F425079

General Info

Members Datasets Scaffolds Average Seq Length
369 147 738 331

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10000789|Ga0265338_1000078935
Length 367
Sequence MLAASWSSNFSLFGVCLSWDSRKLTLELQPLTMETILLLAHTEADGSLGKAALEALGAAKSLNAALAGSAWLVGLVGEKIQPAADQIAGCGAAKFLGVAGKDFAPSRYATDAAAAEALCKAAGATLVIAPGTSRFARCLAGMAQRLGGRVDTHVTGVAAPDGKVAVNRWYYRQRMEAALSRAQRPWFIVIDPGSQPAWQGAPGTAAVEAVAVTLPDSAKRTTVTGVRAPAADAQTIRPDAQLLFVTGAGWTKKQADGQTHVPEAEKIIREFLKVGRASLGSSKSLVDLGGEGQAILPFLSHLPRHPKGLSTCCHGEEPHTVGWRFINERRAISLDPNCGWARGKADVLYVADAFAVMGKVNELLAAK

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
73 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.37
Stem 0
Stem Tuber 0
Unclassified 8.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10000789 3300028800 Bacteria 53624
2 rootH1_10219044 3300003323 Bacteria 1406
3 Ga0070683_100000026 3300005329 Bacteria 172308
4 Ga0070683_100106757 3300005329 Bacteria 2640
5 Ga0070680_100009538 3300005336 Bacteria 7456
6 Ga0070660_100010134 3300005339 Bacteria 6651
7 Ga0070661_100107685 3300005344 Bacteria 2079
8 Ga0070675_100035418 3300005354 Bacteria 4056
9 Ga0070709_10000267 3300005434 Bacteria 33492
10 Ga0070709_10086606 3300005434 Bacteria 2057
11 Ga0070714_100001263 3300005435 Bacteria 18267
12 Ga0070714_100369457 3300005435 Unclassified 1350
13 Ga0070713_100000094 3300005436 Bacteria 57097
14 Ga0070713_100003077 3300005436 Bacteria 10965
15 Ga0070713_100014155 3300005436 Bacteria 5911
16 Ga0070713_100055503 3300005436 Bacteria 3292
17 Ga0070710_10018674 3300005437 Bacteria 3571
18 Ga0070710_10027495 3300005437 Bacteria 3034
19 Ga0070711_100000240 3300005439 Bacteria 28145
20 Ga0070711_100004372 3300005439 Bacteria 8326
21 Ga0070711_100006620 3300005439 Bacteria 7000
22 Ga0070662_100052314 3300005457 Bacteria 2951
23 Ga0070681_10001126 3300005458 Bacteria 22953
24 Ga0070679_100043017 3300005530 Bacteria 4499
25 Ga0070679_100416191 3300005530 Bacteria 1289
26 Ga0070684_100000012 3300005535 Bacteria 167850
27 Ga0068853_100234690 3300005539 Unclassified 1679
28 Ga0068855_100008795 3300005563 Bacteria 12205
29 Ga0068855_100044214 3300005563 Bacteria 5272
30 Ga0068855_100058817 3300005563 Bacteria 4499
31 Ga0068855_100087243 3300005563 Bacteria 3607
32 Ga0068855_100087460 3300005563 Unclassified 3601
33 Ga0068855_100162780 3300005563 Bacteria 2531
34 Ga0068852_100027078 3300005616 Bacteria 4668
35 Ga0068864_100220512 3300005618 Bacteria 1750
36 Ga0068863_100068396 3300005841 Bacteria 3360
37 Ga0070717_10077425 3300006028 Bacteria 2784
38 Ga0070717_10190470 3300006028 Bacteria 1792
39 Ga0070715_10016960 3300006163 Unclassified 2747
40 Ga0070716_100007858 3300006173 Bacteria 5276
41 Ga0070716_100158141 3300006173 Unclassified 1465
42 Ga0070712_100000163 3300006175 Bacteria 36018
43 Ga0070712_100040975 3300006175 Bacteria 3177
44 Ga0070712_100174088 3300006175 Bacteria 1672
45 Ga0068865_100124092 3300006881 Unclassified 1925
46 Ga0105240_10000480 3300009093 Bacteria 73703
47 Ga0105240_10001244 3300009093 Bacteria 44183
48 Ga0105240_10140023 3300009093 Unclassified 2893
49 Ga0105240_10252951 3300009093 Unclassified 2036
50 Ga0105240_10263902 3300009093 Bacteria 1986
51 Ga0105248_10031417 3300009177 Bacteria 5936
52 Ga0105248_10523982 3300009177 Bacteria 1336
53 Ga0105248_10576120 3300009177 Unclassified 1270
54 Ga0105238_10001519 3300009551 Bacteria 23247
55 Ga0105238_10094726 3300009551 Bacteria 2974
56 Ga0105239_10463669 3300010375 Bacteria 1438
57 Ga0157371_10027189 3300013102 Bacteria 4151
58 Ga0157370_10037285 3300013104 Bacteria 4713
59 Ga0157370_10272421 3300013104 Unclassified 1564
60 Ga0157369_10004443 3300013105 Bacteria 16534
61 Ga0157369_10016885 3300013105 Bacteria 8203
62 Ga0157369_10117357 3300013105 Bacteria 2825
63 Ga0157369_10129399 3300013105 Bacteria 2676
64 Ga0157374_10255360 3300013296 Bacteria 1725
65 Ga0157372_10000581 3300013307 Bacteria 39954
66 Ga0157372_10224240 3300013307 Bacteria 2179
67 Ga0157372_10284452 3300013307 Unclassified 1923
68 Ga0163163_10028986 3300014325 Bacteria 5322
69 Ga0163163_10408396 3300014325 Bacteria 1416
70 Ga0163163_10438506 3300014325 Bacteria 1366
71 Ga0163163_10502635 3300014325 Bacteria 1274
72 Ga0157379_10017328 3300014968 Bacteria 6347
73 Ga0157376_10059491 3300014969 Bacteria 3203
74 Ga0163161_10025447 3300017792 Bacteria 4188
75 Ga0207692_10043563 3300025898 Bacteria 2234
76 Ga0207647_10014446 3300025904 Bacteria 5442
77 Ga0207685_10061711 3300025905 Unclassified 1487
78 Ga0207699_10007006 3300025906 Bacteria 5491
79 Ga0207707_10004693 3300025912 Bacteria 11999
80 Ga0207695_10001781 3300025913 Bacteria 33978
81 Ga0207695_10048591 3300025913 Bacteria 4480
82 Ga0207695_10060087 3300025913 Unclassified 3937
83 Ga0207695_10161903 3300025913 Bacteria 2169
84 Ga0207693_10000061 3300025915 Bacteria 92703
85 Ga0207693_10005155 3300025915 Bacteria 10938
86 Ga0207663_10000900 3300025916 Bacteria 13557
87 Ga0207663_10005474 3300025916 Bacteria 6399
88 Ga0207660_10007894 3300025917 Bacteria 6888
89 Ga0207657_10010018 3300025919 Bacteria 9481
90 Ga0207652_10013526 3300025921 Bacteria 6601
91 Ga0207694_10014687 3300025924 Bacteria 5904
92 Ga0207700_10004998 3300025928 Bacteria 7884
93 Ga0207700_10009677 3300025928 Bacteria 6035
94 Ga0207700_10058934 3300025928 Bacteria 2902
95 Ga0207664_10050516 3300025929 Bacteria 3279
96 Ga0207664_10256278 3300025929 Unclassified 1529
97 Ga0207706_10003046 3300025933 Bacteria 16157
98 Ga0207670_10039650 3300025936 Bacteria 3086
99 Ga0207704_10251284 3300025938 Bacteria 1327
100 Ga0207665_10015927 3300025939 Bacteria 4936
101 Ga0207665_10151243 3300025939 Bacteria 1663
102 Ga0207711_10093524 3300025941 Bacteria 2648
103 Ga0207661_10000003 3300025944 Bacteria 611941
104 Ga0207667_10000059 3300025949 Bacteria 192543
105 Ga0207667_10222527 3300025949 Bacteria 1934
106 Ga0207641_10056350 3300026088 Bacteria 3340
107 Ga0207674_10019461 3300026116 Bacteria 7351
108 Ga0207683_10023334 3300026121 Bacteria 5321
109 Ga0268266_10099596 3300028379 Bacteria 2559
110 Ga0265337_1000188 3300028556 Bacteria 32521
111 Ga0265337_1000324 3300028556 Bacteria 25503
112 Ga0265337_1002557 3300028556 Bacteria 8282
113 Ga0265326_10019950 3300028558 Bacteria 1924
114 Ga0265326_10027522 3300028558 Bacteria 1621
115 Ga0265334_10000960 3300028573 Bacteria 14351
116 Ga0265334_10001402 3300028573 Bacteria 11601
117 Ga0265334_10008001 3300028573 Bacteria 4514
118 Ga0265334_10043456 3300028573 Unclassified 1748
119 Ga0265318_10008245 3300028577 Bacteria 4652
120 Ga0265318_10055602 3300028577 Bacteria 1481
121 Ga0265323_10000084 3300028653 Bacteria 53536
122 Ga0265323_10000536 3300028653 Bacteria 21048
123 Ga0265323_10000688 3300028653 Bacteria 18398
124 Ga0265323_10003780 3300028653 Bacteria 6601
125 Ga0265323_10005153 3300028653 Bacteria 5566
126 Ga0265323_10009732 3300028653 Bacteria 3914
127 Ga0265323_10010701 3300028653 Bacteria 3712
128 Ga0265323_10018891 3300028653 Bacteria 2663
129 Ga0265323_10019360 3300028653 Bacteria 2625
130 Ga0265323_10024054 3300028653 Bacteria 2318
131 Ga0265322_10013144 3300028654 Bacteria 2396
132 Ga0265322_10013957 3300028654 Bacteria 2325
133 Ga0265336_10000240 3300028666 Bacteria 39084
134 Ga0265336_10010484 3300028666 Bacteria 3173
135 Ga0265336_10024711 3300028666 Bacteria 1896
136 Ga0265338_10000237 3300028800 Bacteria 101850
137 Ga0265338_10000556 3300028800 Bacteria 65347
138 Ga0265338_10000810 3300028800 Bacteria 52720
139 Ga0265338_10001290 3300028800 Bacteria 41054
140 Ga0265338_10001431 3300028800 Bacteria 38817
141 Ga0265338_10003283 3300028800 Bacteria 22957
142 Ga0265338_10004396 3300028800 Bacteria 19066
143 Ga0265338_10006143 3300028800 Bacteria 15415
144 Ga0265338_10008146 3300028800 Bacteria 12788
145 Ga0265338_10010139 3300028800 Bacteria 11113
146 Ga0265338_10010928 3300028800 Bacteria 10553
147 Ga0265338_10023748 3300028800 Bacteria 6289
148 Ga0265338_10024129 3300028800 Bacteria 6224
149 Ga0265338_10026625 3300028800 Bacteria 5825
150 Ga0265338_10035847 3300028800 Bacteria 4758
151 Ga0265338_10054616 3300028800 Bacteria 3559
152 Ga0265338_10062938 3300028800 Bacteria 3239
153 Ga0265338_10098643 3300028800 Bacteria 2389
154 Ga0265338_10112097 3300028800 Bacteria 2194
155 Ga0265338_10113204 3300028800 Bacteria 2180
156 Ga0265338_10113498 3300028800 Bacteria 2176
157 Ga0265324_10000475 3300029957 Bacteria 28206
158 Ga0265324_10000734 3300029957 Bacteria 21854
159 Ga0265324_10008241 3300029957 Bacteria 4154
160 Ga0265324_10014294 3300029957 Bacteria 2941
161 Ga0265324_10049010 3300029957 Bacteria 1453
162 Ga0265324_10051270 3300029957 Bacteria 1418
163 Ga0265330_10000180 3300031235 Bacteria 48901
164 Ga0265330_10002956 3300031235 Bacteria 9051
165 Ga0265330_10022078 3300031235 Bacteria 2900
166 Ga0265330_10034021 3300031235 Bacteria 2277
167 Ga0265330_10045472 3300031235 Bacteria 1936
168 Ga0265330_10053910 3300031235 Bacteria 1759
169 Ga0265330_10075842 3300031235 Bacteria 1452
170 Ga0265330_10114899 3300031235 Bacteria 1148
171 Ga0265332_10026735 3300031238 Bacteria 2530
172 Ga0265332_10069502 3300031238 Unclassified 1501
173 Ga0265328_10011808 3300031239 Unclassified 3484
174 Ga0265328_10080415 3300031239 Bacteria 1201
175 Ga0265320_10000188 3300031240 Bacteria 51229
176 Ga0265320_10000816 3300031240 Bacteria 23497
177 Ga0265320_10009797 3300031240 Bacteria 5746
178 Ga0265320_10045897 3300031240 Bacteria 2144
179 Ga0265320_10051024 3300031240 Bacteria 2009
180 Ga0265325_10000086 3300031241 Bacteria 64912
181 Ga0265325_10011002 3300031241 Bacteria 5210
182 Ga0265325_10063719 3300031241 Bacteria 1865
183 Ga0265325_10067285 3300031241 Bacteria 1805
184 Ga0265329_10028942 3300031242 Bacteria 1814
185 Ga0265340_10005762 3300031247 Bacteria 6849
186 Ga0265340_10041705 3300031247 Bacteria 2255
187 Ga0265339_10079087 3300031249 Bacteria 1740
188 Ga0265339_10097036 3300031249 Unclassified 1538
189 Ga0265331_10015387 3300031250 Unclassified 4040
190 Ga0265331_10034859 3300031250 Bacteria 2480
191 Ga0265327_10014147 3300031251 Bacteria 5238
192 Ga0265327_10020540 3300031251 Bacteria 4019
193 Ga0265316_10003058 3300031344 Bacteria 17083
194 Ga0265316_10003587 3300031344 Bacteria 15644
195 Ga0265316_10006908 3300031344 Bacteria 10767
196 Ga0265316_10012932 3300031344 Bacteria 7448
197 Ga0265316_10019314 3300031344 Bacteria 5832
198 Ga0265316_10020951 3300031344 Bacteria 5550
199 Ga0265316_10023806 3300031344 Bacteria 5142
200 Ga0265316_10030617 3300031344 Bacteria 4408
201 Ga0265316_10033205 3300031344 Unclassified 4205
202 Ga0265316_10055430 3300031344 Bacteria 3100
203 Ga0265316_10057410 3300031344 Bacteria 3035
204 Ga0265316_10064716 3300031344 Bacteria 2832
205 Ga0265316_10067477 3300031344 Bacteria 2766
206 Ga0265316_10071883 3300031344 Bacteria 2666
207 Ga0265316_10093140 3300031344 Bacteria 2296
208 Ga0265316_10093804 3300031344 Bacteria 2287
209 Ga0265316_10125013 3300031344 Unclassified 1940
210 Ga0265316_10145206 3300031344 Bacteria 1779
211 Ga0265316_10178016 3300031344 Bacteria 1584
212 Ga0265316_10202587 3300031344 Bacteria 1470
213 Ga0265316_10203688 3300031344 Bacteria 1466
214 Ga0265313_10009943 3300031595 Bacteria 6105
215 Ga0265313_10012004 3300031595 Bacteria 5338
216 Ga0265314_10000047 3300031711 Bacteria 194061
217 Ga0265314_10000148 3300031711 Bacteria 105207
218 Ga0265314_10000509 3300031711 Bacteria 50279
219 Ga0265314_10046677 3300031711 Bacteria 3054
220 Ga0265314_10069525 3300031711 Unclassified 2362
221 Ga0265342_10000208 3300031712 Bacteria 66250
222 Ga0265342_10005582 3300031712 Bacteria 9538
223 Ga0265342_10037262 3300031712 Bacteria 2966
224 Ga0265342_10075413 3300031712 Bacteria 1957
225 Ga0265342_10145591 3300031712 Bacteria 1319
226 Ga0307410_10330507 3300031852 Bacteria 1212
227 Ga0307409_100004569 3300031995 Bacteria 7803
228 Ga0373934_0011219 3300035086 Bacteria 3372
229 Ga0373923_0066890 3300035111 Bacteria 1536
230 Ga0373953_0010066 3300035117 Bacteria 3278
231 Ga0373953_0042549 3300035117 Bacteria 1811
232 Ga0373954_0000962 3300035118 Bacteria 11283
233 Ga0373956_0007296 3300035119 Bacteria 4451
234 Ga0373955_0001485 3300035172 Bacteria 9973
235 Ga0316574_0055558 3300035398 Bacteria 2475
236 Ga0373931_0219174 3300035691 Bacteria 1145
237 Ga0373935_0020604 3300035692 Bacteria 4030
238 Ga0373935_0037860 3300035692 Bacteria 3019
239 Ga0373933_0002220 3300035724 Bacteria 11088
240 Ga0373933_0062085 3300035724 Bacteria 2256
241 Ga0373937_0000476 3300036401 Bacteria 36914
242 Ga0373937_0008534 3300036401 Bacteria 8901
243 Ga0373937_0223784 3300036401 Bacteria 1771
244 Ga0373925_0006624 3300037068 Bacteria 8512
245 Ga0373925_0095765 3300037068 Bacteria 2274
246 Ga0451577_0000063 3300042876 Bacteria 264379
247 Ga0451577_0000338 3300042876 Bacteria 87563
248 Ga0451577_0001897 3300042876 Bacteria 26518
249 Ga0451577_0004611 3300042876 Bacteria 14477
250 Ga0451577_0006990 3300042876 Bacteria 11148
251 Ga0451577_0009052 3300042876 Bacteria 9610
252 Ga0451577_0011243 3300042876 Bacteria 8483
253 Ga0451577_0025593 3300042876 Bacteria 5352
254 Ga0451577_0069055 3300042876 Bacteria 3151
255 Ga0451577_0102948 3300042876 Bacteria 2551
256 Ga0451577_0179762 3300042876 Bacteria 1907
257 Ga0451577_0252475 3300042876 Bacteria 1596
258 Ga0451577_0300702 3300042876 Bacteria 1454
259 Ga0453683_0000114 3300044673 Bacteria 119864
260 Ga0453683_0000390 3300044673 Bacteria 52382
261 Ga0453683_0001084 3300044673 Bacteria 25080
262 Ga0453683_0001550 3300044673 Bacteria 19487
263 Ga0453683_0013867 3300044673 Bacteria 5242
264 Ga0453683_0131651 3300044673 Bacteria 1576
265 Ga0466961_0067036 3300044693 Unclassified 2280
266 Ga0466963_0057351 3300044694 Bacteria 2594
267 Ga0453684_0000198 3300044712 Bacteria 264379
268 Ga0453684_0000266 3300044712 Bacteria 225447
269 Ga0453684_0000417 3300044712 Bacteria 173793
270 Ga0453684_0000455 3300044712 Bacteria 165080
271 Ga0453684_0000725 3300044712 Bacteria 116265
272 Ga0453684_0001063 3300044712 Bacteria 87449
273 Ga0453684_0001213 3300044712 Bacteria 79157
274 Ga0453684_0001817 3300044712 Bacteria 56194
275 Ga0453684_0002936 3300044712 Bacteria 39991
276 Ga0453684_0003575 3300044712 Bacteria 34707
277 Ga0453684_0011217 3300044712 Bacteria 15085
278 Ga0453684_0011768 3300044712 Bacteria 14584
279 Ga0453684_0013310 3300044712 Bacteria 13386
280 Ga0453684_0014347 3300044712 Bacteria 12690
281 Ga0453684_0016077 3300044712 Bacteria 11743
282 Ga0453684_0018573 3300044712 Bacteria 10658
283 Ga0453684_0022113 3300044712 Bacteria 9457
284 Ga0453684_0025700 3300044712 Bacteria 8538
285 Ga0453684_0034158 3300044712 Bacteria 7067
286 Ga0453684_0105165 3300044712 Bacteria 3444
287 Ga0453684_0166078 3300044712 Bacteria 2605
288 Ga0453684_0210422 3300044712 Bacteria 2261
289 Ga0453684_0258593 3300044712 Bacteria 1995
290 Ga0466959_0223736 3300045049 Unclassified 1304
291 Ga0451576_0000087 3300045051 Bacteria 234554
292 Ga0451576_0000151 3300045051 Bacteria 176466
293 Ga0451576_0001251 3300045051 Bacteria 44672
294 Ga0451576_0001262 3300045051 Bacteria 44382
295 Ga0451576_0002196 3300045051 Bacteria 30086
296 Ga0451576_0003642 3300045051 Bacteria 20916
297 Ga0451576_0034683 3300045051 Bacteria 5359
298 Ga0451576_0073186 3300045051 Bacteria 3566
299 Ga0451576_0099338 3300045051 Bacteria 3028
300 Ga0451576_0107790 3300045051 Bacteria 2899
301 Ga0451576_0349458 3300045051 Bacteria 1548
302 Ga0451576_0373416 3300045051 Bacteria 1494
303 Ga0466958_0060973 3300045836 Unclassified 2297
304 Ga0495651_0004828 3300046462 Bacteria 10312
305 Ga0495651_0008655 3300046462 Bacteria 7809
306 Ga0495651_0051643 3300046462 Bacteria 3169
307 Ga0495653_0132571 3300046463 Unclassified 1762
308 Ga0495580_0000624 3300046472 Bacteria 29941
309 Ga0495580_0011318 3300046472 Bacteria 6903
310 Ga0495580_0021108 3300046472 Bacteria 4808
311 Ga0495582_0104070 3300046473 Bacteria 1591
312 Ga0495582_0137411 3300046473 Bacteria 1383
313 Ga0495664_0044365 3300046477 Bacteria 2635
314 Ga0495594_0006727 3300046499 Bacteria 5912
315 Ga0495594_0156138 3300046499 Bacteria 1296
316 Ga0495608_0039660 3300046511 Bacteria 3156
317 Ga0495628_0186310 3300046516 Bacteria 1568
318 Ga0495630_0054947 3300046517 Bacteria 2984
319 Ga0495630_0228318 3300046517 Bacteria 1422
320 Ga0495665_0016275 3300046531 Bacteria 4007
321 Ga0495665_0064687 3300046531 Bacteria 1930
322 Ga0495665_0131016 3300046531 Bacteria 1313
323 Ga0495586_0003876 3300046535 Bacteria 8011
324 Ga0495587_0080091 3300046536 Bacteria 1893
325 Ga0495587_0183399 3300046536 Bacteria 1186
326 Ga0495645_0014208 3300046543 Bacteria 5646
327 Ga0495622_0032612 3300046557 Bacteria 2432
328 Ga0495588_0074110 3300046674 Bacteria 1773
329 Ga0495657_0076654 3300046675 Bacteria 2171
330 Ga0495599_0127414 3300046678 Bacteria 1582
331 Ga0495623_0008812 3300046679 Bacteria 6546
332 Ga0495623_0063960 3300046679 Unclassified 2303
333 Ga0495658_0041428 3300046683 Bacteria 2566
334 Ga0495669_0143267 3300046684 Unclassified 1129
335 Ga0495613_0025877 3300046689 Bacteria 4372
336 Ga0495613_0065729 3300046689 Bacteria 2650
337 Ga0495600_0119018 3300046809 Bacteria 1718
338 Ga0495581_0064209 3300047315 Bacteria 2121
339 Ga0495604_0000606 3300047317 Bacteria 30859
340 Ga0495604_0020984 3300047317 Bacteria 5213
341 Ga0495604_0133106 3300047317 Bacteria 1785
342 Ga0495604_0140328 3300047317 Unclassified 1727
343 Ga0495674_0035796 3300047319 Bacteria 4475
344 Ga0495674_0111261 3300047319 Bacteria 2321
345 Ga0495674_0312053 3300047319 Unclassified 1283
346 Ga0495674_0345864 3300047319 Bacteria 1208
347 Ga0495674_0431930 3300047319 Bacteria 1060
348 Ga0495680_0023240 3300047322 Bacteria 5156
349 Ga0495675_0002266 3300047444 Bacteria 11482
350 Ga0495675_0051283 3300047444 Bacteria 2621
351 Ga0495677_0018508 3300047445 Bacteria 2525
352 Ga0495684_0000726 3300047471 Bacteria 26554
353 Ga0495684_0009497 3300047471 Bacteria 7504
354 Ga0495684_0016884 3300047471 Bacteria 5624
355 Ga0495684_0156474 3300047471 Bacteria 1702
356 Ga0495602_0002143 3300048088 Bacteria 19927
357 Ga0495602_0046772 3300048088 Bacteria 3905
358 Ga0496109_0289878 3300048912 Bacteria 1543
359 Ga0496112_0003219 3300048915 Bacteria 13443
360 Ga0496115_0034397 3300048918 Unclassified 4004
361 Ga0496115_0103056 3300048918 Unclassified 2340
362 Ga0496115_0109850 3300048918 Unclassified 2265
363 Ga0501031_0115968 3300049568 Bacteria 1750
364 Ga0501036_0070111 3300049572 Bacteria 2964
365 Ga0501074_0296843 3300049590 Bacteria 1148
366 Ga0495601_0020011 3300053077 Bacteria 4085
367 Ga0501082_0000989 3300060353 Bacteria 25116
368 Ga0501082_0017125 3300060353 Bacteria 6244
369 Ga0530510_0110574 3300061734 Bacteria 2012
370 Ga0265338_10000789
371 rootH1_10219044
372 Ga0070683_100000026
373 Ga0070683_100106757
374 Ga0070680_100009538
375 Ga0070660_100010134
376 Ga0070661_100107685
377 Ga0070675_100035418
378 Ga0070709_10000267
379 Ga0070709_10086606
380 Ga0070714_100001263
381 Ga0070714_100369457
382 Ga0070713_100000094
383 Ga0070713_100003077
384 Ga0070713_100014155
385 Ga0070713_100055503
386 Ga0070710_10018674
387 Ga0070710_10027495
388 Ga0070711_100000240
389 Ga0070711_100004372
390 Ga0070711_100006620
391 Ga0070662_100052314
392 Ga0070681_10001126
393 Ga0070679_100043017
394 Ga0070679_100416191
395 Ga0070684_100000012
396 Ga0068853_100234690
397 Ga0068855_100008795
398 Ga0068855_100044214
399 Ga0068855_100058817
400 Ga0068855_100087243
401 Ga0068855_100087460
402 Ga0068855_100162780
403 Ga0068852_100027078
404 Ga0068864_100220512
405 Ga0068863_100068396
406 Ga0070717_10077425
407 Ga0070717_10190470
408 Ga0070715_10016960
409 Ga0070716_100007858
410 Ga0070716_100158141
411 Ga0070712_100000163
412 Ga0070712_100040975
413 Ga0070712_100174088
414 Ga0068865_100124092
415 Ga0105240_10000480
416 Ga0105240_10001244
417 Ga0105240_10140023
418 Ga0105240_10252951
419 Ga0105240_10263902
420 Ga0105248_10031417
421 Ga0105248_10523982
422 Ga0105248_10576120
423 Ga0105238_10001519
424 Ga0105238_10094726
425 Ga0105239_10463669
426 Ga0157371_10027189
427 Ga0157370_10037285
428 Ga0157370_10272421
429 Ga0157369_10004443
430 Ga0157369_10016885
431 Ga0157369_10117357
432 Ga0157369_10129399
433 Ga0157374_10255360
434 Ga0157372_10000581
435 Ga0157372_10224240
436 Ga0157372_10284452
437 Ga0163163_10028986
438 Ga0163163_10408396
439 Ga0163163_10438506
440 Ga0163163_10502635
441 Ga0157379_10017328
442 Ga0157376_10059491
443 Ga0163161_10025447
444 Ga0207692_10043563
445 Ga0207647_10014446
446 Ga0207685_10061711
447 Ga0207699_10007006
448 Ga0207707_10004693
449 Ga0207695_10001781
450 Ga0207695_10048591
451 Ga0207695_10060087
452 Ga0207695_10161903
453 Ga0207693_10000061
454 Ga0207693_10005155
455 Ga0207663_10000900
456 Ga0207663_10005474
457 Ga0207660_10007894
458 Ga0207657_10010018
459 Ga0207652_10013526
460 Ga0207694_10014687
461 Ga0207700_10004998
462 Ga0207700_10009677
463 Ga0207700_10058934
464 Ga0207664_10050516
465 Ga0207664_10256278
466 Ga0207706_10003046
467 Ga0207670_10039650
468 Ga0207704_10251284
469 Ga0207665_10015927
470 Ga0207665_10151243
471 Ga0207711_10093524
472 Ga0207661_10000003
473 Ga0207667_10000059
474 Ga0207667_10222527
475 Ga0207641_10056350
476 Ga0207674_10019461
477 Ga0207683_10023334
478 Ga0268266_10099596
479 Ga0265337_1000188
480 Ga0265337_1000324
481 Ga0265337_1002557
482 Ga0265326_10019950
483 Ga0265326_10027522
484 Ga0265334_10000960
485 Ga0265334_10001402
486 Ga0265334_10008001
487 Ga0265334_10043456
488 Ga0265318_10008245
489 Ga0265318_10055602
490 Ga0265323_10000084
491 Ga0265323_10000536
492 Ga0265323_10000688
493 Ga0265323_10003780
494 Ga0265323_10005153
495 Ga0265323_10009732
496 Ga0265323_10010701
497 Ga0265323_10018891
498 Ga0265323_10019360
499 Ga0265323_10024054
500 Ga0265322_10013144
501 Ga0265322_10013957
502 Ga0265336_10000240
503 Ga0265336_10010484
504 Ga0265336_10024711
505 Ga0265338_10000237
506 Ga0265338_10000556
507 Ga0265338_10000810
508 Ga0265338_10001290
509 Ga0265338_10001431
510 Ga0265338_10003283
511 Ga0265338_10004396
512 Ga0265338_10006143
513 Ga0265338_10008146
514 Ga0265338_10010139
515 Ga0265338_10010928
516 Ga0265338_10023748
517 Ga0265338_10024129
518 Ga0265338_10026625
519 Ga0265338_10035847
520 Ga0265338_10054616
521 Ga0265338_10062938
522 Ga0265338_10098643
523 Ga0265338_10112097
524 Ga0265338_10113204
525 Ga0265338_10113498
526 Ga0265324_10000475
527 Ga0265324_10000734
528 Ga0265324_10008241
529 Ga0265324_10014294
530 Ga0265324_10049010
531 Ga0265324_10051270
532 Ga0265330_10000180
533 Ga0265330_10002956
534 Ga0265330_10022078
535 Ga0265330_10034021
536 Ga0265330_10045472
537 Ga0265330_10053910
538 Ga0265330_10075842
539 Ga0265330_10114899
540 Ga0265332_10026735
541 Ga0265332_10069502
542 Ga0265328_10011808
543 Ga0265328_10080415
544 Ga0265320_10000188
545 Ga0265320_10000816
546 Ga0265320_10009797
547 Ga0265320_10045897
548 Ga0265320_10051024
549 Ga0265325_10000086
550 Ga0265325_10011002
551 Ga0265325_10063719
552 Ga0265325_10067285
553 Ga0265329_10028942
554 Ga0265340_10005762
555 Ga0265340_10041705
556 Ga0265339_10079087
557 Ga0265339_10097036
558 Ga0265331_10015387
559 Ga0265331_10034859
560 Ga0265327_10014147
561 Ga0265327_10020540
562 Ga0265316_10003058
563 Ga0265316_10003587
564 Ga0265316_10006908
565 Ga0265316_10012932
566 Ga0265316_10019314
567 Ga0265316_10020951
568 Ga0265316_10023806
569 Ga0265316_10030617
570 Ga0265316_10033205
571 Ga0265316_10055430
572 Ga0265316_10057410
573 Ga0265316_10064716
574 Ga0265316_10067477
575 Ga0265316_10071883
576 Ga0265316_10093140
577 Ga0265316_10093804
578 Ga0265316_10125013
579 Ga0265316_10145206
580 Ga0265316_10178016
581 Ga0265316_10202587
582 Ga0265316_10203688
583 Ga0265313_10009943
584 Ga0265313_10012004
585 Ga0265314_10000047
586 Ga0265314_10000148
587 Ga0265314_10000509
588 Ga0265314_10046677
589 Ga0265314_10069525
590 Ga0265342_10000208
591 Ga0265342_10005582
592 Ga0265342_10037262
593 Ga0265342_10075413
594 Ga0265342_10145591
595 Ga0307410_10330507
596 Ga0307409_100004569
597 Ga0373934_0011219
598 Ga0373923_0066890
599 Ga0373953_0010066
600 Ga0373953_0042549
601 Ga0373954_0000962
602 Ga0373956_0007296
603 Ga0373955_0001485
604 Ga0316574_0055558
605 Ga0373931_0219174
606 Ga0373935_0020604
607 Ga0373935_0037860
608 Ga0373933_0002220
609 Ga0373933_0062085
610 Ga0373937_0000476
611 Ga0373937_0008534
612 Ga0373937_0223784
613 Ga0373925_0006624
614 Ga0373925_0095765
615 Ga0451577_0000063
616 Ga0451577_0000338
617 Ga0451577_0001897
618 Ga0451577_0004611
619 Ga0451577_0006990
620 Ga0451577_0009052
621 Ga0451577_0011243
622 Ga0451577_0025593
623 Ga0451577_0069055
624 Ga0451577_0102948
625 Ga0451577_0179762
626 Ga0451577_0252475
627 Ga0451577_0300702
628 Ga0453683_0000114
629 Ga0453683_0000390
630 Ga0453683_0001084
631 Ga0453683_0001550
632 Ga0453683_0013867
633 Ga0453683_0131651
634 Ga0466961_0067036
635 Ga0466963_0057351
636 Ga0453684_0000198
637 Ga0453684_0000266
638 Ga0453684_0000417
639 Ga0453684_0000455
640 Ga0453684_0000725
641 Ga0453684_0001063
642 Ga0453684_0001213
643 Ga0453684_0001817
644 Ga0453684_0002936
645 Ga0453684_0003575
646 Ga0453684_0011217
647 Ga0453684_0011768
648 Ga0453684_0013310
649 Ga0453684_0014347
650 Ga0453684_0016077
651 Ga0453684_0018573
652 Ga0453684_0022113
653 Ga0453684_0025700
654 Ga0453684_0034158
655 Ga0453684_0105165
656 Ga0453684_0166078
657 Ga0453684_0210422
658 Ga0453684_0258593
659 Ga0466959_0223736
660 Ga0451576_0000087
661 Ga0451576_0000151
662 Ga0451576_0001251
663 Ga0451576_0001262
664 Ga0451576_0002196
665 Ga0451576_0003642
666 Ga0451576_0034683
667 Ga0451576_0073186
668 Ga0451576_0099338
669 Ga0451576_0107790
670 Ga0451576_0349458
671 Ga0451576_0373416
672 Ga0466958_0060973
673 Ga0495651_0004828
674 Ga0495651_0008655
675 Ga0495651_0051643
676 Ga0495653_0132571
677 Ga0495580_0000624
678 Ga0495580_0011318
679 Ga0495580_0021108
680 Ga0495582_0104070
681 Ga0495582_0137411
682 Ga0495664_0044365
683 Ga0495594_0006727
684 Ga0495594_0156138
685 Ga0495608_0039660
686 Ga0495628_0186310
687 Ga0495630_0054947
688 Ga0495630_0228318
689 Ga0495665_0016275
690 Ga0495665_0064687
691 Ga0495665_0131016
692 Ga0495586_0003876
693 Ga0495587_0080091
694 Ga0495587_0183399
695 Ga0495645_0014208
696 Ga0495622_0032612
697 Ga0495588_0074110
698 Ga0495657_0076654
699 Ga0495599_0127414
700 Ga0495623_0008812
701 Ga0495623_0063960
702 Ga0495658_0041428
703 Ga0495669_0143267
704 Ga0495613_0025877
705 Ga0495613_0065729
706 Ga0495600_0119018
707 Ga0495581_0064209
708 Ga0495604_0000606
709 Ga0495604_0020984
710 Ga0495604_0133106
711 Ga0495604_0140328
712 Ga0495674_0035796
713 Ga0495674_0111261
714 Ga0495674_0312053
715 Ga0495674_0345864
716 Ga0495674_0431930
717 Ga0495680_0023240
718 Ga0495675_0002266
719 Ga0495675_0051283
720 Ga0495677_0018508
721 Ga0495684_0000726
722 Ga0495684_0009497
723 Ga0495684_0016884
724 Ga0495684_0156474
725 Ga0495602_0002143
726 Ga0495602_0046772
727 Ga0496109_0289878
728 Ga0496112_0003219
729 Ga0496115_0034397
730 Ga0496115_0103056
731 Ga0496115_0109850
732 Ga0501031_0115968
733 Ga0501036_0070111
734 Ga0501074_0296843
735 Ga0495601_0020011
736 Ga0501082_0000989
737 Ga0501082_0017125
738 Ga0530510_0110574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

36

217

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ih5-assembly1.cif.gz_B crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron 0.8309 1 184
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.7944 3 190
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.7869 3 190
2cfo-assembly1.cif.gz_A non-discriminating glutamyl-trna synthetase from thermosynechococcus elongatus in complex with glu 0.7823 1 43
4j75-assembly1.cif.gz_A crystal structure of a parasite trna synthetase, product-bound 0.7749 1 43
ID Description Score Start End Superfamily
af_P9WLP1_2_158_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8515 2 44 3.40.50.620
af_P78790_28_214_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8383 3 189 3.40.50.620
af_P78790_28_214_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8302 3 189 3.40.50.620
4l2iA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7977 2 191 3.40.50.620
1o97D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7935 3 190 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3D0CVM5-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.8827 2 156
AF-A0A3N5SUQ7-F1-model_v4 deleted 0.8762 4 191
AF-A0A7W0TGC8-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.874 3 180 GO:0009055
GO:0033539
GO:0050660
AF-X1AQB7-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.8619 2 167 GO:0009055
GO:0033539
GO:0050660
AF-A0A7W0TGC8-F1-model_v4 Electron transfer flavoprotein subunit alpha/FixB family protein 0.8605 3 180 GO:0009055
GO:0033539
GO:0050660

Map