036032 | 3300011119 | Bacteria | 3311 |
| 62 | Ga0105246_10159639 | 3300011119 | Bacteria | 1716 |
| 63 | Ga0105246_10197980 | 3300011119 | Bacteria | 1560 |
| 64 | Ga0105246_10206554 | 3300011119 | Bacteria | 1530 |
| 65 | Ga0105246_10296662 | 3300011119 | Bacteria | 1303 |
| 66 | Ga0157326_1008557 | 3300012513 | Bacteria | 1117 |
| 67 | Ga0157373_10003357 | 3300013100 | Bacteria | 12097 |
| 68 | Ga0157371_10052641 | 3300013102 | Bacteria | 2891 |
| 69 | Ga0157370_10018032 | 3300013104 | Bacteria | 7105 |
| 70 | Ga0157369_10014543 | 3300013105 | Bacteria | 8879 |
| 71 | Ga0157369_10070384 | 3300013105 | Bacteria | 3758 |
| 72 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 73 | Ga0163162_10028167 | 3300013306 | Bacteria | 5556 |
| 74 | Ga0157372_10013196 | 3300013307 | Bacteria | 8815 |
| 75 | Ga0157372_10538075 | 3300013307 | Bacteria | 1362 |
| 76 | Ga0157375_10984214 | 3300013308 | Bacteria | 984 |
| 77 | Ga0157375_11249007 | 3300013308 | Bacteria | 872 |
| 78 | Ga0163163_10165609 | 3300014325 | Bacteria | 2256 |
| 79 | Ga0163163_10571228 | 3300014325 | Bacteria | 1194 |
| 80 | Ga0163163_10672716 | 3300014325 | Bacteria | 1099 |
| 81 | Ga0157380_10015072 | 3300014326 | Bacteria | 5672 |
| 82 | Ga0157380_10744761 | 3300014326 | Bacteria | 990 |
| 83 | Ga0157377_10187965 | 3300014745 | Bacteria | 1303 |
| 84 | Ga0157379_10010469 | 3300014968 | Bacteria | 8084 |
| 85 | Ga0207697_10001155 | 3300025315 | Bacteria | 14508 |
| 86 | Ga0207655_1012131 | 3300025728 | Bacteria | 5065 |
| 87 | Ga0207713_1040850 | 3300025735 | Bacteria | 1942 |
| 88 | Ga0207682_10001933 | 3300025893 | Bacteria | 9415 |
| 89 | Ga0207688_10023891 | 3300025901 | Bacteria | 3351 |
| 90 | Ga0207688_10031227 | 3300025901 | Bacteria | 2940 |
| 91 | Ga0207688_10069257 | 3300025901 | Bacteria | 1999 |
| 92 | Ga0207647_10046248 | 3300025904 | Bacteria | 2712 |
| 93 | Ga0207645_10006464 | 3300025907 | Bacteria | 8408 |
| 94 | Ga0207643_10128429 | 3300025908 | Bacteria | 1506 |
| 95 | Ga0207705_10246223 | 3300025909 | Bacteria | 1362 |
| 96 | Ga0207671_10430880 | 3300025914 | Bacteria | 1049 |
| 97 | Ga0207657_10174416 | 3300025919 | Bacteria | 1741 |
| 98 | Ga0207681_10044831 | 3300025923 | Bacteria | 2965 |
| 99 | Ga0207694_10276624 | 3300025924 | Bacteria | 1378 |
| 100 | Ga0207650_10015817 | 3300025925 | Bacteria | 5260 |
| 101 | Ga0207687_10020074 | 3300025927 | Bacteria | 4431 |
| 102 | Ga0207687_10105557 | 3300025927 | Bacteria | 2082 |
| 103 | Ga0207690_10004881 | 3300025932 | Bacteria | 7910 |
| 104 | Ga0207686_10188197 | 3300025934 | Bacteria | 1469 |
| 105 | Ga0207686_10376502 | 3300025934 | Bacteria | 1075 |
| 106 | Ga0207709_10031875 | 3300025935 | Bacteria | 3083 |
| 107 | Ga0207669_10110068 | 3300025937 | Bacteria | 1844 |
| 108 | Ga0207669_10546810 | 3300025937 | Bacteria | 934 |
| 109 | Ga0207669_10735461 | 3300025937 | Bacteria | 813 |
| 110 | Ga0207691_10000237 | 3300025940 | Bacteria | 53889 |
| 111 | Ga0207691_10073080 | 3300025940 | Bacteria | 3093 |
| 112 | Ga0207691_10117277 | 3300025940 | Bacteria | 2362 |
| 113 | Ga0207661_10108126 | 3300025944 | Bacteria | 2347 |
| 114 | Ga0207651_10093077 | 3300025960 | Bacteria | 2212 |
| 115 | Ga0207712_10174258 | 3300025961 | Bacteria | 1684 |
| 116 | Ga0207668_10153982 | 3300025972 | Bacteria | 1783 |
| 117 | Ga0207702_10820307 | 3300026078 | Bacteria | 920 |
| 118 | Ga0207676_10010430 | 3300026095 | Bacteria | 6616 |
| 119 | Ga0207676_10157688 | 3300026095 | Bacteria | 1963 |
| 120 | Ga0207674_10021769 | 3300026116 | Bacteria | 6899 |
| 121 | Ga0207675_100053684 | 3300026118 | Bacteria | 3760 |
| 122 | Ga0207683_10001134 | 3300026121 | Bacteria | 24222 |
| 123 | Ga0207683_10006261 | 3300026121 | Bacteria | 10197 |
| 124 | Ga0207683_10208534 | 3300026121 | Bacteria | 1778 |
| 125 | Ga0207698_11374230 | 3300026142 | Bacteria | 721 |
| 126 | Ga0207428_10107415 | 3300027907 | Bacteria | 2150 |
| 127 | Ga0268266_10146196 | 3300028379 | Bacteria | 2126 |
| 128 | Ga0268264_10018494 | 3300028381 | Bacteria | 5699 |
| 129 | Ga0307408_100007514 | 3300031548 | Bacteria | 7205 |
| 130 | Ga0307408_100010637 | 3300031548 | Bacteria | 6070 |
| 131 | Ga0307408_100013428 | 3300031548 | Bacteria | 5435 |
| 132 | Ga0307408_100137488 | 3300031548 | Bacteria | 1913 |
| 133 | Ga0307408_100368096 | 3300031548 | Bacteria | 1225 |
| 134 | Ga0307405_10001158 | 3300031731 | Bacteria | 10849 |
| 135 | Ga0307405_10184654 | 3300031731 | Bacteria | 1500 |
| 136 | Ga0307405_10232911 | 3300031731 | Bacteria | 1359 |
| 137 | Ga0307405_10316197 | 3300031731 | Bacteria | 1191 |
| 138 | Ga0307405_10340838 | 3300031731 | Bacteria | 1152 |
| 139 | Ga0307413_10002422 | 3300031824 | Bacteria | 7580 |
| 140 | Ga0307413_10005051 | 3300031824 | Bacteria | 5831 |
| 141 | Ga0307413_10011832 | 3300031824 | Bacteria | 4311 |
| 142 | Ga0307413_10047517 | 3300031824 | Bacteria | 2560 |
| 143 | Ga0307413_10126672 | 3300031824 | Bacteria | 1740 |
| 144 | Ga0307410_10000549 | 3300031852 | Bacteria | 15431 |
| 145 | Ga0307410_10036149 | 3300031852 | Bacteria | 3214 |
| 146 | Ga0307410_10074909 | 3300031852 | Bacteria | 2358 |
| 147 | Ga0307410_10092654 | 3300031852 | Bacteria | 2148 |
| 148 | Ga0307410_10141819 | 3300031852 | Bacteria | 1778 |
| 149 | Ga0307410_10493201 | 3300031852 | Bacteria | 1007 |
| 150 | Ga0307406_10000068 | 3300031901 | Bacteria | 57569 |
| 151 | Ga0307406_10006749 | 3300031901 | Bacteria | 6349 |
| 152 | Ga0307406_10015235 | 3300031901 | Bacteria | 4444 |
| 153 | Ga0307406_10339139 | 3300031901 | Bacteria | 1170 |
| 154 | Ga0307406_10590344 | 3300031901 | Bacteria | 914 |
| 155 | Ga0307407_10003621 | 3300031903 | Bacteria | 6388 |
| 156 | Ga0307407_10007350 | 3300031903 | Bacteria | 4983 |
| 157 | Ga0307407_10010148 | 3300031903 | Bacteria | 4426 |
| 158 | Ga0307407_10011285 | 3300031903 | Bacteria | 4247 |
| 159 | Ga0307412_10006147 | 3300031911 | Bacteria | 6768 |
| 160 | Ga0307412_10152459 | 3300031911 | Bacteria | 1707 |
| 161 | Ga0307412_10239474 | 3300031911 | Bacteria | 1402 |
| 162 | Ga0307409_100000475 | 3300031995 | Bacteria | 17148 |
| 163 | Ga0307409_100022973 | 3300031995 | Bacteria | 4310 |
| 164 | Ga0307409_100047132 | 3300031995 | Bacteria | 3269 |
| 165 | Ga0307409_100156651 | 3300031995 | Bacteria | 1986 |
| 166 | Ga0307409_100243899 | 3300031995 | Bacteria | 1637 |
| 167 | Ga0307416_100000212 | 3300032002 | Bacteria | 30433 |
| 168 | Ga0307416_100036430 | 3300032002 | Bacteria | 3773 |
| 169 | Ga0307416_100063755 | 3300032002 | Bacteria | 3019 |
| 170 | Ga0307416_100195565 | 3300032002 | Bacteria | 1912 |
| 171 | Ga0307416_101052805 | 3300032002 | Bacteria | 917 |
| 172 | Ga0307416_101580476 | 3300032002 | Bacteria | 761 |
| 173 | Ga0307414_10000982 | 3300032004 | Bacteria | 14543 |
| 174 | Ga0307414_10089446 | 3300032004 | Bacteria | 2282 |
| 175 | Ga0307414_10151831 | 3300032004 | Bacteria | 1828 |
| 176 | Ga0307414_10448962 | 3300032004 | Bacteria | 1130 |
| 177 | Ga0307411_10004079 | 3300032005 | Bacteria | 6921 |
| 178 | Ga0307411_10012655 | 3300032005 | Bacteria | 4616 |
| 179 | Ga0307411_10106195 | 3300032005 | Bacteria | 1998 |
| 180 | Ga0307411_10410288 | 3300032005 | Bacteria | 1122 |
| 181 | Ga0307411_10444306 | 3300032005 | Bacteria | 1083 |
| 182 | Ga0307415_100005294 | 3300032126 | Bacteria | 6833 |
| 183 | Ga0307415_100027504 | 3300032126 | Bacteria | 3604 |
| 184 | Ga0307415_100063081 | 3300032126 | Bacteria | 2573 |
| 185 | Ga0307415_100098746 | 3300032126 | Bacteria | 2135 |
| 186 | Ga0316574_0074370 | 3300035398 | Bacteria | 2150 |
| 187 | Ga0395900_0863141 | 3300037418 | Bacteria | 830 |
| 188 | Ga0395898_0136759 | 3300037466 | Bacteria | 2346 |
| 189 | Ga0451837_1847479 | 3300041494 | Bacteria | 1570 |
| 190 | Ga0451853_0099403 | 3300041512 | Bacteria | 699 |
| 191 | Ga0451853_3441559 | 3300041512 | Bacteria | 7559 |
| 192 | Ga0439463_001848 | 3300042016 | Bacteria | 5494 |
| 193 | Ga0439463_029439 | 3300042016 | Bacteria | 1383 |
| 194 | Ga0439459_0069637 | 3300042438 | Bacteria | 811 |
| 195 | Ga0439464_0023601 | 3300042439 | Bacteria | 1698 |
| 196 | Ga0439460_0065849 | 3300042461 | Bacteria | 1114 |
| 197 | Ga0439440_0000314 | 3300042993 | Bacteria | 7898 |
| 198 | Ga0439440_0016304 | 3300042993 | Bacteria | 1624 |
| 199 | Ga0439440_0065398 | 3300042993 | Bacteria | 936 |
| 200 | Ga0495653_0196172 | 3300046463 | Bacteria | 1374 |
| 201 | Ga0495580_0010950 | 3300046472 | Bacteria | 7036 |
| 202 | Ga0495582_0145761 | 3300046473 | Bacteria | 1343 |
| 203 | Ga0495639_0002917 | 3300046475 | Bacteria | 7451 |
| 204 | Ga0495639_0230319 | 3300046475 | Bacteria | 913 |
| 205 | Ga0495662_0343361 | 3300046476 | Bacteria | 734 |
| 206 | Ga0495643_0057002 | 3300046522 | Bacteria | 2083 |
| 207 | Ga0495642_0209928 | 3300046528 | Bacteria | 849 |
| 208 | Ga0495665_0005931 | 3300046531 | Bacteria | 6582 |
| 209 | Ga0495633_0209230 | 3300046558 | Bacteria | 894 |
| 210 | Ga0495588_0003123 | 3300046674 | Bacteria | 7167 |
| 211 | Ga0495588_0005945 | 3300046674 | Bacteria | 5470 |
| 212 | Ga0495670_0205479 | 3300046691 | Bacteria | 1044 |
| 213 | Ga0495581_0027437 | 3300047315 | Bacteria | 3302 |
| 214 | Ga0495676_0325635 | 3300047321 | Bacteria | 1032 |
| 215 | Ga0495680_0400148 | 3300047322 | Bacteria | 948 |
| 216 | Ga0496100_0037985 | 3300048903 | Bacteria | 3048 |
| 217 | Ga0496100_0381444 | 3300048903 | Bacteria | 1070 |
| 218 | Ga0496101_0013646 | 3300048904 | Bacteria | 5449 |
| 219 | Ga0496101_0014300 | 3300048904 | Bacteria | 5330 |
| 220 | Ga0496101_0114256 | 3300048904 | Bacteria | 2035 |
| 221 | Ga0496102_0017577 | 3300048905 | Bacteria | 6265 |
| 222 | Ga0496102_0021949 | 3300048905 | Bacteria | 5653 |
| 223 | Ga0496102_0113422 | 3300048905 | Bacteria | 2528 |
| 224 | Ga0496102_1057991 | 3300048905 | Bacteria | 731 |
| 225 | Ga0496103_0009882 | 3300048906 | Bacteria | 5645 |
| 226 | Ga0496104_0001045 | 3300048907 | Bacteria | 23660 |
| 227 | Ga0496104_0032581 | 3300048907 | Bacteria | 4851 |
| 228 | Ga0496104_0083955 | 3300048907 | Bacteria | 3038 |
| 229 | Ga0496104_0120154 | 3300048907 | Bacteria | 2523 |
| 230 | Ga0496104_0154910 | 3300048907 | Bacteria | 2199 |
| 231 | Ga0496105_0005870 | 3300048908 | Bacteria | 9361 |
| 232 | Ga0496105_0040432 | 3300048908 | Bacteria | 3845 |
| 233 | Ga0496105_0117004 | 3300048908 | Bacteria | 2198 |
| 234 | Ga0496106_0056209 | 3300048909 | Bacteria | 2975 |
| 235 | Ga0496106_0580921 | 3300048909 | Bacteria | 898 |
| 236 | Ga0496107_0144845 | 3300048910 | Bacteria | 1756 |
| 237 | Ga0496107_0205759 | 3300048910 | Bacteria | 1463 |
| 238 | Ga0496108_0023810 | 3300048911 | Bacteria | 5039 |
| 239 | Ga0496108_0063880 | 3300048911 | Bacteria | 3100 |
| 240 | Ga0496108_0131163 | 3300048911 | Bacteria | 2154 |
| 241 | Ga0496109_0010297 | 3300048912 | Bacteria | 7985 |
| 242 | Ga0496109_0579769 | 3300048912 | Bacteria | 1057 |
| 243 | Ga0496110_0026695 | 3300048913 | Bacteria | 4945 |
| 244 | Ga0496110_0112107 | 3300048913 | Bacteria | 2452 |
| 245 | Ga0496110_0249634 | 3300048913 | Bacteria | 1615 |
| 246 | Ga0496110_0369166 | 3300048913 | Bacteria | 1307 |
| 247 | Ga0496110_0510387 | 3300048913 | Bacteria | 1094 |
| 248 | Ga0496110_0744512 | 3300048913 | Bacteria | 883 |
| 249 | Ga0496111_0004274 | 3300048914 | Bacteria | 8999 |
| 250 | Ga0496111_0038012 | 3300048914 | Bacteria | 3447 |
| 251 | Ga0496111_0043511 | 3300048914 | Bacteria | 3227 |
| 252 | Ga0496111_0065276 | 3300048914 | Bacteria | 2642 |
| 253 | Ga0496111_0257277 | 3300048914 | Bacteria | 1295 |
| 254 | Ga0496112_0190046 | 3300048915 | Bacteria | 2016 |
| 255 | Ga0496112_0209361 | 3300048915 | Bacteria | 1908 |
| 256 | Ga0496113_0100141 | 3300048916 | Bacteria | 2245 |
| 257 | Ga0496113_0516610 | 3300048916 | Bacteria | 959 |
| 258 | Ga0496114_0007756 | 3300048917 | Bacteria | 8492 |
| 259 | Ga0496114_0043992 | 3300048917 | Bacteria | 3703 |
| 260 | Ga0496114_0066197 | 3300048917 | Bacteria | 3029 |
| 261 | Ga0496114_0111092 | 3300048917 | Bacteria | 2348 |
| 262 | Ga0496114_0124633 | 3300048917 | Bacteria | 2219 |
| 263 | Ga0496114_0148257 | 3300048917 | Bacteria | 2035 |
| 264 | Ga0496124_0062013 | 3300048927 | Bacteria | 3131 |
| 265 | Ga0496125_0266995 | 3300048928 | Bacteria | 1069 |
| 266 | Ga0496126_0331066 | 3300048929 | Bacteria | 1250 |
| 267 | Ga0501298_041680 | 3300049521 | Bacteria | 932 |
| 268 | Ga0501031_0000082 | 3300049568 | Bacteria | 50347 |
| 269 | Ga0501031_0145155 | 3300049568 | Bacteria | 1550 |
| 270 | Ga0501032_0000035 | 3300049569 | Bacteria | 117554 |
| 271 | Ga0501032_0025297 | 3300049569 | Bacteria | 4093 |
| 272 | Ga0501032_0049603 | 3300049569 | Bacteria | 2832 |
| 273 | Ga0501033_0001072 | 3300049570 | Bacteria | 24844 |
| 274 | Ga0501033_0061245 | 3300049570 | Bacteria | 2774 |
| 275 | Ga0501034_0000190 | 3300049571 | Bacteria | 115701 |
| 276 | Ga0501034_0000925 | 3300049571 | Bacteria | 42868 |
| 277 | Ga0501034_0016699 | 3300049571 | Bacteria | 7526 |
| 278 | Ga0501034_0264638 | 3300049571 | Bacteria | 1662 |
| 279 | Ga0501034_0509663 | 3300049571 | Bacteria | 1116 |
| 280 | Ga0501036_0057956 | 3300049572 | Bacteria | 3281 |
| 281 | Ga0501036_0073873 | 3300049572 | Bacteria | 2883 |
| 282 | Ga0501036_0441850 | 3300049572 | Bacteria | 1084 |
| 283 | Ga0501037_0000370 | 3300049573 | Bacteria | 37472 |
| 284 | Ga0501038_0000172 | 3300049574 | Bacteria | 55198 |
| 285 | Ga0501038_0002149 | 3300049574 | Bacteria | 18305 |
| 286 | Ga0501038_0048134 | 3300049574 | Bacteria | 3691 |
| 287 | Ga0501038_0377099 | 3300049574 | Bacteria | 1101 |
| 288 | Ga0501038_0698859 | 3300049574 | Bacteria | 760 |
| 289 | Ga0501039_0000269 | 3300049575 | Bacteria | 37904 |
| 290 | Ga0501039_0026637 | 3300049575 | Bacteria | 4442 |
| 291 | Ga0501039_0067844 | 3300049575 | Bacteria | 2770 |
| 292 | Ga0501039_0096267 | 3300049575 | Bacteria | 2308 |
| 293 | Ga0501039_0571427 | 3300049575 | Bacteria | 887 |
| 294 | Ga0501040_0004011 | 3300049576 | Bacteria | 9566 |
| 295 | Ga0501040_0060854 | 3300049576 | Bacteria | 2596 |
| 296 | Ga0501040_0502223 | 3300049576 | Bacteria | 874 |
| 297 | Ga0501041_0007529 | 3300049577 | Bacteria | 6392 |
| 298 | Ga0501042_0020032 | 3300049578 | Bacteria | 4653 |
| 299 | Ga0501042_0031200 | 3300049578 | Bacteria | 3770 |
| 300 | Ga0501043_0000231 | 3300049579 | Bacteria | 50898 |
| 301 | Ga0501043_0078045 | 3300049579 | Bacteria | 2602 |
| 302 | Ga0501043_0274653 | 3300049579 | Bacteria | 1293 |
| 303 | Ga0501046_0000279 | 3300049580 | Bacteria | 51800 |
| 304 | Ga0501046_0045946 | 3300049580 | Bacteria | 3467 |
| 305 | Ga0501047_0000458 | 3300049581 | Bacteria | 45091 |
| 306 | Ga0501048_0000048 | 3300049582 | Bacteria | 59433 |
| 307 | Ga0501048_0032520 | 3300049582 | Bacteria | 3769 |
| 308 | Ga0501048_0119997 | 3300049582 | Bacteria | 1858 |
| 309 | Ga0501067_0013822 | 3300049583 | Bacteria | 4470 |
| 310 | Ga0501068_0039061 | 3300049584 | Bacteria | 2845 |
| 311 | Ga0501068_0045263 | 3300049584 | Bacteria | 2651 |
| 312 | Ga0501069_0000741 | 3300049585 | Bacteria | 15231 |
| 313 | Ga0501070_0000504 | 3300049586 | Bacteria | 35626 |
| 314 | Ga0501070_0162732 | 3300049586 | Bacteria | 1839 |
| 315 | Ga0501070_0295399 | 3300049586 | Bacteria | 1320 |
| 316 | Ga0501071_0013790 | 3300049587 | Bacteria | 5515 |
| 317 | Ga0501071_0063357 | 3300049587 | Bacteria | 2681 |
| 318 | Ga0501071_0118513 | 3300049587 | Bacteria | 1961 |
| 319 | Ga0501071_0282552 | 3300049587 | Bacteria | 1256 |
| 320 | Ga0501072_0038631 | 3300049588 | Bacteria | 3746 |
| 321 | Ga0501072_0296541 | 3300049588 | Bacteria | 1285 |
| 322 | Ga0501073_0001049 | 3300049589 | Bacteria | 19926 |
| 323 | Ga0501074_0000061 | 3300049590 | Bacteria | 53799 |
| 324 | Ga0501074_0077377 | 3300049590 | Bacteria | 2387 |
| 325 | Ga0501075_0026064 | 3300049591 | Bacteria | 4299 |
| 326 | Ga0501076_0004327 | 3300049592 | Bacteria | 10074 |
| 327 | Ga0501076_0129824 | 3300049592 | Bacteria | 2043 |
| 328 | Ga0501077_0051419 | 3300049593 | Bacteria | 2618 |
| 329 | Ga0501079_0007986 | 3300049741 | Bacteria | 8020 |
| 330 | Ga0501080_0000160 | 3300049742 | Bacteria | 48505 |
| 331 | Ga0501080_0097799 | 3300049742 | Bacteria | 2725 |
| 332 | Ga0501083_0004099 | 3300049744 | Bacteria | 10258 |
| 333 | Ga0501083_0009646 | 3300049744 | Bacteria | 6820 |
| 334 | Ga0501083_0043626 | 3300049744 | Bacteria | 3038 |
| 335 | Ga0501270_018483 | 3300049767 | Bacteria | 1033 |
| 336 | Ga0501035_0000404 | 3300049822 | Bacteria | 49157 |
| 337 | Ga0501035_0027080 | 3300049822 | Bacteria | 5241 |
| 338 | Ga0501035_0047877 | 3300049822 | Bacteria | 3836 |
| 339 | Ga0501044_0000439 | 3300049823 | Bacteria | 50915 |
| 340 | Ga0501044_0355848 | 3300049823 | Bacteria | 1383 |
| 341 | Ga0501045_0046786 | 3300049824 | Bacteria | 3150 |
| 342 | Ga0501212_030161 | 3300049851 | Bacteria | 872 |
| 343 | nmdc:mga08y16_507031_c1 | 3300050511 | Bacteria | 1225 |
| 344 | Ga0495655_0246121 | 3300053083 | Bacteria | 600 |
| 345 | Ga0501084_0002451 | 3300054114 | Bacteria | 14931 |
| 346 | Ga0501084_0009697 | 3300054114 | Bacteria | 7964 |
| 347 | 2537897718 | 2537561592 | Bacteria | 4348607 |
| 348 | 2644609353 | 2643221711 | Bacteria | 4865335 |
| 349 | 2691515514 | 2690315906 | Bacteria | 4517044 |
| 350 | 2753037591 | 2751185725 | Bacteria | 5740550 |
| 351 | 2753325459 | 2751185792 | Bacteria | 5739090 |
| 352 | 2775654770 | 2775506735 | Bacteria | 4556596 |
| 353 | 2808828004 | 2808606357 | Bacteria | 4466944 |
| 354 | 2808853360 | 2808606360 | Bacteria | 4404006 |
| 355 | 2808878144 | 2808606366 | Bacteria | 4415912 |
| 356 | 2808890996 | 2808606370 | Bacteria | 4942454 |
| 357 | 2808897348 | 2808606371 | Bacteria | 4251511 |
| 358 | 2812320236 | 2811994871 | Bacteria | 4497550 |
| 359 | 2819428767 | 2818991318 | Bacteria | 5266538 |
| 360 | 2819666188 | 2818991458 | Bacteria | 4794049 |
| 361 | 2819693037 | 2818991462 | Bacteria | 4320267 |
| 362 | 2819730329 | 2818991469 | Bacteria | 4644110 |
| 363 | 2837269631 | 2837268691 | Bacteria | 7850704 |
| 364 | 2883826441 | 2883821847 | Bacteria | 5121194 |
| 365 | 2884994219 | 2884994152 | Bacteria | 4492978 |
| 366 | 2902801064 | 2902799365 | Bacteria | 5419524 |
| 367 | 2939601984 | 2939598168 | Bacteria | 4687164 |
| 368 | 8004023558 | 8004021418 | Bacteria | 4313954 |
| 369 | 8004028381 | 8004025490 | Bacteria | 4327753 |
| 370 | Ga0496102_0062580 | |||
| 371 | JGI24751J29686_10081328 | |||
| 372 | Ga0006562J51391_1019106 | |||
| 373 | Ga0065714_10002995 | |||
| 374 | Ga0070658_10049909 | |||
| 375 | Ga0070676_10003874 | |||
| 376 | Ga0070683_100009449 | |||
| 377 | Ga0070670_100073241 | |||
| 378 | Ga0070677_10007081 | |||
| 379 | Ga0070666_10002686 | |||
| 380 | Ga0070682_100034276 | |||
| 381 | Ga0070660_100140254 | |||
| 382 | Ga0070691_10135246 | |||
| 383 | Ga0070692_10067229 | |||
| 384 | Ga0070668_100038518 | |||
| 385 | Ga0070668_100091977 | |||
| 386 | Ga0070669_100006735 | |||
| 387 | Ga0070675_100003512 | |||
| 388 | Ga0070674_100026726 | |||
| 389 | Ga0070673_100030336 | |||
| 390 | Ga0070659_100407842 | |||
| 391 | Ga0070667_100049824 | |||
| 392 | Ga0070694_100770723 | |||
| 393 | Ga0070678_100003008 | |||
| 394 | Ga0070678_100150307 | |||
| 395 | Ga0070678_100176242 | |||
| 396 | Ga0070684_100004672 | |||
| 397 | Ga0070672_100314415 | |||
| 398 | Ga0070665_100587977 | |||
| 399 | Ga0070664_100036071 | |||
| 400 | Ga0070664_100862540 | |||
| 401 | Ga0068857_100239925 | |||
| 402 | Ga0068856_100525825 | |||
| 403 | Ga0070702_100145837 | |||
| 404 | Ga0068864_100558552 | |||
| 405 | Ga0068864_100901907 | |||
| 406 | Ga0068861_100025364 | |||
| 407 | Ga0068870_10049875 | |||
| 408 | Ga0068858_100104257 | |||
| 409 | Ga0068860_100027566 | |||
| 410 | Ga0081455_10001405 | |||
| 411 | Ga0081455_10012183 | |||
| 412 | Ga0081455_10178291 | |||
| 413 | Ga0081538_10000121 | |||
| 414 | Ga0075369_10069867 | |||
| 415 | Ga0068871_100229984 | |||
| 416 | Ga0105251_10006813 | |||
| 417 | Ga0111539_10557240 | |||
| 418 | Ga0111539_11079433 | |||
| 419 | Ga0105245_10002262 | |||
| 420 | Ga0105245_10364591 | |||
| 421 | Ga0105243_10025147 | |||
| 422 | Ga0105242_10122769 | |||
| 423 | Ga0105242_10164689 | |||
| 424 | Ga0105237_10468692 | |||
| 425 | Ga0105238_10481020 | |||
| 426 | Ga0105249_10050847 | |||
| 427 | Ga0105249_10334548 | |||
| 428 | Ga0105239_10001318 | |||
| 429 | Ga0105246_10000827 | |||
| 430 | Ga0105246_10036032 | |||
| 431 | Ga0105246_10159639 | |||
| 432 | Ga0105246_10197980 | |||
| 433 | Ga0105246_10206554 | |||
| 434 | Ga0105246_10296662 | |||
| 435 | Ga0157326_1008557 | |||
| 436 | Ga0157373_10003357 | |||
| 437 | Ga0157371_10052641 | |||
| 438 | Ga0157370_10018032 | |||
| 439 | Ga0157369_10014543 | |||
| 440 | Ga0157369_10070384 | |||
| 441 | Ga0171462_1004 | |||
| 442 | Ga0163162_10028167 | |||
| 443 | Ga0157372_10013196 | |||
| 444 | Ga0157372_10538075 | |||
| 445 | Ga0157375_10984214 | |||
| 446 | Ga0157375_11249007 | |||
| 447 | Ga0163163_10165609 | |||
| 448 | Ga0163163_10571228 | |||
| 449 | Ga0163163_10672716 | |||
| 450 | Ga0157380_10015072 | |||
| 451 | Ga0157380_10744761 | |||
| 452 | Ga0157377_10187965 | |||
| 453 | Ga0157379_10010469 | |||
| 454 | Ga0207697_10001155 | |||
| 455 | Ga0207655_1012131 | |||
| 456 | Ga0207713_1040850 | |||
| 457 | Ga0207682_10001933 | |||
| 458 | Ga0207688_10023891 | |||
| 459 | Ga0207688_10031227 | |||
| 460 | Ga0207688_10069257 | |||
| 461 | Ga0207647_10046248 | |||
| 462 | Ga0207645_10006464 | |||
| 463 | Ga0207643_10128429 | |||
| 464 | Ga0207705_10246223 | |||
| 465 | Ga0207671_10430880 | |||
| 466 | Ga0207657_10174416 | |||
| 467 | Ga0207681_10044831 | |||
| 468 | Ga0207694_10276624 | |||
| 469 | Ga0207650_10015817 | |||
| 470 | Ga0207687_10020074 | |||
| 471 | Ga0207687_10105557 | |||
| 472 | Ga0207690_10004881 | |||
| 473 | Ga0207686_10188197 | |||
| 474 | Ga0207686_10376502 | |||
| 475 | Ga0207709_10031875 | |||
| 476 | Ga0207669_10110068 | |||
| 477 | Ga0207669_10546810 | |||
| 478 | Ga0207669_10735461 | |||
| 479 | Ga0207691_10000237 | |||
| 480 | Ga0207691_10073080 | |||
| 481 | Ga0207691_10117277 | |||
| 482 | Ga0207661_10108126 | |||
| 483 | Ga0207651_10093077 | |||
| 484 | Ga0207712_10174258 | |||
| 485 | Ga0207668_10153982 | |||
| 486 | Ga0207702_10820307 | |||
| 487 | Ga0207676_10010430 | |||
| 488 | Ga0207676_10157688 | |||
| 489 | Ga0207674_10021769 | |||
| 490 | Ga0207675_100053684 | |||
| 491 | Ga0207683_10001134 | |||
| 492 | Ga0207683_10006261 | |||
| 493 | Ga0207683_10208534 | |||
| 494 | Ga0207698_11374230 | |||
| 495 | Ga0207428_10107415 | |||
| 496 | Ga0268266_10146196 | |||
| 497 | Ga0268264_10018494 | |||
| 498 | Ga0307408_100007514 | |||
| 499 | Ga0307408_100010637 | |||
| 500 | Ga0307408_100013428 | |||
| 501 | Ga0307408_100137488 | |||
| 502 | Ga0307408_100368096 | |||
| 503 | Ga0307405_10001158 | |||
| 504 | Ga0307405_10184654 | |||
| 505 | Ga0307405_10232911 | |||
| 506 | Ga0307405_10316197 | |||
| 507 | Ga0307405_10340838 | |||
| 508 | Ga0307413_10002422 | |||
| 509 | Ga0307413_10005051 | |||
| 510 | Ga0307413_10011832 | |||
| 511 | Ga0307413_10047517 | |||
| 512 | Ga0307413_10126672 | |||
| 513 | Ga0307410_10000549 | |||
| 514 | Ga0307410_10036149 | |||
| 515 | Ga0307410_10074909 | |||
| 516 | Ga0307410_10092654 | |||
| 517 | Ga0307410_10141819 | |||
| 518 | Ga0307410_10493201 | |||
| 519 | Ga0307406_10000068 | |||
| 520 | Ga0307406_10006749 | |||
| 521 | Ga0307406_10015235 | |||
| 522 | Ga0307406_10339139 | |||
| 523 | Ga0307406_10590344 | |||
| 524 | Ga0307407_10003621 | |||
| 525 | Ga0307407_10007350 | |||
| 526 | Ga0307407_10010148 | |||
| 527 | Ga0307407_10011285 | |||
| 528 | Ga0307412_10006147 | |||
| 529 | Ga0307412_10152459 | |||
| 530 | Ga0307412_10239474 | |||
| 531 | Ga0307409_100000475 | |||
| 532 | Ga0307409_100022973 | |||
| 533 | Ga0307409_100047132 | |||
| 534 | Ga0307409_100156651 | |||
| 535 | Ga0307409_100243899 | |||
| 536 | Ga0307416_100000212 | |||
| 537 | Ga0307416_100036430 | |||
| 538 | Ga0307416_100063755 | |||
| 539 | Ga0307416_100195565 | |||
| 540 | Ga0307416_101052805 | |||
| 541 | Ga0307416_101580476 | |||
| 542 | Ga0307414_10000982 | |||
| 543 | Ga0307414_10089446 | |||
| 544 | Ga0307414_10151831 | |||
| 545 | Ga0307414_10448962 | |||
| 546 | Ga0307411_10004079 | |||
| 547 | Ga0307411_10012655 | |||
| 548 | Ga0307411_10106195 | |||
| 549 | Ga0307411_10410288 | |||
| 550 | Ga0307411_10444306 | |||
| 551 | Ga0307415_100005294 | |||
| 552 | Ga0307415_100027504 | |||
| 553 | Ga0307415_100063081 | |||
| 554 | Ga0307415_100098746 | |||
| 555 | Ga0316574_0074370 | |||
| 556 | Ga0395900_0863141 | |||
| 557 | Ga0395898_0136759 | |||
| 558 | Ga0451837_1847479 | |||
| 559 | Ga0451853_0099403 | |||
| 560 | Ga0451853_3441559 | |||
| 561 | Ga0439463_001848 | |||
| 562 | Ga0439463_029439 | |||
| 563 | Ga0439459_0069637 | |||
| 564 | Ga0439464_0023601 | |||
| 565 | Ga0439460_0065849 | |||
| 566 | Ga0439440_0000314 | |||
| 567 | Ga0439440_0016304 | |||
| 568 | Ga0439440_0065398 | |||
| 569 | Ga0495653_0196172 | |||
| 570 | Ga0495580_0010950 | |||
| 571 | Ga0495582_0145761 | |||
| 572 | Ga0495639_0002917 | |||
| 573 | Ga0495639_0230319 | |||
| 574 | Ga0495662_0343361 | |||
| 575 | Ga0495643_0057002 | |||
| 576 | Ga0495642_0209928 | |||
| 577 | Ga0495665_0005931 | |||
| 578 | Ga0495633_0209230 | |||
| 579 | Ga0495588_0003123 | |||
| 580 | Ga0495588_0005945 | |||
| 581 | Ga0495670_0205479 | |||
| 582 | Ga0495581_0027437 | |||
| 583 | Ga0495676_0325635 | |||
| 584 | Ga0495680_0400148 | |||
| 585 | Ga0496100_0037985 | |||
| 586 | Ga0496100_0381444 | |||
| 587 | Ga0496101_0013646 | |||
| 588 | Ga0496101_0014300 | |||
| 589 | Ga0496101_0114256 | |||
| 590 | Ga0496102_0017577 | |||
| 591 | Ga0496102_0021949 | |||
| 592 | Ga0496102_0113422 | |||
| 593 | Ga0496102_1057991 | |||
| 594 | Ga0496103_0009882 | |||
| 595 | Ga0496104_0001045 | |||
| 596 | Ga0496104_0032581 | |||
| 597 | Ga0496104_0083955 | |||
| 598 | Ga0496104_0120154 | |||
| 599 | Ga0496104_0154910 | |||
| 600 | Ga0496105_0005870 | |||
| 601 | Ga0496105_0040432 | |||
| 602 | Ga0496105_0117004 | |||
| 603 | Ga0496106_0056209 | |||
| 604 | Ga0496106_0580921 | |||
| 605 | Ga0496107_0144845 | |||
| 606 | Ga0496107_0205759 | |||
| 607 | Ga0496108_0023810 | |||
| 608 | Ga0496108_0063880 | |||
| 609 | Ga0496108_0131163 | |||
| 610 | Ga0496109_0010297 | |||
| 611 | Ga0496109_0579769 | |||
| 612 | Ga0496110_0026695 | |||
| 613 | Ga0496110_0112107 | |||
| 614 | Ga0496110_0249634 | |||
| 615 | Ga0496110_0369166 | |||
| 616 | Ga0496110_0510387 | |||
| 617 | Ga0496110_0744512 | |||
| 618 | Ga0496111_0004274 | |||
| 619 | Ga0496111_0038012 | |||
| 620 | Ga0496111_0043511 | |||
| 621 | Ga0496111_0065276 | |||
| 622 | Ga0496111_0257277 | |||
| 623 | Ga0496112_0190046 | |||
| 624 | Ga0496112_0209361 | |||
| 625 | Ga0496113_0100141 | |||
| 626 | Ga0496113_0516610 | |||
| 627 | Ga0496114_0007756 | |||
| 628 | Ga0496114_0043992 | |||
| 629 | Ga0496114_0066197 | |||
| 630 | Ga0496114_0111092 | |||
| 631 | Ga0496114_0124633 | |||
| 632 | Ga0496114_0148257 | |||
| 633 | Ga0496124_0062013 | |||
| 634 | Ga0496125_0266995 | |||
| 635 | Ga0496126_0331066 | |||
| 636 | Ga0501298_041680 | |||
| 637 | Ga0501031_0000082 | |||
| 638 | Ga0501031_0145155 | |||
| 639 | Ga0501032_0000035 | |||
| 640 | Ga0501032_0025297 | |||
| 641 | Ga0501032_0049603 | |||
| 642 | Ga0501033_0001072 | |||
| 643 | Ga0501033_0061245 | |||
| 644 | Ga0501034_0000190 | |||
| 645 | Ga0501034_0000925 | |||
| 646 | Ga0501034_0016699 | |||
| 647 | Ga0501034_0264638 | |||
| 648 | Ga0501034_0509663 | |||
| 649 | Ga0501036_0057956 | |||
| 650 | Ga0501036_0073873 | |||
| 651 | Ga0501036_0441850 | |||
| 652 | Ga0501037_0000370 | |||
| 653 | Ga0501038_0000172 | |||
| 654 | Ga0501038_0002149 | |||
| 655 | Ga0501038_0048134 | |||
| 656 | Ga0501038_0377099 | |||
| 657 | Ga0501038_0698859 | |||
| 658 | Ga0501039_0000269 | |||
| 659 | Ga0501039_0026637 | |||
| 660 | Ga0501039_0067844 | |||
| 661 | Ga0501039_0096267 | |||
| 662 | Ga0501039_0571427 | |||
| 663 | Ga0501040_0004011 | |||
| 664 | Ga0501040_0060854 | |||
| 665 | Ga0501040_0502223 | |||
| 666 | Ga0501041_0007529 | |||
| 667 | Ga0501042_0020032 | |||
| 668 | Ga0501042_0031200 | |||
| 669 | Ga0501043_0000231 | |||
| 670 | Ga0501043_0078045 | |||
| 671 | Ga0501043_0274653 | |||
| 672 | Ga0501046_0000279 | |||
| 673 | Ga0501046_0045946 | |||
| 674 | Ga0501047_0000458 | |||
| 675 | Ga0501048_0000048 | |||
| 676 | Ga0501048_0032520 | |||
| 677 | Ga0501048_0119997 | |||
| 678 | Ga0501067_0013822 | |||
| 679 | Ga0501068_0039061 | |||
| 680 | Ga0501068_0045263 | |||
| 681 | Ga0501069_0000741 | |||
| 682 | Ga0501070_0000504 | |||
| 683 | Ga0501070_0162732 | |||
| 684 | Ga0501070_0295399 | |||
| 685 | Ga0501071_0013790 | |||
| 686 | Ga0501071_0063357 | |||
| 687 | Ga0501071_0118513 | |||
| 688 | Ga0501071_0282552 | |||
| 689 | Ga0501072_0038631 | |||
| 690 | Ga0501072_0296541 | |||
| 691 | Ga0501073_0001049 | |||
| 692 | Ga0501074_0000061 | |||
| 693 | Ga0501074_0077377 | |||
| 694 | Ga0501075_0026064 | |||
| 695 | Ga0501076_0004327 | |||
| 696 | Ga0501076_0129824 | |||
| 697 | Ga0501077_0051419 | |||
| 698 | Ga0501079_0007986 | |||
| 699 | Ga0501080_0000160 | |||
| 700 | Ga0501080_0097799 | |||
| 701 | Ga0501083_0004099 | |||
| 702 | Ga0501083_0009646 | |||
| 703 | Ga0501083_0043626 | |||
| 704 | Ga0501270_018483 | |||
| 705 | Ga0501035_0000404 | |||
| 706 | Ga0501035_0027080 | |||
| 707 | Ga0501035_0047877 | |||
| 708 | Ga0501044_0000439 | |||
| 709 | Ga0501044_0355848 | |||
| 710 | Ga0501045_0046786 | |||
| 711 | Ga0501212_030161 | |||
| 712 | nmdc:mga08y16_507031_c1 | |||
| 713 | Ga0495655_0246121 | |||
| 714 | Ga0501084_0002451 | |||
| 715 | Ga0501084_0009697 | |||
| 716 | 2537897718 | |||
| 717 | 2644609353 | |||
| 718 | 2691515514 | |||
| 719 | 2753037591 | |||
| 720 | 2753325459 | |||
| 721 | 2775654770 | |||
| 722 | 2808828004 | |||
| 723 | 2808853360 | |||
| 724 | 2808878144 | |||
| 725 | 2808890996 | |||
| 726 | 2808897348 | |||
| 727 | 2812320236 | |||
| 728 | 2819428767 | |||
| 729 | 2819666188 | |||
| 730 | 2819693037 | |||
| 731 | 2819730329 | |||
| 732 | 2837269631 | |||
| 733 | 2883826441 | |||
| 734 | 2884994219 | |||
| 735 | 2902801064 | |||
| 736 | 2939601984 | |||
| 737 | 8004023558 | |||
| 738 | 8004028381 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o9x-assembly1.cif.gz_A | crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus | 0.7493 | 1 | 166 |
| 2o9x-assembly1.cif.gz_A | crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus | 0.7098 | 1 | 166 |
| 1s9u-assembly1.cif.gz_A | atomic structure of a putative anaerobic dehydrogenase component | 0.6561 | 5 | 166 |
| 1s9u-assembly1.cif.gz_A | atomic structure of a putative anaerobic dehydrogenase component | 0.5464 | 5 | 166 |
| 1n1c-assembly1.cif.gz_A | crystal structure of the dimeric tord chaperone from shewanella massilia | 0.3269 | 20 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06561_3_176_1.10.3480.10 | Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like | 0.8917 | 11 | 182 | 1.10.3480.10 |
| af_P9WJQ1_274_409_1.10.3480.10 | Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like | 0.8914 | 25 | 161 | 1.10.3480.10 |
| af_O06561_3_176_1.10.3480.10 | Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like | 0.8774 | 11 | 182 | 1.10.3480.10 |
| af_P9WJQ1_274_409_1.10.3480.10 | Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like | 0.8732 | 25 | 161 | 1.10.3480.10 |
| af_P0AF26_5_149_1.10.3480.10 | Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like | 0.8682 | 11 | 150 | 1.10.3480.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N4SVW4-F1-model_v4 | deleted | 0.9359 | 1 | 169 |
|
| AF-A0A1H0QB96-F1-model_v4 | Respiratory nitrate reductase chaperone NarJ | 0.9244 | 1 | 206 |
GO:0016530
GO:0042128 GO:0051082 GO:0051131 |
| AF-A0A542IPS0-F1-model_v4 | Respiratory nitrate reductase chaperone NarJ | 0.9243 | 1 | 206 |
GO:0016530
GO:0042128 GO:0051082 GO:0051131 |
| AF-A0A7X6NUS1-F1-model_v4 | Nitrate reductase molybdenum cofactor assembly chaperone | 0.9236 | 1 | 196 |
GO:0016530
GO:0042128 GO:0051082 GO:0051131 |
| AF-A0A655A1B6-F1-model_v4 | Nitrate reductase NarX (EC 1.7.99.4) | 0.9231 | 4 | 166 |
GO:0005886
GO:0008940 GO:0009055 GO:0009325 GO:0019645 GO:0020037 GO:0042128 GO:0046872 GO:0051082 GO:0051131 |