F425033

General Info

Members Datasets Scaffolds Average Seq Length
369 117 738 169

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10195979|Ga0157371_101959792
Length 202
Sequence MAETKSQDAIALLKEDHREVEKLFKQFEEAKGDGRKQKLAHQICLELIVHSEIEETIFYPACEGTVDEDELKEGYVEHDAAKLLIAEIEAAEDGADDDFFDTKVKVLSEEIEHHIKEEEGPGGIFSQARKGKLDMDALGEQLAAKKKELIARYKDEGLPTPKLKTMDEVSVQTRLFWGRVRFRARPLFFCDYRSVATSESRP

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 3.25
Rhizosphere 96.21
Stem 0
Stem Tuber 0
Unclassified 9.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10195979 3300013102 Bacteria 1447
2 JGI24736J21556_1013365 3300001904 Bacteria 1326
3 JGI24741J21665_1058650 3300001915 Bacteria 568
4 JGI24740J21852_10001875 3300001979 Bacteria 9620
5 JGI24740J21852_10053989 3300001979 Bacteria 1137
6 JGI24740J21852_10054747 3300001979 Unclassified 1125
7 JGI24739J22299_10115722 3300001989 Bacteria 803
8 JGI24737J22298_10044078 3300001990 Bacteria 1365
9 JGI24735J21928_10005112 3300002067 Bacteria 4367
10 JGI24735J21928_10094332 3300002067 Unclassified 858
11 rootH1_10201535 3300003323 Bacteria 1070
12 Ga0070658_10024569 3300005327 Bacteria 4833
13 Ga0070658_10061580 3300005327 Bacteria 3058
14 Ga0070658_10136068 3300005327 Bacteria 2050
15 Ga0070658_10396546 3300005327 Bacteria 1185
16 Ga0070658_11161145 3300005327 Bacteria 671
17 Ga0070658_11240454 3300005327 Bacteria 648
18 Ga0070658_11453506 3300005327 Bacteria 595
19 Ga0070683_100004703 3300005329 Bacteria 11283
20 Ga0070683_100036041 3300005329 Bacteria 4525
21 Ga0070683_100076864 3300005329 Bacteria 3122
22 Ga0070683_100706202 3300005329 Unclassified 966
23 Ga0070680_100000845 3300005336 Bacteria 21681
24 Ga0070680_100002095 3300005336 Bacteria 14733
25 Ga0070680_100008625 3300005336 Bacteria 7813
26 Ga0070680_100012610 3300005336 Bacteria 6571
27 Ga0070680_100026281 3300005336 Bacteria 4655
28 Ga0070680_100259634 3300005336 Bacteria 1469
29 Ga0070682_100026285 3300005337 Bacteria 3483
30 Ga0070682_100438595 3300005337 Bacteria 997
31 Ga0070660_100022265 3300005339 Bacteria 4684
32 Ga0070660_100034046 3300005339 Bacteria 3846
33 Ga0070660_100101357 3300005339 Bacteria 2281
34 Ga0070660_100544301 3300005339 Unclassified 968
35 Ga0070691_10002168 3300005341 Bacteria 8687
36 Ga0070661_100006185 3300005344 Bacteria 8254
37 Ga0070661_100021931 3300005344 Bacteria 4567
38 Ga0070661_100098491 3300005344 Bacteria 2172
39 Ga0070661_100209075 3300005344 Bacteria 1493
40 Ga0070661_100213872 3300005344 Unclassified 1477
41 Ga0070661_100695562 3300005344 Bacteria 828
42 Ga0070692_10027681 3300005345 Bacteria 2812
43 Ga0070692_10091731 3300005345 Bacteria 1652
44 Ga0070671_100003890 3300005355 Bacteria 11740
45 Ga0070673_100379567 3300005364 Bacteria 1260
46 Ga0070659_100005750 3300005366 Bacteria 8923
47 Ga0070659_100040767 3300005366 Unclassified 3629
48 Ga0070659_100058606 3300005366 Bacteria 3039
49 Ga0070659_100060947 3300005366 Bacteria 2981
50 Ga0070659_100061359 3300005366 Bacteria 2971
51 Ga0070714_100031084 3300005435 Bacteria 4451
52 Ga0070714_100416981 3300005435 Bacteria 1271
53 Ga0070663_100167121 3300005455 Bacteria 1698
54 Ga0070663_100947369 3300005455 Bacteria 746
55 Ga0070662_100117046 3300005457 Unclassified 2038
56 Ga0070662_100203784 3300005457 Bacteria 1571
57 Ga0070662_100537751 3300005457 Unclassified 978
58 Ga0070681_10011026 3300005458 Bacteria 8934
59 Ga0070681_10030936 3300005458 Bacteria 5372
60 Ga0070681_10053823 3300005458 Bacteria 4010
61 Ga0070681_10545770 3300005458 Bacteria 1073
62 Ga0070679_100036459 3300005530 Bacteria 4880
63 Ga0070679_100100852 3300005530 Bacteria 2873
64 Ga0070679_100101695 3300005530 Bacteria 2861
65 Ga0070679_100170417 3300005530 Bacteria 2150
66 Ga0070679_100441869 3300005530 Bacteria 1245
67 Ga0070679_100841333 3300005530 Bacteria 861
68 Ga0070684_100812640 3300005535 Bacteria 874
69 Ga0068853_100009560 3300005539 Bacteria 7811
70 Ga0068853_100015045 3300005539 Bacteria 6358
71 Ga0068853_100049030 3300005539 Bacteria 3628
72 Ga0068853_100087150 3300005539 Bacteria 2739
73 Ga0068853_100252034 3300005539 Unclassified 1620
74 Ga0068853_100568985 3300005539 Bacteria 1075
75 Ga0070672_100584847 3300005543 Bacteria 971
76 Ga0070696_101378827 3300005546 Bacteria 600
77 Ga0068855_100017589 3300005563 Bacteria 8596
78 Ga0068855_100048748 3300005563 Bacteria 4998
79 Ga0068855_100148124 3300005563 Bacteria 2671
80 Ga0068855_100249380 3300005563 Bacteria 1980
81 Ga0068855_100263996 3300005563 Bacteria 1917
82 Ga0068855_100340767 3300005563 Bacteria 1653
83 Ga0068855_100469786 3300005563 Bacteria 1370
84 Ga0068855_101013011 3300005563 Unclassified 872
85 Ga0070664_100008604 3300005564 Bacteria 8257
86 Ga0070664_100030634 3300005564 Bacteria 4490
87 Ga0070664_100375839 3300005564 Bacteria 1296
88 Ga0068857_100091479 3300005577 Bacteria 2723
89 Ga0068857_100096294 3300005577 Bacteria 2652
90 Ga0068854_100008608 3300005578 Bacteria 6570
91 Ga0068854_100019474 3300005578 Bacteria 4574
92 Ga0068854_100026494 3300005578 Bacteria 3985
93 Ga0068854_100509294 3300005578 Bacteria 1015
94 Ga0068854_101111324 3300005578 Bacteria 705
95 Ga0068856_100008728 3300005614 Bacteria 9861
96 Ga0068856_100010867 3300005614 Bacteria 8839
97 Ga0068856_100023360 3300005614 Bacteria 6011
98 Ga0068856_100102805 3300005614 Bacteria 2851
99 Ga0068856_100332685 3300005614 Bacteria 1536
100 Ga0068856_100580998 3300005614 Bacteria 1142
101 Ga0068856_100770673 3300005614 Unclassified 982
102 Ga0068856_101161538 3300005614 Bacteria 789
103 Ga0070702_100285226 3300005615 Bacteria 1135
104 Ga0068852_100003430 3300005616 Bacteria 11074
105 Ga0068852_100018585 3300005616 Bacteria 5479
106 Ga0068852_100024184 3300005616 Bacteria 4905
107 Ga0068852_100069264 3300005616 Bacteria 3091
108 Ga0068852_100083096 3300005616 Bacteria 2847
109 Ga0068852_100132575 3300005616 Bacteria 2296
110 Ga0068852_100289108 3300005616 Bacteria 1583
111 Ga0068852_100289879 3300005616 Bacteria 1581
112 Ga0068852_100582897 3300005616 Bacteria 1121
113 Ga0068852_101150122 3300005616 Bacteria 797
114 Ga0068864_100006117 3300005618 Bacteria 9874
115 Ga0068851_10007809 3300005834 Bacteria 4925
116 Ga0068863_100202213 3300005841 Bacteria 1911
117 Ga0068871_100439414 3300006358 Bacteria 1168
118 Ga0105240_10023904 3300009093 Bacteria 8071
119 Ga0105240_10033036 3300009093 Bacteria 6689
120 Ga0105240_10092352 3300009093 Bacteria 3696
121 Ga0105241_10297839 3300009174 Bacteria 1383
122 Ga0105237_10016756 3300009545 Bacteria 7608
123 Ga0105237_10062414 3300009545 Bacteria 3726
124 Ga0105237_10419810 3300009545 Bacteria 1343
125 Ga0105237_11764677 3300009545 Unclassified 626
126 Ga0105238_10007178 3300009551 Bacteria 11143
127 Ga0105238_10064009 3300009551 Bacteria 3678
128 Ga0105238_10395271 3300009551 Bacteria 1375
129 Ga0105238_10489670 3300009551 Unclassified 1229
130 Ga0105238_10521028 3300009551 Bacteria 1191
131 Ga0105239_10278618 3300010375 Bacteria 1882
132 Ga0157373_10007336 3300013100 Bacteria 8212
133 Ga0157373_10048145 3300013100 Bacteria 3040
134 Ga0157373_10052290 3300013100 Bacteria 2907
135 Ga0157373_10092418 3300013100 Bacteria 2131
136 Ga0157373_10186656 3300013100 Bacteria 1460
137 Ga0157373_10350902 3300013100 Bacteria 1052
138 Ga0157373_10353432 3300013100 Bacteria 1048
139 Ga0157373_10454868 3300013100 Bacteria 922
140 Ga0157373_10652853 3300013100 Bacteria 768
141 Ga0157371_10009476 3300013102 Bacteria 7660
142 Ga0157371_10018713 3300013102 Bacteria 5119
143 Ga0157371_10069903 3300013102 Bacteria 2486
144 Ga0157371_10084620 3300013102 Bacteria 2247
145 Ga0157371_10148437 3300013102 Bacteria 1672
146 Ga0157371_10295090 3300013102 Bacteria 1173
147 Ga0157371_10339448 3300013102 Bacteria 1092
148 Ga0157371_10403019 3300013102 Bacteria 1001
149 Ga0157371_10625180 3300013102 Unclassified 802
150 Ga0157371_10733209 3300013102 Bacteria 741
151 Ga0157370_10026506 3300013104 Bacteria 5722
152 Ga0157370_10047895 3300013104 Bacteria 4096
153 Ga0157370_10049004 3300013104 Bacteria 4045
154 Ga0157370_10289900 3300013104 Bacteria 1512
155 Ga0157370_10521053 3300013104 Bacteria 1091
156 Ga0157369_10030569 3300013105 Bacteria 5939
157 Ga0157369_10032061 3300013105 Bacteria 5780
158 Ga0157369_10047123 3300013105 Bacteria 4682
159 Ga0157369_10063838 3300013105 Bacteria 3967
160 Ga0157369_10072616 3300013105 Bacteria 3694
161 Ga0157369_10161593 3300013105 Bacteria 2364
162 Ga0157369_10450701 3300013105 Bacteria 1332
163 Ga0157369_10514969 3300013105 Bacteria 1238
164 Ga0157369_10639300 3300013105 Bacteria 1098
165 Ga0157369_11075966 3300013105 Bacteria 822
166 Ga0163162_11408807 3300013306 Bacteria 793
167 Ga0157372_10026078 3300013307 Bacteria 6358
168 Ga0157372_10057693 3300013307 Bacteria 4340
169 Ga0157372_10067847 3300013307 Bacteria 4009
170 Ga0157372_10155179 3300013307 Bacteria 2644
171 Ga0157372_10207992 3300013307 Bacteria 2267
172 Ga0157372_10856276 3300013307 Unclassified 1055
173 Ga0157372_12156914 3300013307 Bacteria 640
174 Ga0163163_10660091 3300014325 Bacteria 1109
175 Ga0182008_10115916 3300014497 Bacteria 1329
176 Ga0197907_11213749 3300020069 Bacteria 2824
177 Ga0206356_11729923 3300020070 Bacteria 1879
178 Ga0206355_1657929 3300020076 Bacteria 531
179 Ga0206353_10582999 3300020082 Bacteria 1255
180 Ga0207656_10055088 3300025321 Bacteria 1730
181 Ga0207647_10000910 3300025904 Bacteria 22876
182 Ga0207647_10007595 3300025904 Bacteria 7814
183 Ga0207647_10047846 3300025904 Bacteria 2658
184 Ga0207647_10265569 3300025904 Bacteria 982
185 Ga0207705_10005390 3300025909 Bacteria 9567
186 Ga0207705_10068452 3300025909 Bacteria 2570
187 Ga0207705_10084276 3300025909 Bacteria 2320
188 Ga0207705_10375855 3300025909 Unclassified 1097
189 Ga0207654_10033488 3300025911 Bacteria 2848
190 Ga0207654_10257751 3300025911 Bacteria 1171
191 Ga0207707_10073441 3300025912 Bacteria 2983
192 Ga0207707_10083464 3300025912 Bacteria 2790
193 Ga0207707_10532351 3300025912 Bacteria 1000
194 Ga0207695_10008918 3300025913 Bacteria 12486
195 Ga0207695_10101972 3300025913 Bacteria 2863
196 Ga0207671_10014919 3300025914 Bacteria 6110
197 Ga0207671_10214056 3300025914 Bacteria 1508
198 Ga0207660_10000486 3300025917 Bacteria 26452
199 Ga0207660_10004580 3300025917 Bacteria 9006
200 Ga0207660_10039075 3300025917 Bacteria 3316
201 Ga0207660_10133044 3300025917 Unclassified 1895
202 Ga0207660_10149527 3300025917 Bacteria 1793
203 Ga0207660_10384781 3300025917 Bacteria 1128
204 Ga0207657_10001203 3300025919 Bacteria 27541
205 Ga0207657_10002760 3300025919 Bacteria 18909
206 Ga0207657_10121668 3300025919 Bacteria 2147
207 Ga0207649_10001843 3300025920 Bacteria 12115
208 Ga0207649_10021472 3300025920 Bacteria 3717
209 Ga0207649_10287551 3300025920 Unclassified 1197
210 Ga0207649_10776961 3300025920 Bacteria 746
211 Ga0207649_10867245 3300025920 Bacteria 707
212 Ga0207652_10079275 3300025921 Bacteria 2869
213 Ga0207652_10424701 3300025921 Unclassified 1199
214 Ga0207694_10000827 3300025924 Bacteria 27549
215 Ga0207694_10005672 3300025924 Bacteria 9577
216 Ga0207694_10058545 3300025924 Bacteria 2996
217 Ga0207694_10666565 3300025924 Unclassified 877
218 Ga0207664_10013114 3300025929 Bacteria 5942
219 Ga0207664_10480627 3300025929 Bacteria 1111
220 Ga0207644_10012515 3300025931 Bacteria 5637
221 Ga0207690_10010569 3300025932 Bacteria 5492
222 Ga0207690_10070495 3300025932 Unclassified 2408
223 Ga0207690_10084998 3300025932 Bacteria 2219
224 Ga0207706_10150489 3300025933 Unclassified 2047
225 Ga0207706_10383357 3300025933 Bacteria 1220
226 Ga0207691_10290331 3300025940 Bacteria 1406
227 Ga0207711_10020627 3300025941 Bacteria 5499
228 Ga0207661_10355497 3300025944 Bacteria 1322
229 Ga0207661_10989774 3300025944 Bacteria 774
230 Ga0207661_11608878 3300025944 Unclassified 594
231 Ga0207679_10077275 3300025945 Unclassified 2532
232 Ga0207679_10294562 3300025945 Bacteria 1396
233 Ga0207679_10863642 3300025945 Bacteria 827
234 Ga0207667_10007822 3300025949 Bacteria 12775
235 Ga0207667_10011157 3300025949 Bacteria 10459
236 Ga0207667_10038631 3300025949 Bacteria 5095
237 Ga0207667_10169138 3300025949 Bacteria 2247
238 Ga0207667_10202286 3300025949 Bacteria 2037
239 Ga0207667_10243112 3300025949 Bacteria 1842
240 Ga0207667_10685851 3300025949 Bacteria 1028
241 Ga0207667_10800011 3300025949 Bacteria 940
242 Ga0207651_10364995 3300025960 Bacteria 1220
243 Ga0207640_10002781 3300025981 Bacteria 9378
244 Ga0207640_10096521 3300025981 Unclassified 2061
245 Ga0207640_10373953 3300025981 Bacteria 1152
246 Ga0207640_10404935 3300025981 Bacteria 1112
247 Ga0207640_11444655 3300025981 Bacteria 617
248 Ga0207639_10035692 3300026041 Bacteria 3680
249 Ga0207639_10110370 3300026041 Bacteria 2240
250 Ga0207639_10188850 3300026041 Bacteria 1758
251 Ga0207639_10213052 3300026041 Bacteria 1664
252 Ga0207639_10347650 3300026041 Bacteria 1324
253 Ga0207678_10031874 3300026067 Bacteria 4595
254 Ga0207678_10129198 3300026067 Bacteria 2155
255 Ga0207702_10013224 3300026078 Bacteria 6863
256 Ga0207702_10039984 3300026078 Bacteria 3931
257 Ga0207702_10179130 3300026078 Bacteria 1950
258 Ga0207702_10581698 3300026078 Bacteria 1098
259 Ga0207702_10624643 3300026078 Bacteria 1058
260 Ga0207702_11170192 3300026078 Bacteria 763
261 Ga0207702_12003104 3300026078 Bacteria 569
262 Ga0207641_10189989 3300026088 Bacteria 1887
263 Ga0207676_10005052 3300026095 Bacteria 9333
264 Ga0207674_10010668 3300026116 Bacteria 10390
265 Ga0207674_10054652 3300026116 Bacteria 4064
266 Ga0207698_10000336 3300026142 Bacteria 27862
267 Ga0207698_10001039 3300026142 Bacteria 16159
268 Ga0207698_10004072 3300026142 Bacteria 8873
269 Ga0207698_10016554 3300026142 Bacteria 4974
270 Ga0207698_10052721 3300026142 Bacteria 3118
271 Ga0207698_10085446 3300026142 Bacteria 2562
272 Ga0207698_11228146 3300026142 Bacteria 764
273 Ga0307416_102252227 3300032002 Bacteria 646
274 Ga0395899_0010948 3300037312 Bacteria 6949
275 Ga0395899_0027375 3300037312 Bacteria 4299
276 Ga0395899_0060953 3300037312 Bacteria 2778
277 Ga0395899_0086632 3300037312 Bacteria 2274
278 Ga0395899_0390279 3300037312 Unclassified 923
279 Ga0395899_0756390 3300037312 Bacteria 604
280 Ga0395900_0002233 3300037418 Bacteria 21590
281 Ga0395900_0007158 3300037418 Bacteria 11562
282 Ga0395900_0012879 3300037418 Bacteria 8543
283 Ga0395900_0028497 3300037418 Bacteria 5721
284 Ga0395900_0041141 3300037418 Bacteria 4765
285 Ga0395900_0078308 3300037418 Bacteria 3396
286 Ga0395900_0086924 3300037418 Bacteria 3213
287 Ga0395900_0260908 3300037418 Bacteria 1730
288 Ga0395900_0503253 3300037418 Bacteria 1161
289 Ga0395900_0641195 3300037418 Bacteria 1000
290 Ga0395900_1044467 3300037418 Unclassified 736
291 Ga0395898_0038885 3300037466 Bacteria 4712
292 Ga0395898_0061103 3300037466 Bacteria 3660
293 Ga0395898_0080573 3300037466 Bacteria 3139
294 Ga0395898_0152649 3300037466 Bacteria 2209
295 Ga0395898_0453672 3300037466 Bacteria 1221
296 Ga0395898_0700001 3300037466 Unclassified 955
297 Ga0395898_0908600 3300037466 Bacteria 818
298 Ga0395898_1491254 3300037466 Bacteria 602
299 Ga0395905_0014464 3300037471 Bacteria 7533
300 Ga0395905_0046084 3300037471 Bacteria 4088
301 Ga0395905_0058219 3300037471 Unclassified 3614
302 Ga0395905_0149315 3300037471 Bacteria 2199
303 Ga0395901_0000140 3300038443 Bacteria 94487
304 Ga0395901_0002476 3300038443 Bacteria 18740
305 Ga0395901_0038747 3300038443 Bacteria 4930
306 Ga0395901_0087087 3300038443 Bacteria 3265
307 Ga0395901_0137292 3300038443 Bacteria 2570
308 Ga0395901_0213708 3300038443 Bacteria 2017
309 Ga0395901_0238846 3300038443 Bacteria 1895
310 Ga0395901_0253316 3300038443 Bacteria 1834
311 Ga0395901_0319896 3300038443 Bacteria 1605
312 Ga0395901_0479858 3300038443 Bacteria 1268
313 Ga0395901_0758326 3300038443 Unclassified 963
314 Ga0395901_0774382 3300038443 Bacteria 950
315 Ga0451798_0303419 3300041458 Bacteria 747
316 Ga0466966_0037123 3300044684 Bacteria 3143
317 Ga0466963_0006738 3300044694 Bacteria 6825
318 Ga0466963_0044534 3300044694 Bacteria 2921
319 Ga0466963_0076133 3300044694 Bacteria 2265
320 Ga0466963_0114686 3300044694 Bacteria 1851
321 Ga0466963_0167557 3300044694 Bacteria 1530
322 Ga0466963_0308751 3300044694 Bacteria 1112
323 Ga0466964_0321210 3300044706 Bacteria 787
324 Ga0466971_0047577 3300044719 Bacteria 1928
325 Ga0466971_0175371 3300044719 Bacteria 1007
326 Ga0466971_0278877 3300044719 Unclassified 800
327 Ga0466970_0006462 3300044765 Bacteria 5862
328 Ga0466957_0001182 3300044842 Bacteria 13566
329 Ga0466957_0778343 3300044842 Bacteria 679
330 Ga0466957_0796296 3300044842 Bacteria 671
331 Ga0466958_0006170 3300045836 Bacteria 6501
332 Ga0466958_0110127 3300045836 Bacteria 1719
333 Ga0466958_0117014 3300045836 Bacteria 1667
334 Ga0466967_0005331 3300045976 Bacteria 8884
335 Ga0466967_0010384 3300045976 Bacteria 6983
336 Ga0466967_0011818 3300045976 Bacteria 6639
337 Ga0466967_0022004 3300045976 Bacteria 5192
338 Ga0466967_0035712 3300045976 Bacteria 4235
339 Ga0466967_0080048 3300045976 Bacteria 2947
340 Ga0466967_0112902 3300045976 Bacteria 2499
341 Ga0466967_0151450 3300045976 Bacteria 2168
342 Ga0466967_0170141 3300045976 Bacteria 2049
343 Ga0466967_0183102 3300045976 Unclassified 1977
344 Ga0466967_0223482 3300045976 Bacteria 1790
345 Ga0466967_0279125 3300045976 Unclassified 1602
346 Ga0466967_0425660 3300045976 Bacteria 1294
347 Ga0466967_0983347 3300045976 Bacteria 840
348 Ga0466967_1093105 3300045976 Unclassified 794
349 Ga0495663_0159468 3300046525 Bacteria 773
350 Ga0495642_0055463 3300046528 Bacteria 1636
351 Ga0495669_0038307 3300046684 Bacteria 2123
352 Ga0495677_0088078 3300047445 Bacteria 1168
353 Ga0496100_0175142 3300048903 Bacteria 1548
354 Ga0496101_0114148 3300048904 Bacteria 2036
355 Ga0496103_0405194 3300048906 Bacteria 876
356 Ga0496108_0021315 3300048911 Bacteria 5326
357 Ga0496109_0002022 3300048912 Bacteria 16815
358 Ga0496109_1242143 3300048912 Bacteria 681
359 Ga0496110_0028987 3300048913 Bacteria 4758
360 Ga0496111_0006065 3300048914 Bacteria 7809
361 Ga0496112_0035609 3300048915 Bacteria 4851
362 Ga0496112_0048333 3300048915 Bacteria 4171
363 Ga0496113_0156030 3300048916 Bacteria 1802
364 Ga0501074_0295362 3300049590 Bacteria 1151
365 Ga0501080_0668030 3300049742 Bacteria 918
366 Ga0500642_0000480 3300053130 Bacteria 12396
367 Ga0466962_0020805 3300061719 Bacteria 3153
368 Ga0466962_0159040 3300061719 Bacteria 1098
369 Ga0466962_0196774 3300061719 Bacteria 984
370 Ga0157371_10195979
371 JGI24736J21556_1013365
372 JGI24741J21665_1058650
373 JGI24740J21852_10001875
374 JGI24740J21852_10053989
375 JGI24740J21852_10054747
376 JGI24739J22299_10115722
377 JGI24737J22298_10044078
378 JGI24735J21928_10005112
379 JGI24735J21928_10094332
380 rootH1_10201535
381 Ga0070658_10024569
382 Ga0070658_10061580
383 Ga0070658_10136068
384 Ga0070658_10396546
385 Ga0070658_11161145
386 Ga0070658_11240454
387 Ga0070658_11453506
388 Ga0070683_100004703
389 Ga0070683_100036041
390 Ga0070683_100076864
391 Ga0070683_100706202
392 Ga0070680_100000845
393 Ga0070680_100002095
394 Ga0070680_100008625
395 Ga0070680_100012610
396 Ga0070680_100026281
397 Ga0070680_100259634
398 Ga0070682_100026285
399 Ga0070682_100438595
400 Ga0070660_100022265
401 Ga0070660_100034046
402 Ga0070660_100101357
403 Ga0070660_100544301
404 Ga0070691_10002168
405 Ga0070661_100006185
406 Ga0070661_100021931
407 Ga0070661_100098491
408 Ga0070661_100209075
409 Ga0070661_100213872
410 Ga0070661_100695562
411 Ga0070692_10027681
412 Ga0070692_10091731
413 Ga0070671_100003890
414 Ga0070673_100379567
415 Ga0070659_100005750
416 Ga0070659_100040767
417 Ga0070659_100058606
418 Ga0070659_100060947
419 Ga0070659_100061359
420 Ga0070714_100031084
421 Ga0070714_100416981
422 Ga0070663_100167121
423 Ga0070663_100947369
424 Ga0070662_100117046
425 Ga0070662_100203784
426 Ga0070662_100537751
427 Ga0070681_10011026
428 Ga0070681_10030936
429 Ga0070681_10053823
430 Ga0070681_10545770
431 Ga0070679_100036459
432 Ga0070679_100100852
433 Ga0070679_100101695
434 Ga0070679_100170417
435 Ga0070679_100441869
436 Ga0070679_100841333
437 Ga0070684_100812640
438 Ga0068853_100009560
439 Ga0068853_100015045
440 Ga0068853_100049030
441 Ga0068853_100087150
442 Ga0068853_100252034
443 Ga0068853_100568985
444 Ga0070672_100584847
445 Ga0070696_101378827
446 Ga0068855_100017589
447 Ga0068855_100048748
448 Ga0068855_100148124
449 Ga0068855_100249380
450 Ga0068855_100263996
451 Ga0068855_100340767
452 Ga0068855_100469786
453 Ga0068855_101013011
454 Ga0070664_100008604
455 Ga0070664_100030634
456 Ga0070664_100375839
457 Ga0068857_100091479
458 Ga0068857_100096294
459 Ga0068854_100008608
460 Ga0068854_100019474
461 Ga0068854_100026494
462 Ga0068854_100509294
463 Ga0068854_101111324
464 Ga0068856_100008728
465 Ga0068856_100010867
466 Ga0068856_100023360
467 Ga0068856_100102805
468 Ga0068856_100332685
469 Ga0068856_100580998
470 Ga0068856_100770673
471 Ga0068856_101161538
472 Ga0070702_100285226
473 Ga0068852_100003430
474 Ga0068852_100018585
475 Ga0068852_100024184
476 Ga0068852_100069264
477 Ga0068852_100083096
478 Ga0068852_100132575
479 Ga0068852_100289108
480 Ga0068852_100289879
481 Ga0068852_100582897
482 Ga0068852_101150122
483 Ga0068864_100006117
484 Ga0068851_10007809
485 Ga0068863_100202213
486 Ga0068871_100439414
487 Ga0105240_10023904
488 Ga0105240_10033036
489 Ga0105240_10092352
490 Ga0105241_10297839
491 Ga0105237_10016756
492 Ga0105237_10062414
493 Ga0105237_10419810
494 Ga0105237_11764677
495 Ga0105238_10007178
496 Ga0105238_10064009
497 Ga0105238_10395271
498 Ga0105238_10489670
499 Ga0105238_10521028
500 Ga0105239_10278618
501 Ga0157373_10007336
502 Ga0157373_10048145
503 Ga0157373_10052290
504 Ga0157373_10092418
505 Ga0157373_10186656
506 Ga0157373_10350902
507 Ga0157373_10353432
508 Ga0157373_10454868
509 Ga0157373_10652853
510 Ga0157371_10009476
511 Ga0157371_10018713
512 Ga0157371_10069903
513 Ga0157371_10084620
514 Ga0157371_10148437
515 Ga0157371_10295090
516 Ga0157371_10339448
517 Ga0157371_10403019
518 Ga0157371_10625180
519 Ga0157371_10733209
520 Ga0157370_10026506
521 Ga0157370_10047895
522 Ga0157370_10049004
523 Ga0157370_10289900
524 Ga0157370_10521053
525 Ga0157369_10030569
526 Ga0157369_10032061
527 Ga0157369_10047123
528 Ga0157369_10063838
529 Ga0157369_10072616
530 Ga0157369_10161593
531 Ga0157369_10450701
532 Ga0157369_10514969
533 Ga0157369_10639300
534 Ga0157369_11075966
535 Ga0163162_11408807
536 Ga0157372_10026078
537 Ga0157372_10057693
538 Ga0157372_10067847
539 Ga0157372_10155179
540 Ga0157372_10207992
541 Ga0157372_10856276
542 Ga0157372_12156914
543 Ga0163163_10660091
544 Ga0182008_10115916
545 Ga0197907_11213749
546 Ga0206356_11729923
547 Ga0206355_1657929
548 Ga0206353_10582999
549 Ga0207656_10055088
550 Ga0207647_10000910
551 Ga0207647_10007595
552 Ga0207647_10047846
553 Ga0207647_10265569
554 Ga0207705_10005390
555 Ga0207705_10068452
556 Ga0207705_10084276
557 Ga0207705_10375855
558 Ga0207654_10033488
559 Ga0207654_10257751
560 Ga0207707_10073441
561 Ga0207707_10083464
562 Ga0207707_10532351
563 Ga0207695_10008918
564 Ga0207695_10101972
565 Ga0207671_10014919
566 Ga0207671_10214056
567 Ga0207660_10000486
568 Ga0207660_10004580
569 Ga0207660_10039075
570 Ga0207660_10133044
571 Ga0207660_10149527
572 Ga0207660_10384781
573 Ga0207657_10001203
574 Ga0207657_10002760
575 Ga0207657_10121668
576 Ga0207649_10001843
577 Ga0207649_10021472
578 Ga0207649_10287551
579 Ga0207649_10776961
580 Ga0207649_10867245
581 Ga0207652_10079275
582 Ga0207652_10424701
583 Ga0207694_10000827
584 Ga0207694_10005672
585 Ga0207694_10058545
586 Ga0207694_10666565
587 Ga0207664_10013114
588 Ga0207664_10480627
589 Ga0207644_10012515
590 Ga0207690_10010569
591 Ga0207690_10070495
592 Ga0207690_10084998
593 Ga0207706_10150489
594 Ga0207706_10383357
595 Ga0207691_10290331
596 Ga0207711_10020627
597 Ga0207661_10355497
598 Ga0207661_10989774
599 Ga0207661_11608878
600 Ga0207679_10077275
601 Ga0207679_10294562
602 Ga0207679_10863642
603 Ga0207667_10007822
604 Ga0207667_10011157
605 Ga0207667_10038631
606 Ga0207667_10169138
607 Ga0207667_10202286
608 Ga0207667_10243112
609 Ga0207667_10685851
610 Ga0207667_10800011
611 Ga0207651_10364995
612 Ga0207640_10002781
613 Ga0207640_10096521
614 Ga0207640_10373953
615 Ga0207640_10404935
616 Ga0207640_11444655
617 Ga0207639_10035692
618 Ga0207639_10110370
619 Ga0207639_10188850
620 Ga0207639_10213052
621 Ga0207639_10347650
622 Ga0207678_10031874
623 Ga0207678_10129198
624 Ga0207702_10013224
625 Ga0207702_10039984
626 Ga0207702_10179130
627 Ga0207702_10581698
628 Ga0207702_10624643
629 Ga0207702_11170192
630 Ga0207702_12003104
631 Ga0207641_10189989
632 Ga0207676_10005052
633 Ga0207674_10010668
634 Ga0207674_10054652
635 Ga0207698_10000336
636 Ga0207698_10001039
637 Ga0207698_10004072
638 Ga0207698_10016554
639 Ga0207698_10052721
640 Ga0207698_10085446
641 Ga0207698_11228146
642 Ga0307416_102252227
643 Ga0395899_0010948
644 Ga0395899_0027375
645 Ga0395899_0060953
646 Ga0395899_0086632
647 Ga0395899_0390279
648 Ga0395899_0756390
649 Ga0395900_0002233
650 Ga0395900_0007158
651 Ga0395900_0012879
652 Ga0395900_0028497
653 Ga0395900_0041141
654 Ga0395900_0078308
655 Ga0395900_0086924
656 Ga0395900_0260908
657 Ga0395900_0503253
658 Ga0395900_0641195
659 Ga0395900_1044467
660 Ga0395898_0038885
661 Ga0395898_0061103
662 Ga0395898_0080573
663 Ga0395898_0152649
664 Ga0395898_0453672
665 Ga0395898_0700001
666 Ga0395898_0908600
667 Ga0395898_1491254
668 Ga0395905_0014464
669 Ga0395905_0046084
670 Ga0395905_0058219
671 Ga0395905_0149315
672 Ga0395901_0000140
673 Ga0395901_0002476
674 Ga0395901_0038747
675 Ga0395901_0087087
676 Ga0395901_0137292
677 Ga0395901_0213708
678 Ga0395901_0238846
679 Ga0395901_0253316
680 Ga0395901_0319896
681 Ga0395901_0479858
682 Ga0395901_0758326
683 Ga0395901_0774382
684 Ga0451798_0303419
685 Ga0466966_0037123
686 Ga0466963_0006738
687 Ga0466963_0044534
688 Ga0466963_0076133
689 Ga0466963_0114686
690 Ga0466963_0167557
691 Ga0466963_0308751
692 Ga0466964_0321210
693 Ga0466971_0047577
694 Ga0466971_0175371
695 Ga0466971_0278877
696 Ga0466970_0006462
697 Ga0466957_0001182
698 Ga0466957_0778343
699 Ga0466957_0796296
700 Ga0466958_0006170
701 Ga0466958_0110127
702 Ga0466958_0117014
703 Ga0466967_0005331
704 Ga0466967_0010384
705 Ga0466967_0011818
706 Ga0466967_0022004
707 Ga0466967_0035712
708 Ga0466967_0080048
709 Ga0466967_0112902
710 Ga0466967_0151450
711 Ga0466967_0170141
712 Ga0466967_0183102
713 Ga0466967_0223482
714 Ga0466967_0279125
715 Ga0466967_0425660
716 Ga0466967_0983347
717 Ga0466967_1093105
718 Ga0495663_0159468
719 Ga0495642_0055463
720 Ga0495669_0038307
721 Ga0495677_0088078
722 Ga0496100_0175142
723 Ga0496101_0114148
724 Ga0496103_0405194
725 Ga0496108_0021315
726 Ga0496109_0002022
727 Ga0496109_1242143
728 Ga0496110_0028987
729 Ga0496111_0006065
730 Ga0496112_0035609
731 Ga0496112_0048333
732 Ga0496113_0156030
733 Ga0501074_0295362
734 Ga0501080_0668030
735 Ga0500642_0000480
736 Ga0466962_0020805
737 Ga0466962_0159040
738 Ga0466962_0196774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01814

Hemerythrin

Hemerythrin HHE cation binding domain

8

121

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.7712 7 156
7jrq-assembly1.cif.gz_A crystallographically characterized de novo designed mn-diphenylporphyrin binding protein 0.7184 9 115
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.716 7 156
4xq1-assembly1.cif.gz_A crystal structure of hemerythrin: l114a mutant 0.7098 11 112
4xpx-assembly1.cif.gz_A crystal structure of hemerythrin:wild-type 0.6751 11 132
ID Description Score Start End Superfamily
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8247 5 149 1.20.120.520
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8093 5 149 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7555 7 144 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7459 7 144 1.20.120.520
af_P39987_544_632_1.20.1270.10 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.6753 32 129 1.20.1270.10
ID Description Score Start End GO Terms
AF-G1XYJ7-F1-model_v4 deleted 0.9679 9 154
AF-A0A6G7ZDW5-F1-model_v4 Hemerythrin domain-containing protein 0.9638 6 168
AF-A0A7V9YKY3-F1-model_v4 deleted 0.9587 2 153
AF-A0A6M5JI15-F1-model_v4 Hemerythrin domain-containing protein 0.9555 7 170
AF-A0A519Z6U0-F1-model_v4 Hemerythrin domain-containing protein 0.9544 4 148

Map