F425110

General Info

Members Datasets Scaffolds Average Seq Length
369 176 738 324

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000047|Ga0395905_0000047_66130_67200
Length 356
Sequence MTPMMSLFLRCLLALALVVVLLALTGYAMAATPVQAPHSALDAMGPQAQHWVDLWRVFLGACTAVFVAILVALWLAIRRAPRADEATPPDLSSVNRAEPGPHRHVMRAVIASGLALVALIAASVFADRALARLPLANAVHIELTGHQWWWSARYIDGPHASDIFVTANEIHIPVGRPVVFKLNADDVIHSLWVPSLAGKKDLIPGRTALLELRADRPGIYRGQCAEFCGLEHALMGLLVIADPPEQFDAWVAAQRQPAAEPADAQARRGKQVFQASSCALCHSIVGADFAGAQHAPDLTHVASRQTLAAGTLKNTRDNLAGWIRDPQIHKPGAAMPATPLSPEDLDAIVAYLGGLK

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
93 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
97 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2643221556 Massilia sp. Root1485 Isolate Unclassified
174 2643221684 Massilia sp. Root133 Isolate Unclassified
175 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
176 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 2.98
Rhizosphere 89.16
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0000047 3300037471 Bacteria 237582
2 rootH2_10095379 3300003320 Bacteria 1936
3 rootL2_10097028 3300003322 Bacteria 3763
4 rootH1_10185502 3300003323 Bacteria 1743
5 Ga0055540_1003419 3300003792 Bacteria 7678
6 Ga0055531_10001478 3300003794 Bacteria 17287
7 Ga0065165_1001064 3300005262 Bacteria 32813
8 Ga0065165_1016020 3300005262 Bacteria 2827
9 Ga0070658_10144944 3300005327 Bacteria 1985
10 Ga0070683_100071610 3300005329 Bacteria 3235
11 Ga0070683_100258991 3300005329 Bacteria 1654
12 Ga0070683_100367566 3300005329 Bacteria 1370
13 Ga0070670_100000750 3300005331 Bacteria 25161
14 Ga0070670_100135580 3300005331 Bacteria 2127
15 Ga0070670_100139467 3300005331 Bacteria 2096
16 Ga0070670_100280252 3300005331 Bacteria 1455
17 Ga0070677_10019822 3300005333 Bacteria 2442
18 Ga0068869_100100403 3300005334 Unclassified 2188
19 Ga0070666_10048206 3300005335 Bacteria 2862
20 Ga0070680_100003443 3300005336 Bacteria 11816
21 Ga0070660_100033946 3300005339 Bacteria 3851
22 Ga0070660_100053906 3300005339 Bacteria 3103
23 Ga0070660_100122069 3300005339 Bacteria 2080
24 Ga0070661_100005359 3300005344 Bacteria 8844
25 Ga0070661_100010340 3300005344 Bacteria 6487
26 Ga0070661_100234347 3300005344 Bacteria 1412
27 Ga0070675_100007253 3300005354 Bacteria 8551
28 Ga0070675_100240487 3300005354 Bacteria 1582
29 Ga0070671_100028742 3300005355 Bacteria 4581
30 Ga0070673_100009011 3300005364 Bacteria 6679
31 Ga0070659_100017857 3300005366 Bacteria 5344
32 Ga0070659_100027646 3300005366 Bacteria 4373
33 Ga0070659_100073029 3300005366 Bacteria 2730
34 Ga0070663_100235073 3300005455 Bacteria 1444
35 Ga0070663_100274206 3300005455 Bacteria 1342
36 Ga0070678_100042708 3300005456 Bacteria 3225
37 Ga0070678_100070056 3300005456 Bacteria 2620
38 Ga0070681_10104439 3300005458 Bacteria 2776
39 Ga0070684_100028579 3300005535 Bacteria 4718
40 Ga0070684_100039404 3300005535 Bacteria 4064
41 Ga0070684_100145034 3300005535 Bacteria 2148
42 Ga0070672_100000880 3300005543 Bacteria 17997
43 Ga0070672_100025022 3300005543 Bacteria 4421
44 Ga0070672_100091975 3300005543 Bacteria 2448
45 Ga0070672_100196517 3300005543 Bacteria 1685
46 Ga0070693_100034370 3300005547 Bacteria 2805
47 Ga0070664_100014650 3300005564 Bacteria 6401
48 Ga0070664_100018411 3300005564 Bacteria 5737
49 Ga0070664_100048045 3300005564 Bacteria 3606
50 Ga0070664_100120727 3300005564 Bacteria 2295
51 Ga0068857_100061592 3300005577 Bacteria 3334
52 Ga0068854_100001471 3300005578 Bacteria 14274
53 Ga0068854_100099263 3300005578 Bacteria 2180
54 Ga0068854_100126264 3300005578 Bacteria 1949
55 Ga0068856_100015864 3300005614 Bacteria 7285
56 Ga0068852_100041928 3300005616 Bacteria 3872
57 Ga0068852_100094402 3300005616 Bacteria 2683
58 Ga0068852_100097039 3300005616 Bacteria 2650
59 Ga0068852_100126672 3300005616 Bacteria 2346
60 Ga0068864_100005560 3300005618 Bacteria 10335
61 Ga0068864_100019644 3300005618 Bacteria 5651
62 Ga0068864_100181638 3300005618 Bacteria 1924
63 Ga0068851_10010485 3300005834 Bacteria 4329
64 Ga0068870_10104965 3300005840 Bacteria 1604
65 Ga0068863_100141364 3300005841 Bacteria 2300
66 Ga0075365_10124557 3300006038 Bacteria 1780
67 Ga0075365_10249998 3300006038 Bacteria 1246
68 Ga0068871_100043775 3300006358 Bacteria 3598
69 Ga0068871_100141836 3300006358 Bacteria 2044
70 Ga0105242_10008295 3300009176 Bacteria 7980
71 Ga0105242_10106166 3300009176 Bacteria 2386
72 Ga0105248_10030665 3300009177 Bacteria 6005
73 Ga0105248_10056747 3300009177 Bacteria 4394
74 Ga0105248_10444845 3300009177 Bacteria 1460
75 Ga0105238_10023224 3300009551 Bacteria 6322
76 Ga0157373_10009281 3300013100 Bacteria 7273
77 Ga0157371_10000001 3300013102 Bacteria 1162285
78 Ga0157371_10120695 3300013102 Bacteria 1863
79 Ga0157369_10023408 3300013105 Bacteria 6879
80 Ga0157369_10118031 3300013105 Bacteria 2816
81 Ga0157369_10447009 3300013105 Bacteria 1339
82 Ga0157374_10062768 3300013296 Bacteria 3484
83 Ga0157374_10190483 3300013296 Bacteria 2006
84 Ga0157374_10336067 3300013296 Bacteria 1499
85 Ga0157372_10119772 3300013307 Bacteria 3022
86 Ga0157372_10284087 3300013307 Bacteria 1924
87 Ga0157375_10009567 3300013308 Bacteria 8510
88 Ga0157375_10062755 3300013308 Bacteria 3693
89 Ga0163163_10184615 3300014325 Bacteria 2133
90 Ga0163163_10534630 3300014325 Bacteria 1235
91 Ga0157379_10175084 3300014968 Bacteria 1937
92 Ga0157376_10021652 3300014969 Bacteria 4996
93 Ga0182006_1013993 3300015261 Bacteria 3465
94 Ga0209051_1000025 3300025303 Bacteria 415397
95 Ga0209257_1000039 3300025304 Bacteria 591694
96 Ga0207656_10076770 3300025321 Bacteria 1495
97 Ga0207645_10010830 3300025907 Bacteria 6249
98 Ga0207705_10046947 3300025909 Bacteria 3105
99 Ga0207705_10052220 3300025909 Bacteria 2942
100 Ga0207657_10055152 3300025919 Bacteria 3434
101 Ga0207657_10073778 3300025919 Bacteria 2882
102 Ga0207657_10156739 3300025919 Bacteria 1851
103 Ga0207649_10010375 3300025920 Bacteria 5116
104 Ga0207649_10029534 3300025920 Bacteria 3238
105 Ga0207649_10058732 3300025920 Bacteria 2410
106 Ga0207694_10018655 3300025924 Bacteria 5245
107 Ga0207694_10088468 3300025924 Bacteria 2441
108 Ga0207650_10001587 3300025925 Bacteria 16225
109 Ga0207659_10331889 3300025926 Bacteria 1258
110 Ga0207644_10100389 3300025931 Bacteria 2173
111 Ga0207690_10070711 3300025932 Bacteria 2405
112 Ga0207706_10060242 3300025933 Bacteria 3342
113 Ga0207706_10135791 3300025933 Bacteria 2164
114 Ga0207706_10198298 3300025933 Bacteria 1761
115 Ga0207686_10037639 3300025934 Bacteria 2921
116 Ga0207691_10000754 3300025940 Bacteria 31954
117 Ga0207691_10003176 3300025940 Bacteria 16059
118 Ga0207691_10092924 3300025940 Bacteria 2702
119 Ga0207691_10149894 3300025940 Bacteria 2051
120 Ga0207661_10034862 3300025944 Bacteria 3917
121 Ga0207679_10012599 3300025945 Bacteria 5518
122 Ga0207679_10094560 3300025945 Bacteria 2321
123 Ga0207679_10174925 3300025945 Bacteria 1771
124 Ga0207640_10188473 3300025981 Bacteria 1553
125 Ga0207658_10034710 3300025986 Bacteria 3607
126 Ga0207639_10391548 3300026041 Bacteria 1250
127 Ga0207678_10000957 3300026067 Bacteria 26396
128 Ga0207678_10074686 3300026067 Bacteria 2905
129 Ga0207702_10022110 3300026078 Bacteria 5270
130 Ga0207702_10040503 3300026078 Bacteria 3905
131 Ga0207641_10076724 3300026088 Bacteria 2890
132 Ga0207676_10016309 3300026095 Bacteria 5379
133 Ga0207676_10086741 3300026095 Bacteria 2558
134 Ga0207674_10091198 3300026116 Bacteria 3038
135 Ga0207683_10001292 3300026121 Bacteria 22631
136 Ga0207683_10067550 3300026121 Bacteria 3154
137 Ga0207683_10143343 3300026121 Bacteria 2153
138 Ga0207698_10099062 3300026142 Bacteria 2410
139 Ga0207698_10145126 3300026142 Bacteria 2051
140 Ga0207698_10153308 3300026142 Unclassified 2003
141 Ga0316180_1042849 3300030736 Bacteria 1780
142 Ga0307405_10098828 3300031731 Bacteria 1952
143 Ga0307410_10090787 3300031852 Bacteria 2167
144 Ga0307412_10037908 3300031911 Bacteria 3100
145 Ga0307416_100003748 3300032002 Bacteria 9020
146 Ga0307416_100065341 3300032002 Bacteria 2989
147 Ga0307416_100084665 3300032002 Bacteria 2695
148 Ga0307411_10062263 3300032005 Bacteria 2488
149 Ga0307415_100002078 3300032126 Bacteria 9898
150 Ga0307415_100149318 3300032126 Bacteria 1796
151 Ga0395899_0001450 3300037312 Bacteria 20237
152 Ga0395899_0032392 3300037312 Bacteria 3926
153 Ga0395900_0001519 3300037418 Bacteria 27557
154 Ga0395900_0012335 3300037418 Bacteria 8743
155 Ga0395900_0018397 3300037418 Bacteria 7125
156 Ga0395900_0106114 3300037418 Bacteria 2885
157 Ga0395900_0327080 3300037418 Bacteria 1512
158 Ga0395898_0001815 3300037466 Bacteria 27567
159 Ga0395898_0005192 3300037466 Bacteria 14085
160 Ga0395898_0086317 3300037466 Bacteria 3024
161 Ga0395898_0212416 3300037466 Bacteria 1846
162 Ga0395898_0343095 3300037466 Bacteria 1424
163 Ga0395905_0014044 3300037471 Bacteria 7657
164 Ga0395905_0016105 3300037471 Bacteria 7107
165 Ga0395905_0018136 3300037471 Bacteria 6679
166 Ga0395905_0079357 3300037471 Bacteria 3077
167 Ga0395905_0092604 3300037471 Bacteria 2834
168 Ga0395905_0103529 3300037471 Bacteria 2672
169 Ga0395905_0223402 3300037471 Bacteria 1762
170 Ga0395905_0259486 3300037471 Bacteria 1622
171 Ga0395901_0019214 3300038443 Bacteria 6985
172 Ga0395901_0066495 3300038443 Bacteria 3754
173 Ga0395901_0084174 3300038443 Bacteria 3324
174 Ga0395901_0421097 3300038443 Bacteria 1369
175 Ga0395901_0542347 3300038443 Bacteria 1179
176 Ga0395901_0853685 3300038443 Bacteria 895
177 Ga0436365_0664769 3300039437 Bacteria 2478
178 Ga0436363_0699812 3300039450 Bacteria 16102
179 Ga0436363_1675970 3300039450 Bacteria 4479
180 Ga0451853_2552061 3300041512 Bacteria 2097
181 Ga0439448_0000792 3300042005 Bacteria 7687
182 Ga0439448_0034789 3300042005 Bacteria 1611
183 Ga0439449_0045784 3300042007 Bacteria 1621
184 Ga0439450_001752 3300042008 Bacteria 3248
185 Ga0439455_0015002 3300042012 Bacteria 1777
186 Ga0439458_0056692 3300042157 Bacteria 973
187 Ga0439464_0007677 3300042439 Bacteria 2823
188 Ga0466969_0004871 3300044656 Bacteria 7150
189 Ga0466969_0007108 3300044656 Bacteria 5956
190 Ga0466969_0053689 3300044656 Bacteria 1976
191 Ga0466972_0008983 3300044658 Bacteria 5016
192 Ga0466965_0040899 3300044683 Bacteria 2282
193 Ga0466965_0046141 3300044683 Bacteria 2156
194 Ga0466966_0002771 3300044684 Bacteria 11520
195 Ga0466966_0004054 3300044684 Bacteria 9669
196 Ga0466966_0010530 3300044684 Bacteria 6144
197 Ga0466966_0026950 3300044684 Bacteria 3748
198 Ga0466961_0002667 3300044693 Bacteria 11070
199 Ga0466961_0021077 3300044693 Bacteria 4195
200 Ga0466961_0031337 3300044693 Bacteria 3417
201 Ga0466963_0111923 3300044694 Bacteria 1875
202 Ga0466964_0005073 3300044706 Bacteria 4871
203 Ga0466964_0127817 3300044706 Bacteria 1153
204 Ga0466971_0026224 3300044719 Bacteria 2603
205 Ga0466971_0033226 3300044719 Bacteria 2311
206 Ga0466968_0000221 3300044735 Bacteria 17709
207 Ga0466968_0008283 3300044735 Bacteria 3977
208 Ga0466970_0015982 3300044765 Bacteria 3864
209 Ga0466957_0014352 3300044842 Bacteria 4612
210 Ga0466957_0015604 3300044842 Bacteria 4437
211 Ga0466957_0023614 3300044842 Bacteria 3635
212 Ga0466957_0074556 3300044842 Bacteria 2104
213 Ga0466957_0104869 3300044842 Bacteria 1786
214 Ga0466960_0024450 3300044901 Bacteria 2725
215 Ga0466960_0050846 3300044901 Bacteria 1999
216 Ga0466959_0002855 3300045049 Bacteria 11139
217 Ga0466959_0022404 3300045049 Bacteria 4670
218 Ga0466959_0074706 3300045049 Bacteria 2450
219 Ga0466959_0241341 3300045049 Bacteria 1248
220 Ga0466958_0157820 3300045836 Bacteria 1432
221 Ga0466967_0098103 3300045976 Bacteria 2675
222 Ga0495617_015456 3300046452 Bacteria 2586
223 Ga0495627_011128 3300046453 Bacteria 3239
224 Ga0495590_0000033 3300046457 Bacteria 133950
225 Ga0495590_0027741 3300046457 Bacteria 1986
226 Ga0495590_0040617 3300046457 Bacteria 1622
227 Ga0495591_000227 3300046458 Bacteria 55251
228 Ga0495650_0002058 3300046471 Bacteria 17484
229 Ga0495580_0063113 3300046472 Bacteria 2599
230 Ga0495605_0000286 3300046474 Bacteria 55733
231 Ga0495605_0014036 3300046474 Bacteria 4395
232 Ga0495605_0029675 3300046474 Bacteria 2810
233 Ga0495584_0000265 3300046491 Bacteria 37425
234 Ga0495584_0000832 3300046491 Bacteria 20131
235 Ga0495584_0136921 3300046491 Bacteria 1243
236 Ga0495584_0146522 3300046491 Bacteria 1199
237 Ga0495585_0000815 3300046492 Bacteria 27025
238 Ga0495585_0047222 3300046492 Bacteria 2398
239 Ga0495585_0055112 3300046492 Bacteria 2197
240 Ga0495585_0073593 3300046492 Bacteria 1860
241 Ga0495596_0000988 3300046500 Bacteria 16884
242 Ga0495596_0011018 3300046500 Bacteria 3914
243 Ga0495596_0028739 3300046500 Bacteria 2230
244 Ga0495607_0002593 3300046501 Bacteria 14552
245 Ga0495607_0003088 3300046501 Bacteria 12943
246 Ga0495607_0005225 3300046501 Bacteria 9342
247 Ga0495607_0041340 3300046501 Bacteria 2740
248 Ga0495583_0000658 3300046506 Bacteria 45286
249 Ga0495583_0000885 3300046506 Bacteria 35926
250 Ga0495583_0012855 3300046506 Bacteria 4709
251 Ga0495583_0054423 3300046506 Bacteria 1812
252 Ga0495606_0069400 3300046507 Bacteria 2226
253 Ga0495606_0168312 3300046507 Bacteria 1273
254 Ga0495610_0000627 3300046512 Bacteria 34979
255 Ga0495616_0000957 3300046513 Bacteria 20701
256 Ga0495616_0046068 3300046513 Bacteria 2203
257 Ga0495616_0054005 3300046513 Bacteria 1994
258 Ga0495616_0054409 3300046513 Bacteria 1985
259 Ga0495631_0030871 3300046518 Bacteria 2428
260 Ga0495631_0036980 3300046518 Bacteria 2176
261 Ga0495631_0081230 3300046518 Bacteria 1398
262 Ga0495632_0000741 3300046519 Bacteria 29455
263 Ga0495632_0084982 3300046519 Bacteria 1505
264 Ga0495637_0001711 3300046520 Bacteria 12628
265 Ga0495637_0032189 3300046520 Bacteria 2312
266 Ga0495637_0082126 3300046520 Bacteria 1283
267 Ga0495643_0001326 3300046522 Bacteria 23389
268 Ga0495643_0011287 3300046522 Bacteria 5451
269 Ga0495643_0018357 3300046522 Bacteria 4067
270 Ga0495644_0082063 3300046523 Bacteria 1215
271 Ga0495648_0004371 3300046524 Bacteria 12091
272 Ga0495648_0009998 3300046524 Bacteria 7275
273 Ga0495648_0043075 3300046524 Bacteria 2833
274 Ga0495642_0002374 3300046528 Bacteria 7674
275 Ga0495642_0013798 3300046528 Bacteria 3130
276 Ga0495642_0031247 3300046528 Bacteria 2134
277 Ga0495609_0002859 3300046538 Bacteria 10323
278 Ga0495597_0000142 3300046542 Bacteria 64212
279 Ga0495597_0000458 3300046542 Bacteria 34880
280 Ga0495633_0005025 3300046558 Bacteria 8243
281 Ga0495633_0031778 3300046558 Bacteria 2555
282 Ga0495668_0001346 3300046616 Bacteria 24143
283 Ga0495668_0030417 3300046616 Bacteria 3048
284 Ga0495611_0000071 3300046648 Bacteria 70920
285 Ga0495611_0017879 3300046648 Bacteria 3037
286 Ga0495611_0087022 3300046648 Bacteria 1442
287 Ga0495661_0000856 3300046665 Bacteria 28337
288 Ga0495661_0001692 3300046665 Bacteria 17879
289 Ga0495661_0051607 3300046665 Bacteria 2482
290 Ga0495661_0109561 3300046665 Bacteria 1541
291 Ga0495661_0194953 3300046665 Bacteria 1064
292 Ga0495588_0000147 3300046674 Bacteria 100948
293 Ga0495669_0002148 3300046684 Bacteria 8098
294 Ga0495669_0131203 3300046684 Bacteria 1179
295 Ga0495670_0067491 3300046691 Bacteria 1805
296 Ga0495670_0098636 3300046691 Bacteria 1502
297 Ga0495671_0007119 3300046692 Bacteria 6405
298 Ga0495671_0007121 3300046692 Bacteria 6405
299 Ga0495649_0013889 3300046694 Bacteria 4631
300 Ga0495649_0014005 3300046694 Bacteria 4611
301 Ga0495649_0060221 3300046694 Bacteria 2043
302 Ga0495589_0000359 3300046794 Bacteria 35371
303 Ga0495589_0000984 3300046794 Bacteria 17340
304 Ga0495589_0005901 3300046794 Bacteria 6465
305 Ga0495589_0019088 3300046794 Bacteria 3517
306 Ga0495660_0000299 3300046810 Bacteria 45148
307 Ga0495660_0004605 3300046810 Bacteria 8319
308 Ga0495660_0011438 3300046810 Bacteria 5149
309 Ga0495660_0023720 3300046810 Bacteria 3499
310 Ga0495672_0000148 3300047320 Bacteria 101427
311 Ga0495672_0000681 3300047320 Bacteria 37887
312 Ga0495672_0001124 3300047320 Bacteria 27126
313 Ga0495683_0000104 3300047323 Bacteria 87180
314 Ga0495683_0076492 3300047323 Bacteria 1637
315 Ga0495687_000103 3300047443 Bacteria 128840
316 Ga0495687_000269 3300047443 Bacteria 69487
317 Ga0495687_001224 3300047443 Bacteria 24532
318 Ga0495687_002431 3300047443 Bacteria 14975
319 Ga0495687_028425 3300047443 Bacteria 2601
320 Ga0495677_0001070 3300047445 Bacteria 10985
321 Ga0495677_0001757 3300047445 Bacteria 8680
322 Ga0495677_0037745 3300047445 Bacteria 1765
323 Ga0495677_0050776 3300047445 Bacteria 1526
324 Ga0495681_0000222 3300047470 Bacteria 47335
325 Ga0495681_0000945 3300047470 Bacteria 22298
326 Ga0495681_0006762 3300047470 Bacteria 7463
327 Ga0495686_0000109 3300047472 Bacteria 171482
328 Ga0495626_0000022 3300048091 Bacteria 216166
329 Ga0495626_0002918 3300048091 Bacteria 11392
330 Ga0495626_0004836 3300048091 Bacteria 8113
331 Ga0495626_0008768 3300048091 Bacteria 5504
332 Ga0495626_0020270 3300048091 Bacteria 3315
333 Ga0495626_0030303 3300048091 Bacteria 2609
334 Ga0496100_0051352 3300048903 Bacteria 2676
335 Ga0496101_0008831 3300048904 Bacteria 6594
336 Ga0496102_0280398 3300048905 Bacteria 1571
337 Ga0496102_0345876 3300048905 Bacteria 1400
338 Ga0496106_0029114 3300048909 Bacteria 4115
339 Ga0496106_0193469 3300048909 Bacteria 1618
340 Ga0496107_0048787 3300048910 Bacteria 3051
341 Ga0496109_0024456 3300048912 Bacteria 5370
342 Ga0496110_0000009 3300048913 Bacteria 111367
343 Ga0496113_0022606 3300048916 Bacteria 4451
344 Ga0496114_0038688 3300048917 Bacteria 3947
345 Ga0496122_0000127 3300048925 Bacteria 178260
346 Ga0496122_0015692 3300048925 Bacteria 7223
347 Ga0496123_0000084 3300048926 Bacteria 187479
348 Ga0496123_0002734 3300048926 Bacteria 21142
349 Ga0496124_0002142 3300048927 Bacteria 26508
350 Ga0496124_0010320 3300048927 Bacteria 9477
351 Ga0496124_0061762 3300048927 Bacteria 3139
352 Ga0496124_0098181 3300048927 Bacteria 2377
353 Ga0496124_0113072 3300048927 Bacteria 2182
354 Ga0496124_0154753 3300048927 Bacteria 1794
355 Ga0496125_0005968 3300048928 Bacteria 13334
356 Ga0495678_000164 3300049459 Bacteria 77961
357 Ga0495678_001077 3300049459 Bacteria 23045
358 Ga0495678_001800 3300049459 Bacteria 15832
359 Ga0495682_0001590 3300049460 Bacteria 11799
360 Ga0495682_0019565 3300049460 Bacteria 2545
361 Ga0495682_0063142 3300049460 Bacteria 1336
362 Ga0501036_0400271 3300049572 Bacteria 1145
363 nmdc:mga0yw44_25846_c1 3300050492 Bacteria 3345
364 Ga0466962_0042190 3300061719 Bacteria 2183
365 Ga0466962_0104196 3300061719 Bacteria 1363
366 2643801241 2643221556 Bacteria 7251154
367 2644471659 2643221684 Bacteria 7145183
368 2809145712 2808606418 Bacteria 6724496
369 8047675925 8047673197 Bacteria 7395230
370 Ga0395905_0000047
371 rootH2_10095379
372 rootL2_10097028
373 rootH1_10185502
374 Ga0055540_1003419
375 Ga0055531_10001478
376 Ga0065165_1001064
377 Ga0065165_1016020
378 Ga0070658_10144944
379 Ga0070683_100071610
380 Ga0070683_100258991
381 Ga0070683_100367566
382 Ga0070670_100000750
383 Ga0070670_100135580
384 Ga0070670_100139467
385 Ga0070670_100280252
386 Ga0070677_10019822
387 Ga0068869_100100403
388 Ga0070666_10048206
389 Ga0070680_100003443
390 Ga0070660_100033946
391 Ga0070660_100053906
392 Ga0070660_100122069
393 Ga0070661_100005359
394 Ga0070661_100010340
395 Ga0070661_100234347
396 Ga0070675_100007253
397 Ga0070675_100240487
398 Ga0070671_100028742
399 Ga0070673_100009011
400 Ga0070659_100017857
401 Ga0070659_100027646
402 Ga0070659_100073029
403 Ga0070663_100235073
404 Ga0070663_100274206
405 Ga0070678_100042708
406 Ga0070678_100070056
407 Ga0070681_10104439
408 Ga0070684_100028579
409 Ga0070684_100039404
410 Ga0070684_100145034
411 Ga0070672_100000880
412 Ga0070672_100025022
413 Ga0070672_100091975
414 Ga0070672_100196517
415 Ga0070693_100034370
416 Ga0070664_100014650
417 Ga0070664_100018411
418 Ga0070664_100048045
419 Ga0070664_100120727
420 Ga0068857_100061592
421 Ga0068854_100001471
422 Ga0068854_100099263
423 Ga0068854_100126264
424 Ga0068856_100015864
425 Ga0068852_100041928
426 Ga0068852_100094402
427 Ga0068852_100097039
428 Ga0068852_100126672
429 Ga0068864_100005560
430 Ga0068864_100019644
431 Ga0068864_100181638
432 Ga0068851_10010485
433 Ga0068870_10104965
434 Ga0068863_100141364
435 Ga0075365_10124557
436 Ga0075365_10249998
437 Ga0068871_100043775
438 Ga0068871_100141836
439 Ga0105242_10008295
440 Ga0105242_10106166
441 Ga0105248_10030665
442 Ga0105248_10056747
443 Ga0105248_10444845
444 Ga0105238_10023224
445 Ga0157373_10009281
446 Ga0157371_10000001
447 Ga0157371_10120695
448 Ga0157369_10023408
449 Ga0157369_10118031
450 Ga0157369_10447009
451 Ga0157374_10062768
452 Ga0157374_10190483
453 Ga0157374_10336067
454 Ga0157372_10119772
455 Ga0157372_10284087
456 Ga0157375_10009567
457 Ga0157375_10062755
458 Ga0163163_10184615
459 Ga0163163_10534630
460 Ga0157379_10175084
461 Ga0157376_10021652
462 Ga0182006_1013993
463 Ga0209051_1000025
464 Ga0209257_1000039
465 Ga0207656_10076770
466 Ga0207645_10010830
467 Ga0207705_10046947
468 Ga0207705_10052220
469 Ga0207657_10055152
470 Ga0207657_10073778
471 Ga0207657_10156739
472 Ga0207649_10010375
473 Ga0207649_10029534
474 Ga0207649_10058732
475 Ga0207694_10018655
476 Ga0207694_10088468
477 Ga0207650_10001587
478 Ga0207659_10331889
479 Ga0207644_10100389
480 Ga0207690_10070711
481 Ga0207706_10060242
482 Ga0207706_10135791
483 Ga0207706_10198298
484 Ga0207686_10037639
485 Ga0207691_10000754
486 Ga0207691_10003176
487 Ga0207691_10092924
488 Ga0207691_10149894
489 Ga0207661_10034862
490 Ga0207679_10012599
491 Ga0207679_10094560
492 Ga0207679_10174925
493 Ga0207640_10188473
494 Ga0207658_10034710
495 Ga0207639_10391548
496 Ga0207678_10000957
497 Ga0207678_10074686
498 Ga0207702_10022110
499 Ga0207702_10040503
500 Ga0207641_10076724
501 Ga0207676_10016309
502 Ga0207676_10086741
503 Ga0207674_10091198
504 Ga0207683_10001292
505 Ga0207683_10067550
506 Ga0207683_10143343
507 Ga0207698_10099062
508 Ga0207698_10145126
509 Ga0207698_10153308
510 Ga0316180_1042849
511 Ga0307405_10098828
512 Ga0307410_10090787
513 Ga0307412_10037908
514 Ga0307416_100003748
515 Ga0307416_100065341
516 Ga0307416_100084665
517 Ga0307411_10062263
518 Ga0307415_100002078
519 Ga0307415_100149318
520 Ga0395899_0001450
521 Ga0395899_0032392
522 Ga0395900_0001519
523 Ga0395900_0012335
524 Ga0395900_0018397
525 Ga0395900_0106114
526 Ga0395900_0327080
527 Ga0395898_0001815
528 Ga0395898_0005192
529 Ga0395898_0086317
530 Ga0395898_0212416
531 Ga0395898_0343095
532 Ga0395905_0014044
533 Ga0395905_0016105
534 Ga0395905_0018136
535 Ga0395905_0079357
536 Ga0395905_0092604
537 Ga0395905_0103529
538 Ga0395905_0223402
539 Ga0395905_0259486
540 Ga0395901_0019214
541 Ga0395901_0066495
542 Ga0395901_0084174
543 Ga0395901_0421097
544 Ga0395901_0542347
545 Ga0395901_0853685
546 Ga0436365_0664769
547 Ga0436363_0699812
548 Ga0436363_1675970
549 Ga0451853_2552061
550 Ga0439448_0000792
551 Ga0439448_0034789
552 Ga0439449_0045784
553 Ga0439450_001752
554 Ga0439455_0015002
555 Ga0439458_0056692
556 Ga0439464_0007677
557 Ga0466969_0004871
558 Ga0466969_0007108
559 Ga0466969_0053689
560 Ga0466972_0008983
561 Ga0466965_0040899
562 Ga0466965_0046141
563 Ga0466966_0002771
564 Ga0466966_0004054
565 Ga0466966_0010530
566 Ga0466966_0026950
567 Ga0466961_0002667
568 Ga0466961_0021077
569 Ga0466961_0031337
570 Ga0466963_0111923
571 Ga0466964_0005073
572 Ga0466964_0127817
573 Ga0466971_0026224
574 Ga0466971_0033226
575 Ga0466968_0000221
576 Ga0466968_0008283
577 Ga0466970_0015982
578 Ga0466957_0014352
579 Ga0466957_0015604
580 Ga0466957_0023614
581 Ga0466957_0074556
582 Ga0466957_0104869
583 Ga0466960_0024450
584 Ga0466960_0050846
585 Ga0466959_0002855
586 Ga0466959_0022404
587 Ga0466959_0074706
588 Ga0466959_0241341
589 Ga0466958_0157820
590 Ga0466967_0098103
591 Ga0495617_015456
592 Ga0495627_011128
593 Ga0495590_0000033
594 Ga0495590_0027741
595 Ga0495590_0040617
596 Ga0495591_000227
597 Ga0495650_0002058
598 Ga0495580_0063113
599 Ga0495605_0000286
600 Ga0495605_0014036
601 Ga0495605_0029675
602 Ga0495584_0000265
603 Ga0495584_0000832
604 Ga0495584_0136921
605 Ga0495584_0146522
606 Ga0495585_0000815
607 Ga0495585_0047222
608 Ga0495585_0055112
609 Ga0495585_0073593
610 Ga0495596_0000988
611 Ga0495596_0011018
612 Ga0495596_0028739
613 Ga0495607_0002593
614 Ga0495607_0003088
615 Ga0495607_0005225
616 Ga0495607_0041340
617 Ga0495583_0000658
618 Ga0495583_0000885
619 Ga0495583_0012855
620 Ga0495583_0054423
621 Ga0495606_0069400
622 Ga0495606_0168312
623 Ga0495610_0000627
624 Ga0495616_0000957
625 Ga0495616_0046068
626 Ga0495616_0054005
627 Ga0495616_0054409
628 Ga0495631_0030871
629 Ga0495631_0036980
630 Ga0495631_0081230
631 Ga0495632_0000741
632 Ga0495632_0084982
633 Ga0495637_0001711
634 Ga0495637_0032189
635 Ga0495637_0082126
636 Ga0495643_0001326
637 Ga0495643_0011287
638 Ga0495643_0018357
639 Ga0495644_0082063
640 Ga0495648_0004371
641 Ga0495648_0009998
642 Ga0495648_0043075
643 Ga0495642_0002374
644 Ga0495642_0013798
645 Ga0495642_0031247
646 Ga0495609_0002859
647 Ga0495597_0000142
648 Ga0495597_0000458
649 Ga0495633_0005025
650 Ga0495633_0031778
651 Ga0495668_0001346
652 Ga0495668_0030417
653 Ga0495611_0000071
654 Ga0495611_0017879
655 Ga0495611_0087022
656 Ga0495661_0000856
657 Ga0495661_0001692
658 Ga0495661_0051607
659 Ga0495661_0109561
660 Ga0495661_0194953
661 Ga0495588_0000147
662 Ga0495669_0002148
663 Ga0495669_0131203
664 Ga0495670_0067491
665 Ga0495670_0098636
666 Ga0495671_0007119
667 Ga0495671_0007121
668 Ga0495649_0013889
669 Ga0495649_0014005
670 Ga0495649_0060221
671 Ga0495589_0000359
672 Ga0495589_0000984
673 Ga0495589_0005901
674 Ga0495589_0019088
675 Ga0495660_0000299
676 Ga0495660_0004605
677 Ga0495660_0011438
678 Ga0495660_0023720
679 Ga0495672_0000148
680 Ga0495672_0000681
681 Ga0495672_0001124
682 Ga0495683_0000104
683 Ga0495683_0076492
684 Ga0495687_000103
685 Ga0495687_000269
686 Ga0495687_001224
687 Ga0495687_002431
688 Ga0495687_028425
689 Ga0495677_0001070
690 Ga0495677_0001757
691 Ga0495677_0037745
692 Ga0495677_0050776
693 Ga0495681_0000222
694 Ga0495681_0000945
695 Ga0495681_0006762
696 Ga0495686_0000109
697 Ga0495626_0000022
698 Ga0495626_0002918
699 Ga0495626_0004836
700 Ga0495626_0008768
701 Ga0495626_0020270
702 Ga0495626_0030303
703 Ga0496100_0051352
704 Ga0496101_0008831
705 Ga0496102_0280398
706 Ga0496102_0345876
707 Ga0496106_0029114
708 Ga0496106_0193469
709 Ga0496107_0048787
710 Ga0496109_0024456
711 Ga0496110_0000009
712 Ga0496113_0022606
713 Ga0496114_0038688
714 Ga0496122_0000127
715 Ga0496122_0015692
716 Ga0496123_0000084
717 Ga0496123_0002734
718 Ga0496124_0002142
719 Ga0496124_0010320
720 Ga0496124_0061762
721 Ga0496124_0098181
722 Ga0496124_0113072
723 Ga0496124_0154753
724 Ga0496125_0005968
725 Ga0495678_000164
726 Ga0495678_001077
727 Ga0495678_001800
728 Ga0495682_0001590
729 Ga0495682_0019565
730 Ga0495682_0063142
731 Ga0501036_0400271
732 nmdc:mga0yw44_25846_c1
733 Ga0466962_0042190
734 Ga0466962_0104196
735 2643801241
736 2644471659
737 2809145712
738 8047675925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

158

241

0.94

PF00034

Cytochrom_C

Cytochrome c

266

356

0.82

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

264

352

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.9252 125 238
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.9114 127 227
4w9z-assembly1.cif.gz_A crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum 0.9077 126 240
2cua-assembly1.cif.gz_A the cua domain of cytochrome ba3 from thermus thermophilus 0.9066 127 227
2cua-assembly2.cif.gz_B the cua domain of cytochrome ba3 from thermus thermophilus 0.9039 127 227
ID Description Score Start End Superfamily
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9318 154 234 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.931 153 235 2.60.40.420
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9251 125 238 2.60.40.420
af_A0A2P2CLF0_113_253_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9191 125 239 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9064 127 227 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A435FGA7-F1-model_v4 Cytochrome c oxidase subunit II 0.9616 157 236 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A0F3NAB0-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) 0.9529 154 240 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-K2DQG4-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.946 153 238 GO:0004129
GO:0005507
GO:0009486
GO:0016020
GO:0042773
AF-A0A3S2C292-F1-model_v4 Cytochrome ubiquinol oxidase subunit II 0.9403 125 238 GO:0004129
GO:0005507
GO:0005886
GO:0009486
GO:0042773
AF-A0A435FGA7-F1-model_v4 Cytochrome c oxidase subunit II 0.9389 157 236 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Map