F425017

General Info

Members Datasets Scaffolds Average Seq Length
369 209 738 221

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10646421|Ga0105243_106464211
Length 244
Sequence VAKNSGGFLLKIENVSKEYPAPREALKIISGISLSLSRGDALSIVGPSGSGKSTLLYIMGALEPPSSGTVTLDGKNPFQLKEKELAAFRNKEIGFVFQDHCLLPQCSVLENVLTPTLVSETKENDERILERARSLLQQVGLADRLDHRPAQLSGGEKQRVALARALITSPQLLLCDEPTGNLDHKAAEVVGSLLLELHQQQKTILVVVTHSAELAARFPLRYELLDQHLRQLSEPPAVAGGPDD

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
175 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
176 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
182 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
185 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
186 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
193 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 0.81
Rhizosphere 97.29
Stem 0
Stem Tuber 0
Unclassified 11.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10646421 3300009148 Bacteria 1024
2 SwRhRL2b_contig_2029303 2162886007 Bacteria 2496
3 Ga0065704_10098478 3300005289 Bacteria 2351
4 Ga0065704_10239417 3300005289 Bacteria 1019
5 Ga0065712_10067902 3300005290 Bacteria 21942
6 Ga0065712_10091753 3300005290 Bacteria 2358
7 Ga0065715_10014096 3300005293 Bacteria 1965
8 Ga0065715_10118728 3300005293 Bacteria 2308
9 Ga0065715_10136419 3300005293 Bacteria 1911
10 Ga0065707_10001555 3300005295 Bacteria 8690
11 Ga0065707_10011683 3300005295 Bacteria 2191
12 Ga0070676_10063159 3300005328 Bacteria 2205
13 Ga0070676_10121939 3300005328 Unclassified 1637
14 Ga0070690_100019400 3300005330 Bacteria 4126
15 Ga0068869_100053940 3300005334 Bacteria 2924
16 Ga0068869_100107615 3300005334 Unclassified 2117
17 Ga0068869_100127073 3300005334 Bacteria 1956
18 Ga0070680_100056194 3300005336 Bacteria 3217
19 Ga0070680_100060942 3300005336 Unclassified 3088
20 Ga0070680_100199331 3300005336 Bacteria 1688
21 Ga0070682_100000059 3300005337 Bacteria 106643
22 Ga0070682_100008678 3300005337 Bacteria 5733
23 Ga0070682_100203827 3300005337 Bacteria 1397
24 Ga0070691_10213988 3300005341 Bacteria 1018
25 Ga0070668_100003327 3300005347 Bacteria 11864
26 Ga0070669_100031372 3300005353 Bacteria 3839
27 Ga0070669_100177641 3300005353 Unclassified 1664
28 Ga0070669_100215298 3300005353 Bacteria 1517
29 Ga0070675_100249094 3300005354 Bacteria 1554
30 Ga0070671_100402997 3300005355 Bacteria 1170
31 Ga0070673_100080848 3300005364 Unclassified 2634
32 Ga0070659_100064156 3300005366 Bacteria 2907
33 Ga0070703_10000364 3300005406 Bacteria 19566
34 Ga0070709_10000167 3300005434 Bacteria 41492
35 Ga0070701_10122282 3300005438 Bacteria 1468
36 Ga0070711_100020524 3300005439 Bacteria 4259
37 Ga0070705_100131159 3300005440 Bacteria 1635
38 Ga0070705_100384282 3300005440 Bacteria 1034
39 Ga0070700_100000106 3300005441 Bacteria 53028
40 Ga0070694_100001085 3300005444 Bacteria 15586
41 Ga0070694_100073325 3300005444 Unclassified 2364
42 Ga0070694_100074735 3300005444 Bacteria 2343
43 Ga0070694_100158281 3300005444 Bacteria 1660
44 Ga0070694_100598755 3300005444 Bacteria 887
45 Ga0070708_100040846 3300005445 Bacteria 4064
46 Ga0070708_100083039 3300005445 Bacteria 2903
47 Ga0070708_100159633 3300005445 Bacteria 2101
48 Ga0070708_100160030 3300005445 Bacteria 2098
49 Ga0070663_100160085 3300005455 Bacteria 1732
50 Ga0070662_100075664 3300005457 Bacteria 2494
51 Ga0070681_10000807 3300005458 Bacteria 26154
52 Ga0070706_100001126 3300005467 Bacteria 28901
53 Ga0070706_100010705 3300005467 Bacteria 8514
54 Ga0070706_100232518 3300005467 Bacteria 1721
55 Ga0070706_100711909 3300005467 Bacteria 931
56 Ga0070707_100010152 3300005468 Bacteria 8765
57 Ga0070707_100307046 3300005468 Bacteria 1542
58 Ga0070707_100315936 3300005468 Bacteria 1518
59 Ga0070707_100326772 3300005468 Bacteria 1490
60 Ga0070698_100004385 3300005471 Bacteria 15500
61 Ga0070698_100107628 3300005471 Bacteria 2755
62 Ga0070699_100021698 3300005518 Bacteria 5537
63 Ga0070699_100025305 3300005518 Bacteria 5118
64 Ga0070699_100436342 3300005518 Bacteria 1187
65 Ga0070699_100454471 3300005518 Bacteria 1161
66 Ga0070699_100760062 3300005518 Bacteria 886
67 Ga0070679_100074433 3300005530 Bacteria 3387
68 Ga0070697_100000018 3300005536 Bacteria 140702
69 Ga0070697_100000293 3300005536 Bacteria 40046
70 Ga0070697_100031398 3300005536 Bacteria 4273
71 Ga0070697_100174351 3300005536 Bacteria 1821
72 Ga0070697_100302456 3300005536 Bacteria 1375
73 Ga0068853_100007786 3300005539 Bacteria 8592
74 Ga0068853_100028131 3300005539 Bacteria 4727
75 Ga0070695_100062598 3300005545 Bacteria 2416
76 Ga0070695_100275970 3300005545 Unclassified 1233
77 Ga0070695_100554987 3300005545 Bacteria 896
78 Ga0070696_100009194 3300005546 Bacteria 6615
79 Ga0070696_100019214 3300005546 Unclassified 4626
80 Ga0070696_100286431 3300005546 Bacteria 1257
81 Ga0070693_100025381 3300005547 Bacteria 3189
82 Ga0070704_100005514 3300005549 Bacteria 7375
83 Ga0070664_100001444 3300005564 Bacteria 18958
84 Ga0070664_100334871 3300005564 Bacteria 1374
85 Ga0068857_100016815 3300005577 Bacteria 6408
86 Ga0068857_100110402 3300005577 Unclassified 2471
87 Ga0068857_100117054 3300005577 Unclassified 2398
88 Ga0068857_100148457 3300005577 Bacteria 2123
89 Ga0068854_100077951 3300005578 Bacteria 2440
90 Ga0068854_100091335 3300005578 Bacteria 2266
91 Ga0068854_100257805 3300005578 Unclassified 1395
92 Ga0068856_100445195 3300005614 Bacteria 1316
93 Ga0070702_100092004 3300005615 Bacteria 1841
94 Ga0070702_100234197 3300005615 Bacteria 1236
95 Ga0070702_100740821 3300005615 Bacteria 753
96 Ga0068859_100000546 3300005617 Bacteria 37260
97 Ga0068859_100011713 3300005617 Bacteria 8811
98 Ga0068859_100027598 3300005617 Bacteria 5694
99 Ga0068859_100062142 3300005617 Unclassified 3764
100 Ga0068859_100106684 3300005617 Bacteria 2860
101 Ga0068864_100009488 3300005618 Bacteria 8029
102 Ga0068864_100015459 3300005618 Bacteria 6346
103 Ga0068861_100037287 3300005719 Bacteria 3614
104 Ga0068870_10008899 3300005840 Bacteria 4535
105 Ga0068870_10068947 3300005840 Unclassified 1923
106 Ga0068870_10108251 3300005840 Bacteria 1582
107 Ga0068870_10120767 3300005840 Bacteria 1509
108 Ga0068870_10295690 3300005840 Bacteria 1020
109 Ga0068870_10370183 3300005840 Bacteria 924
110 Ga0068863_100284476 3300005841 Bacteria 1603
111 Ga0068863_101076718 3300005841 Bacteria 808
112 Ga0068858_100030984 3300005842 Unclassified 4967
113 Ga0068858_100390593 3300005842 Bacteria 1336
114 Ga0068860_100033327 3300005843 Unclassified 4944
115 Ga0068862_100090583 3300005844 Bacteria 2663
116 Ga0068862_100101429 3300005844 Unclassified 2518
117 Ga0068862_100139769 3300005844 Unclassified 2149
118 Ga0081455_10240448 3300005937 Bacteria 1331
119 Ga0081539_10002761 3300005985 Bacteria 23639
120 Ga0075364_10181728 3300006051 Bacteria 1423
121 Ga0070716_100375429 3300006173 Bacteria 1014
122 Ga0075367_10099536 3300006178 Bacteria 1776
123 Ga0097621_100024689 3300006237 Bacteria 4697
124 Ga0068871_100000781 3300006358 Bacteria 21419
125 Ga0075428_100083168 3300006844 Bacteria 3492
126 Ga0075430_100094601 3300006846 Bacteria 2498
127 Ga0075430_100306655 3300006846 Bacteria 1313
128 Ga0075431_100233074 3300006847 Archaea 1875
129 Ga0075431_100614155 3300006847 Unclassified 1070
130 Ga0075433_10017765 3300006852 Bacteria 5901
131 Ga0075433_10119787 3300006852 Bacteria 2336
132 Ga0075433_10134572 3300006852 Bacteria 2197
133 Ga0075434_100135337 3300006871 Bacteria 2483
134 Ga0075434_100756580 3300006871 Bacteria 988
135 Ga0075429_100012444 3300006880 Bacteria 7382
136 Ga0075429_100027249 3300006880 Bacteria 4959
137 Ga0075436_100119336 3300006914 Bacteria 1844
138 Ga0097620_100000546 3300006931 Bacteria 37260
139 Ga0097620_100011712 3300006931 Bacteria 8811
140 Ga0097620_100027598 3300006931 Bacteria 5694
141 Ga0097620_100062149 3300006931 Unclassified 3764
142 Ga0097620_100106681 3300006931 Bacteria 2860
143 Ga0099794_10002145 3300007265 Bacteria 7175
144 Ga0105240_10279792 3300009093 Bacteria 1917
145 Ga0105240_10795138 3300009093 Bacteria 1025
146 Ga0111539_10000627 3300009094 Bacteria 45686
147 Ga0111539_10126315 3300009094 Bacteria 2996
148 Ga0105245_10381608 3300009098 Bacteria 1403
149 Ga0105245_10963943 3300009098 Bacteria 896
150 Ga0114129_10005288 3300009147 Bacteria 18214
151 Ga0114129_10012449 3300009147 Bacteria 12111
152 Ga0114129_10052172 3300009147 Bacteria 5740
153 Ga0114129_10082972 3300009147 Unclassified 4453
154 Ga0114129_10477170 3300009147 Bacteria 1632
155 Ga0114129_10523187 3300009147 Bacteria 1546
156 Ga0114129_10577393 3300009147 Bacteria 1459
157 Ga0105243_10000044 3300009148 Bacteria 156661
158 Ga0105243_10034114 3300009148 Bacteria 3938
159 Ga0105243_10552726 3300009148 Bacteria 1100
160 Ga0105243_11111678 3300009148 Bacteria 799
161 Ga0105243_11187744 3300009148 Bacteria 775
162 Ga0105241_10652906 3300009174 Bacteria 956
163 Ga0105242_10000012 3300009176 Bacteria 136893
164 Ga0105248_10010419 3300009177 Bacteria 10235
165 Ga0105248_10023543 3300009177 Bacteria 6841
166 Ga0105248_10045219 3300009177 Bacteria 4937
167 Ga0105248_10081375 3300009177 Bacteria 3640
168 Ga0105237_10120330 3300009545 Bacteria 2620
169 Ga0105238_10170628 3300009551 Unclassified 2151
170 Ga0105249_10000201 3300009553 Bacteria 68199
171 Ga0105249_10086495 3300009553 Bacteria 2924
172 Ga0105239_10347786 3300010375 Bacteria 1674
173 Ga0105246_10130605 3300011119 Bacteria 1876
174 Ga0157373_10088749 3300013100 Bacteria 2178
175 Ga0157371_10252588 3300013102 Unclassified 1270
176 Ga0157378_10070079 3300013297 Bacteria 3147
177 Ga0157378_10300558 3300013297 Bacteria 1553
178 Ga0157378_11033642 3300013297 Bacteria 857
179 Ga0163162_10000128 3300013306 Bacteria 68199
180 Ga0163162_10032985 3300013306 Bacteria 5143
181 Ga0163162_10273176 3300013306 Unclassified 1822
182 Ga0157372_10639954 3300013307 Bacteria 1239
183 Ga0163163_10118698 3300014325 Bacteria 2678
184 Ga0163163_10172384 3300014325 Bacteria 2210
185 Ga0157380_10000470 3300014326 Bacteria 24591
186 Ga0157380_10056071 3300014326 Bacteria 3132
187 Ga0157380_10455568 3300014326 Bacteria 1230
188 Ga0157380_11250459 3300014326 Bacteria 788
189 Ga0157377_10178055 3300014745 Bacteria 1335
190 Ga0157377_10395817 3300014745 Bacteria 939
191 Ga0157376_10401818 3300014969 Bacteria 1325
192 Ga0207653_10129248 3300025885 Bacteria 916
193 Ga0207647_10000385 3300025904 Bacteria 35983
194 Ga0207647_10087159 3300025904 Bacteria 1865
195 Ga0207685_10206073 3300025905 Bacteria 927
196 Ga0207699_10000018 3300025906 Bacteria 180370
197 Ga0207645_10120528 3300025907 Bacteria 1703
198 Ga0207643_10075069 3300025908 Bacteria 1951
199 Ga0207684_10008223 3300025910 Bacteria 9291
200 Ga0207684_10258369 3300025910 Bacteria 1503
201 Ga0207684_10600554 3300025910 Bacteria 940
202 Ga0207707_10049153 3300025912 Bacteria 3674
203 Ga0207707_10123463 3300025912 Bacteria 2264
204 Ga0207663_10013166 3300025916 Bacteria 4490
205 Ga0207660_10310272 3300025917 Bacteria 1258
206 Ga0207660_10436234 3300025917 Bacteria 1058
207 Ga0207652_10140562 3300025921 Bacteria 2158
208 Ga0207646_10010855 3300025922 Bacteria 8852
209 Ga0207646_10215659 3300025922 Bacteria 1733
210 Ga0207646_10255538 3300025922 Bacteria 1584
211 Ga0207646_10266273 3300025922 Bacteria 1549
212 Ga0207646_10388872 3300025922 Bacteria 1260
213 Ga0207646_10395697 3300025922 Bacteria 1248
214 Ga0207681_10011236 3300025923 Bacteria 5500
215 Ga0207681_10130050 3300025923 Bacteria 1860
216 Ga0207650_10632169 3300025925 Bacteria 902
217 Ga0207659_10215216 3300025926 Bacteria 1542
218 Ga0207706_10052389 3300025933 Bacteria 3603
219 Ga0207706_10211241 3300025933 Bacteria 1701
220 Ga0207686_10000445 3300025934 Bacteria 27617
221 Ga0207686_10071990 3300025934 Bacteria 2226
222 Ga0207709_10000029 3300025935 Bacteria 333327
223 Ga0207665_10095753 3300025939 Bacteria 2064
224 Ga0207711_10055310 3300025941 Bacteria 3407
225 Ga0207711_10119199 3300025941 Bacteria 2354
226 Ga0207689_10035106 3300025942 Bacteria 4165
227 Ga0207689_10117410 3300025942 Unclassified 2188
228 Ga0207689_10253300 3300025942 Bacteria 1456
229 Ga0207689_10615874 3300025942 Bacteria 914
230 Ga0207679_10014462 3300025945 Bacteria 5191
231 Ga0207679_10590460 3300025945 Bacteria 1000
232 Ga0207651_10057580 3300025960 Unclassified 2681
233 Ga0207712_10001036 3300025961 Bacteria 19681
234 Ga0207668_10015291 3300025972 Bacteria 4764
235 Ga0207668_10799372 3300025972 Bacteria 835
236 Ga0207640_10072844 3300025981 Bacteria 2319
237 Ga0207640_10222546 3300025981 Unclassified 1446
238 Ga0207703_10029743 3300026035 Unclassified 4312
239 Ga0207703_10340354 3300026035 Bacteria 1378
240 Ga0207703_10517682 3300026035 Bacteria 1122
241 Ga0207639_10122006 3300026041 Bacteria 2143
242 Ga0207678_10336662 3300026067 Bacteria 1300
243 Ga0207708_10000043 3300026075 Bacteria 121725
244 Ga0207708_10109573 3300026075 Bacteria 2142
245 Ga0207708_10160124 3300026075 Bacteria 1777
246 Ga0207641_10146128 3300026088 Bacteria 2138
247 Ga0207641_10176892 3300026088 Bacteria 1952
248 Ga0207641_10571416 3300026088 Bacteria 1104
249 Ga0207676_10031757 3300026095 Bacteria 3973
250 Ga0207676_10142049 3300026095 Bacteria 2056
251 Ga0207676_10226098 3300026095 Bacteria 1670
252 Ga0207676_10622251 3300026095 Bacteria 1039
253 Ga0207674_10000332 3300026116 Bacteria 60296
254 Ga0207674_10634126 3300026116 Bacteria 1032
255 Ga0207675_100053605 3300026118 Bacteria 3763
256 Ga0207698_10213668 3300026142 Bacteria 1737
257 Ga0209813_10108433 3300027866 Bacteria 953
258 Ga0207428_10022474 3300027907 Bacteria 5323
259 Ga0268265_10080499 3300028380 Unclassified 2569
260 Ga0268265_10138997 3300028380 Bacteria 2031
261 Ga0268265_10342298 3300028380 Bacteria 1362
262 Ga0316178_1147559 3300030735 Bacteria 1302
263 Ga0265316_10073534 3300031344 Bacteria 2632
264 Ga0265316_10153640 3300031344 Bacteria 1723
265 Ga0307405_10017215 3300031731 Unclassified 3961
266 Ga0307405_10170551 3300031731 Bacteria 1552
267 Ga0307405_10503267 3300031731 Bacteria 971
268 Ga0307410_10041242 3300031852 Bacteria 3043
269 Ga0307406_10005794 3300031901 Bacteria 6770
270 Ga0307407_10137760 3300031903 Bacteria 1571
271 Ga0307407_10301814 3300031903 Unclassified 1117
272 Ga0307412_10183663 3300031911 Unclassified 1575
273 Ga0307416_100072357 3300032002 Bacteria 2869
274 Ga0307416_100491878 3300032002 Bacteria 1289
275 Ga0307416_101000633 3300032002 Bacteria 939
276 Ga0307416_101516623 3300032002 Bacteria 776
277 Ga0307414_10054568 3300032004 Bacteria 2793
278 Ga0307411_10117249 3300032005 Unclassified 1918
279 Ga0307411_10180185 3300032005 Bacteria 1603
280 Ga0307415_100159561 3300032126 Unclassified 1746
281 Ga0373934_0064144 3300035086 Bacteria 1466
282 Ga0373941_0021827 3300035115 Bacteria 1811
283 Ga0373955_0130597 3300035172 Bacteria 1466
284 Ga0316574_0049019 3300035398 Bacteria 2625
285 Ga0373931_0553511 3300035691 Bacteria 748
286 Ga0373933_0040146 3300035724 Bacteria 2756
287 Ga0373937_0087223 3300036401 Bacteria 2888
288 Ga0373925_0669049 3300037068 Bacteria 856
289 Ga0439439_0041778 3300041406 Bacteria 1190
290 Ga0439448_0038051 3300042005 Bacteria 1548
291 Ga0439434_0074054 3300042435 Bacteria 1074
292 Ga0495629_0625238 3300046459 Bacteria 719
293 Ga0495653_0264041 3300046463 Bacteria 1137
294 Ga0495582_0206859 3300046473 Unclassified 1121
295 Ga0495594_0036504 3300046499 Bacteria 2680
296 Ga0495610_0231917 3300046512 Bacteria 740
297 Ga0495630_0222484 3300046517 Bacteria 1441
298 Ga0495663_0000150 3300046525 Bacteria 28417
299 Ga0495665_0074469 3300046531 Bacteria 1788
300 Ga0495587_0139846 3300046536 Bacteria 1382
301 Ga0495598_0107108 3300046537 Bacteria 932
302 Ga0495667_0019833 3300046559 Bacteria 4537
303 Ga0495635_0137338 3300046663 Bacteria 1666
304 Ga0495659_0006923 3300046664 Bacteria 3589
305 Ga0495658_0034451 3300046683 Bacteria 2779
306 Ga0495613_0163460 3300046689 Bacteria 1582
307 Ga0495670_0340909 3300046691 Bacteria 806
308 Ga0495672_0012556 3300047320 Bacteria 5907
309 Ga0495675_0266815 3300047444 Bacteria 1024
310 Ga0495684_0096506 3300047471 Bacteria 2237
311 Ga0495602_0319473 3300048088 Bacteria 1130
312 Ga0495615_0101723 3300048090 Bacteria 812
313 Ga0496104_0217032 3300048907 Bacteria 1825
314 Ga0496104_0248694 3300048907 Bacteria 1691
315 Ga0496112_0226438 3300048915 Unclassified 1825
316 Ga0501296_002806 3300049519 Unclassified 1842
317 Ga0501298_000636 3300049521 Bacteria 4826
318 Ga0501300_032821 3300049523 Bacteria 769
319 Ga0501036_0132730 3300049572 Bacteria 2102
320 Ga0501038_0000398 3300049574 Bacteria 37855
321 Ga0501075_0041599 3300049591 Bacteria 3444
322 Ga0501076_0377954 3300049592 Bacteria 1164
323 Ga0501202_035351 3300049652 Unclassified 1060
324 Ga0501207_000863 3300049654 Bacteria 3621
325 Ga0501207_041692 3300049654 Unclassified 799
326 Ga0501217_000939 3300049661 Bacteria 5223
327 Ga0501227_003113 3300049665 Bacteria 3605
328 Ga0501235_005733 3300049669 Bacteria 2701
329 Ga0501251_010347 3300049681 Unclassified 1092
330 Ga0501257_027259 3300049686 Unclassified 1367
331 Ga0501245_023063 3300049708 Unclassified 986
332 Ga0501079_0081834 3300049741 Bacteria 2497
333 Ga0501079_0528984 3300049741 Unclassified 927
334 Ga0501080_0292064 3300049742 Bacteria 1480
335 Ga0501080_0756937 3300049742 Bacteria 854
336 Ga0501081_0052035 3300049743 Bacteria 2825
337 Ga0501081_0670071 3300049743 Bacteria 778
338 Ga0501279_017838 3300049775 Bacteria 996
339 Ga0501283_007595 3300049779 Bacteria 1547
340 Ga0501045_0194501 3300049824 Bacteria 1511
341 Ga0501212_016429 3300049851 Bacteria 1112
342 nmdc:mga03683_782_c1 3300050489 Bacteria 9138
343 nmdc:mga00v17_19374_c1 3300050491 Bacteria 1348
344 nmdc:mga0yw44_307160_c1 3300050492 Bacteria 1063
345 nmdc:mga04h51_124063_c1 3300050495 Bacteria 965
346 nmdc:mga05p37_1078679_c1 3300050507 Bacteria 844
347 nmdc:mga05p37_248378_c1 3300050507 Bacteria 2135
348 nmdc:mga05p37_3817_c1 3300050507 Bacteria 17624
349 nmdc:mga05p37_514_c1 3300050507 Bacteria 42786
350 nmdc:mga05p37_608390_c1 3300050507 Bacteria 1232
351 nmdc:mga0qj67_65076_c1 3300050509 Bacteria 2902
352 nmdc:mga06r32_257994_c1 3300050510 Bacteria 1731
353 nmdc:mga06r32_559051_c1 3300050510 Unclassified 1117
354 nmdc:mga08y16_181134_c1 3300050511 Bacteria 2188
355 nmdc:mga08y16_29748_c1 3300050511 Bacteria 5751
356 nmdc:mga08y16_6810_c1 3300050511 Bacteria 11991
357 nmdc:mga08y16_948989_c1 3300050511 Bacteria 843
358 nmdc:mga0n895_138516_c1 3300050512 Bacteria 2461
359 nmdc:mga0n895_503312_c1 3300050512 Bacteria 1220
360 nmdc:mga0rr50_482318_c1 3300050513 Bacteria 1053
361 nmdc:mga08x19_140876_c1 3300050514 Bacteria 1629
362 nmdc:mga0a205_121645_c1 3300050515 Bacteria 2509
363 nmdc:mga0a205_13945_c1 3300050515 Bacteria 7494
364 nmdc:mga0a205_478519_c1 3300050515 Bacteria 1104
365 nmdc:mga0a205_68254_c1 3300050515 Bacteria 3434
366 nmdc:mga0a205_72392_c1 3300050515 Bacteria 3329
367 Ga0501084_0141273 3300054114 Bacteria 2028
368 Ga0530510_0267452 3300061734 Bacteria 1276
369 Ga0530510_0581936 3300061734 Bacteria 851
370 Ga0105243_10646421
371 SwRhRL2b_contig_2029303
372 Ga0065704_10098478
373 Ga0065704_10239417
374 Ga0065712_10067902
375 Ga0065712_10091753
376 Ga0065715_10014096
377 Ga0065715_10118728
378 Ga0065715_10136419
379 Ga0065707_10001555
380 Ga0065707_10011683
381 Ga0070676_10063159
382 Ga0070676_10121939
383 Ga0070690_100019400
384 Ga0068869_100053940
385 Ga0068869_100107615
386 Ga0068869_100127073
387 Ga0070680_100056194
388 Ga0070680_100060942
389 Ga0070680_100199331
390 Ga0070682_100000059
391 Ga0070682_100008678
392 Ga0070682_100203827
393 Ga0070691_10213988
394 Ga0070668_100003327
395 Ga0070669_100031372
396 Ga0070669_100177641
397 Ga0070669_100215298
398 Ga0070675_100249094
399 Ga0070671_100402997
400 Ga0070673_100080848
401 Ga0070659_100064156
402 Ga0070703_10000364
403 Ga0070709_10000167
404 Ga0070701_10122282
405 Ga0070711_100020524
406 Ga0070705_100131159
407 Ga0070705_100384282
408 Ga0070700_100000106
409 Ga0070694_100001085
410 Ga0070694_100073325
411 Ga0070694_100074735
412 Ga0070694_100158281
413 Ga0070694_100598755
414 Ga0070708_100040846
415 Ga0070708_100083039
416 Ga0070708_100159633
417 Ga0070708_100160030
418 Ga0070663_100160085
419 Ga0070662_100075664
420 Ga0070681_10000807
421 Ga0070706_100001126
422 Ga0070706_100010705
423 Ga0070706_100232518
424 Ga0070706_100711909
425 Ga0070707_100010152
426 Ga0070707_100307046
427 Ga0070707_100315936
428 Ga0070707_100326772
429 Ga0070698_100004385
430 Ga0070698_100107628
431 Ga0070699_100021698
432 Ga0070699_100025305
433 Ga0070699_100436342
434 Ga0070699_100454471
435 Ga0070699_100760062
436 Ga0070679_100074433
437 Ga0070697_100000018
438 Ga0070697_100000293
439 Ga0070697_100031398
440 Ga0070697_100174351
441 Ga0070697_100302456
442 Ga0068853_100007786
443 Ga0068853_100028131
444 Ga0070695_100062598
445 Ga0070695_100275970
446 Ga0070695_100554987
447 Ga0070696_100009194
448 Ga0070696_100019214
449 Ga0070696_100286431
450 Ga0070693_100025381
451 Ga0070704_100005514
452 Ga0070664_100001444
453 Ga0070664_100334871
454 Ga0068857_100016815
455 Ga0068857_100110402
456 Ga0068857_100117054
457 Ga0068857_100148457
458 Ga0068854_100077951
459 Ga0068854_100091335
460 Ga0068854_100257805
461 Ga0068856_100445195
462 Ga0070702_100092004
463 Ga0070702_100234197
464 Ga0070702_100740821
465 Ga0068859_100000546
466 Ga0068859_100011713
467 Ga0068859_100027598
468 Ga0068859_100062142
469 Ga0068859_100106684
470 Ga0068864_100009488
471 Ga0068864_100015459
472 Ga0068861_100037287
473 Ga0068870_10008899
474 Ga0068870_10068947
475 Ga0068870_10108251
476 Ga0068870_10120767
477 Ga0068870_10295690
478 Ga0068870_10370183
479 Ga0068863_100284476
480 Ga0068863_101076718
481 Ga0068858_100030984
482 Ga0068858_100390593
483 Ga0068860_100033327
484 Ga0068862_100090583
485 Ga0068862_100101429
486 Ga0068862_100139769
487 Ga0081455_10240448
488 Ga0081539_10002761
489 Ga0075364_10181728
490 Ga0070716_100375429
491 Ga0075367_10099536
492 Ga0097621_100024689
493 Ga0068871_100000781
494 Ga0075428_100083168
495 Ga0075430_100094601
496 Ga0075430_100306655
497 Ga0075431_100233074
498 Ga0075431_100614155
499 Ga0075433_10017765
500 Ga0075433_10119787
501 Ga0075433_10134572
502 Ga0075434_100135337
503 Ga0075434_100756580
504 Ga0075429_100012444
505 Ga0075429_100027249
506 Ga0075436_100119336
507 Ga0097620_100000546
508 Ga0097620_100011712
509 Ga0097620_100027598
510 Ga0097620_100062149
511 Ga0097620_100106681
512 Ga0099794_10002145
513 Ga0105240_10279792
514 Ga0105240_10795138
515 Ga0111539_10000627
516 Ga0111539_10126315
517 Ga0105245_10381608
518 Ga0105245_10963943
519 Ga0114129_10005288
520 Ga0114129_10012449
521 Ga0114129_10052172
522 Ga0114129_10082972
523 Ga0114129_10477170
524 Ga0114129_10523187
525 Ga0114129_10577393
526 Ga0105243_10000044
527 Ga0105243_10034114
528 Ga0105243_10552726
529 Ga0105243_11111678
530 Ga0105243_11187744
531 Ga0105241_10652906
532 Ga0105242_10000012
533 Ga0105248_10010419
534 Ga0105248_10023543
535 Ga0105248_10045219
536 Ga0105248_10081375
537 Ga0105237_10120330
538 Ga0105238_10170628
539 Ga0105249_10000201
540 Ga0105249_10086495
541 Ga0105239_10347786
542 Ga0105246_10130605
543 Ga0157373_10088749
544 Ga0157371_10252588
545 Ga0157378_10070079
546 Ga0157378_10300558
547 Ga0157378_11033642
548 Ga0163162_10000128
549 Ga0163162_10032985
550 Ga0163162_10273176
551 Ga0157372_10639954
552 Ga0163163_10118698
553 Ga0163163_10172384
554 Ga0157380_10000470
555 Ga0157380_10056071
556 Ga0157380_10455568
557 Ga0157380_11250459
558 Ga0157377_10178055
559 Ga0157377_10395817
560 Ga0157376_10401818
561 Ga0207653_10129248
562 Ga0207647_10000385
563 Ga0207647_10087159
564 Ga0207685_10206073
565 Ga0207699_10000018
566 Ga0207645_10120528
567 Ga0207643_10075069
568 Ga0207684_10008223
569 Ga0207684_10258369
570 Ga0207684_10600554
571 Ga0207707_10049153
572 Ga0207707_10123463
573 Ga0207663_10013166
574 Ga0207660_10310272
575 Ga0207660_10436234
576 Ga0207652_10140562
577 Ga0207646_10010855
578 Ga0207646_10215659
579 Ga0207646_10255538
580 Ga0207646_10266273
581 Ga0207646_10388872
582 Ga0207646_10395697
583 Ga0207681_10011236
584 Ga0207681_10130050
585 Ga0207650_10632169
586 Ga0207659_10215216
587 Ga0207706_10052389
588 Ga0207706_10211241
589 Ga0207686_10000445
590 Ga0207686_10071990
591 Ga0207709_10000029
592 Ga0207665_10095753
593 Ga0207711_10055310
594 Ga0207711_10119199
595 Ga0207689_10035106
596 Ga0207689_10117410
597 Ga0207689_10253300
598 Ga0207689_10615874
599 Ga0207679_10014462
600 Ga0207679_10590460
601 Ga0207651_10057580
602 Ga0207712_10001036
603 Ga0207668_10015291
604 Ga0207668_10799372
605 Ga0207640_10072844
606 Ga0207640_10222546
607 Ga0207703_10029743
608 Ga0207703_10340354
609 Ga0207703_10517682
610 Ga0207639_10122006
611 Ga0207678_10336662
612 Ga0207708_10000043
613 Ga0207708_10109573
614 Ga0207708_10160124
615 Ga0207641_10146128
616 Ga0207641_10176892
617 Ga0207641_10571416
618 Ga0207676_10031757
619 Ga0207676_10142049
620 Ga0207676_10226098
621 Ga0207676_10622251
622 Ga0207674_10000332
623 Ga0207674_10634126
624 Ga0207675_100053605
625 Ga0207698_10213668
626 Ga0209813_10108433
627 Ga0207428_10022474
628 Ga0268265_10080499
629 Ga0268265_10138997
630 Ga0268265_10342298
631 Ga0316178_1147559
632 Ga0265316_10073534
633 Ga0265316_10153640
634 Ga0307405_10017215
635 Ga0307405_10170551
636 Ga0307405_10503267
637 Ga0307410_10041242
638 Ga0307406_10005794
639 Ga0307407_10137760
640 Ga0307407_10301814
641 Ga0307412_10183663
642 Ga0307416_100072357
643 Ga0307416_100491878
644 Ga0307416_101000633
645 Ga0307416_101516623
646 Ga0307414_10054568
647 Ga0307411_10117249
648 Ga0307411_10180185
649 Ga0307415_100159561
650 Ga0373934_0064144
651 Ga0373941_0021827
652 Ga0373955_0130597
653 Ga0316574_0049019
654 Ga0373931_0553511
655 Ga0373933_0040146
656 Ga0373937_0087223
657 Ga0373925_0669049
658 Ga0439439_0041778
659 Ga0439448_0038051
660 Ga0439434_0074054
661 Ga0495629_0625238
662 Ga0495653_0264041
663 Ga0495582_0206859
664 Ga0495594_0036504
665 Ga0495610_0231917
666 Ga0495630_0222484
667 Ga0495663_0000150
668 Ga0495665_0074469
669 Ga0495587_0139846
670 Ga0495598_0107108
671 Ga0495667_0019833
672 Ga0495635_0137338
673 Ga0495659_0006923
674 Ga0495658_0034451
675 Ga0495613_0163460
676 Ga0495670_0340909
677 Ga0495672_0012556
678 Ga0495675_0266815
679 Ga0495684_0096506
680 Ga0495602_0319473
681 Ga0495615_0101723
682 Ga0496104_0217032
683 Ga0496104_0248694
684 Ga0496112_0226438
685 Ga0501296_002806
686 Ga0501298_000636
687 Ga0501300_032821
688 Ga0501036_0132730
689 Ga0501038_0000398
690 Ga0501075_0041599
691 Ga0501076_0377954
692 Ga0501202_035351
693 Ga0501207_000863
694 Ga0501207_041692
695 Ga0501217_000939
696 Ga0501227_003113
697 Ga0501235_005733
698 Ga0501251_010347
699 Ga0501257_027259
700 Ga0501245_023063
701 Ga0501079_0081834
702 Ga0501079_0528984
703 Ga0501080_0292064
704 Ga0501080_0756937
705 Ga0501081_0052035
706 Ga0501081_0670071
707 Ga0501279_017838
708 Ga0501283_007595
709 Ga0501045_0194501
710 Ga0501212_016429
711 nmdc:mga03683_782_c1
712 nmdc:mga00v17_19374_c1
713 nmdc:mga0yw44_307160_c1
714 nmdc:mga04h51_124063_c1
715 nmdc:mga05p37_1078679_c1
716 nmdc:mga05p37_248378_c1
717 nmdc:mga05p37_3817_c1
718 nmdc:mga05p37_514_c1
719 nmdc:mga05p37_608390_c1
720 nmdc:mga0qj67_65076_c1
721 nmdc:mga06r32_257994_c1
722 nmdc:mga06r32_559051_c1
723 nmdc:mga08y16_181134_c1
724 nmdc:mga08y16_29748_c1
725 nmdc:mga08y16_6810_c1
726 nmdc:mga08y16_948989_c1
727 nmdc:mga0n895_138516_c1
728 nmdc:mga0n895_503312_c1
729 nmdc:mga0rr50_482318_c1
730 nmdc:mga08x19_140876_c1
731 nmdc:mga0a205_121645_c1
732 nmdc:mga0a205_13945_c1
733 nmdc:mga0a205_478519_c1
734 nmdc:mga0a205_68254_c1
735 nmdc:mga0a205_72392_c1
736 Ga0501084_0141273
737 Ga0530510_0267452
738 Ga0530510_0581936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

180

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.947 1 219
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9455 2 219
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9409 1 221
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9399 1 219
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.938 1 221
ID Description Score Start End Superfamily
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9589 26 219 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9586 2 221 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9564 2 221 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9564 2 221 3.40.50.300
af_Q2G167_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9537 1 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3B9H8A7-F1-model_v4 ABC transporter domain-containing protein 0.9715 87 218 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7X1E6I1-F1-model_v4 ABC transporter ATP-binding protein 0.9675 2 221 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A424YGU9-F1-model_v4 ABC transporter ATP-binding protein 0.9666 26 219 GO:0005524
GO:0016887
AF-A0A2P9ANQ0-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD (EC 3.6.3.-) 0.9657 1 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7Y3EYL6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9653 119 221 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map