F424954

General Info

Members Datasets Scaffolds Average Seq Length
369 174 738 255

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100020255|Ga0070714_1000202555
Length 306
Sequence MSPKYLVAAALVATLGTPAFGQSVKAGIEAWQRADYATAVTIWRPLAVRGDADAEFNLGQAYRLGRGVPLDLSAAESWFQRAANSGHLDAEATLGLLLFQNGEKVDGIKWLRRAADQNEPRAQLVYGTALYNGDGVAQDRLLGYAYVSRAAGQGLAPAQETLAQLDGMLPPTDRRLALSIAADAQRAPRSSSAPKQQKPVKVASAQPPKAQHIKPVPIKQPAKPTAAPVAAVSGHWRIQLGAFSQRGAAEALYHRISGKAAVAGRVPFYVSAGPVTRLQVGPFPTKGAAASACSSLGIACFAIPAG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
170 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
171 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
172 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
173 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.15
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100020255 3300005435 Bacteria 5429
2 JGI24735J21928_10031771 3300002067 Bacteria 1564
3 JGI24034J26672_10009530 3300002239 Bacteria 1433
4 Ga0070658_10020575 3300005327 Bacteria 5289
5 Ga0070658_10151257 3300005327 Bacteria 1943
6 Ga0070658_10168459 3300005327 Bacteria 1840
7 Ga0070658_10258719 3300005327 Bacteria 1478
8 Ga0070676_10302525 3300005328 Bacteria 1085
9 Ga0070683_100330348 3300005329 Bacteria 1451
10 Ga0070690_100000784 3300005330 Bacteria 16113
11 Ga0070690_100001152 3300005330 Bacteria 13610
12 Ga0070670_100083454 3300005331 Bacteria 2745
13 Ga0070670_100216862 3300005331 Bacteria 1664
14 Ga0070670_100516599 3300005331 Bacteria 1063
15 Ga0070677_10011479 3300005333 Bacteria 3056
16 Ga0068869_100015636 3300005334 Bacteria 5097
17 Ga0070666_10000215 3300005335 Bacteria 39675
18 Ga0070666_10017898 3300005335 Bacteria 4546
19 Ga0070666_10035608 3300005335 Bacteria 3301
20 Ga0070666_10263693 3300005335 Bacteria 1222
21 Ga0070680_100466960 3300005336 Unclassified 1078
22 Ga0068868_100003281 3300005338 Bacteria 11260
23 Ga0068868_100403911 3300005338 Bacteria 1179
24 Ga0070660_100051047 3300005339 Bacteria 3184
25 Ga0070660_100060639 3300005339 Bacteria 2936
26 Ga0070660_100397400 3300005339 Unclassified 1139
27 Ga0070691_10060301 3300005341 Bacteria 1824
28 Ga0070687_100163893 3300005343 Bacteria 1317
29 Ga0070661_100082302 3300005344 Bacteria 2377
30 Ga0070661_100140876 3300005344 Bacteria 1817
31 Ga0070661_100141357 3300005344 Bacteria 1814
32 Ga0070661_100229772 3300005344 Bacteria 1425
33 Ga0070668_100326961 3300005347 Bacteria 1292
34 Ga0070669_100176071 3300005353 Bacteria 1671
35 Ga0070675_100026903 3300005354 Bacteria 4619
36 Ga0070675_100239319 3300005354 Bacteria 1586
37 Ga0070671_100021559 3300005355 Bacteria 5262
38 Ga0070671_100026121 3300005355 Bacteria 4797
39 Ga0070671_100055565 3300005355 Bacteria 3293
40 Ga0070671_100075186 3300005355 Bacteria 2822
41 Ga0070671_100318698 3300005355 Bacteria 1325
42 Ga0070674_100017266 3300005356 Bacteria 4536
43 Ga0070673_100010506 3300005364 Bacteria 6269
44 Ga0070673_100023662 3300005364 Bacteria 4491
45 Ga0070673_100214519 3300005364 Bacteria 1663
46 Ga0070688_100085263 3300005365 Bacteria 2053
47 Ga0070659_100008920 3300005366 Bacteria 7350
48 Ga0070659_100122753 3300005366 Bacteria 2105
49 Ga0070659_100288017 3300005366 Bacteria 1367
50 Ga0070659_100301055 3300005366 Bacteria 1337
51 Ga0070667_100016761 3300005367 Bacteria 6063
52 Ga0070667_100017923 3300005367 Bacteria 5869
53 Ga0070667_100024685 3300005367 Bacteria 4994
54 Ga0070667_100036753 3300005367 Bacteria 4106
55 Ga0070709_10259952 3300005434 Unclassified 1254
56 Ga0070714_100078946 3300005435 Bacteria 2861
57 Ga0070714_100081350 3300005435 Bacteria 2819
58 Ga0070714_100141888 3300005435 Bacteria 2157
59 Ga0070714_100207758 3300005435 Bacteria 1794
60 Ga0070713_100034212 3300005436 Bacteria 4079
61 Ga0070713_100078067 3300005436 Bacteria 2817
62 Ga0070713_100443197 3300005436 Bacteria 1218
63 Ga0070663_100027693 3300005455 Bacteria 3850
64 Ga0070663_100170107 3300005455 Bacteria 1684
65 Ga0070663_100295900 3300005455 Bacteria 1294
66 Ga0070678_100025250 3300005456 Bacteria 3994
67 Ga0070678_100039741 3300005456 Bacteria 3322
68 Ga0070678_100053090 3300005456 Bacteria 2946
69 Ga0070678_100170630 3300005456 Bacteria 1771
70 Ga0070678_100440170 3300005456 Unclassified 1140
71 Ga0070662_100015069 3300005457 Bacteria 5171
72 Ga0070662_100128119 3300005457 Bacteria 1953
73 Ga0070662_100192832 3300005457 Bacteria 1612
74 Ga0070662_100265024 3300005457 Bacteria 1385
75 Ga0068867_100041793 3300005459 Bacteria 3351
76 Ga0068867_100088130 3300005459 Bacteria 2351
77 Ga0070679_100169610 3300005530 Bacteria 2155
78 Ga0070679_100206662 3300005530 Bacteria 1928
79 Ga0068853_100010924 3300005539 Bacteria 7359
80 Ga0068853_100018188 3300005539 Bacteria 5813
81 Ga0068853_100067057 3300005539 Bacteria 3117
82 Ga0070672_100019010 3300005543 Bacteria 4979
83 Ga0070672_100043437 3300005543 Bacteria 3466
84 Ga0070672_100083735 3300005543 Bacteria 2560
85 Ga0070672_100270599 3300005543 Bacteria 1434
86 Ga0070696_100239673 3300005546 Bacteria 1367
87 Ga0070665_100051169 3300005548 Bacteria 4143
88 Ga0070665_100402517 3300005548 Bacteria 1377
89 Ga0070665_100420887 3300005548 Bacteria 1344
90 Ga0070664_100012608 3300005564 Bacteria 6879
91 Ga0070664_100012706 3300005564 Bacteria 6855
92 Ga0070664_100016941 3300005564 Bacteria 5979
93 Ga0070664_100209430 3300005564 Bacteria 1742
94 Ga0070664_100469703 3300005564 Bacteria 1156
95 Ga0068857_100029782 3300005577 Bacteria 4817
96 Ga0068857_100336736 3300005577 Bacteria 1395
97 Ga0068857_100337120 3300005577 Bacteria 1395
98 Ga0068854_100060499 3300005578 Bacteria 2740
99 Ga0068854_100060665 3300005578 Bacteria 2737
100 Ga0068854_100238217 3300005578 Bacteria 1448
101 Ga0068856_100211543 3300005614 Bacteria 1954
102 Ga0068856_100295374 3300005614 Bacteria 1637
103 Ga0068852_100008630 3300005616 Bacteria 7527
104 Ga0068852_100025151 3300005616 Bacteria 4820
105 Ga0068852_100098131 3300005616 Bacteria 2637
106 Ga0068852_100148960 3300005616 Bacteria 2174
107 Ga0068859_100008399 3300005617 Bacteria 10464
108 Ga0068859_100049319 3300005617 Bacteria 4228
109 Ga0068859_100082322 3300005617 Bacteria 3261
110 Ga0068864_100004613 3300005618 Bacteria 11303
111 Ga0068864_100090590 3300005618 Bacteria 2696
112 Ga0068864_100291354 3300005618 Bacteria 1526
113 Ga0068866_10054340 3300005718 Bacteria 2051
114 Ga0068866_10100372 3300005718 Bacteria 1595
115 Ga0068851_10141238 3300005834 Bacteria 1310
116 Ga0068863_100007871 3300005841 Bacteria 10422
117 Ga0068863_100031207 3300005841 Bacteria 5087
118 Ga0068858_100002324 3300005842 Bacteria 19223
119 Ga0068858_100005553 3300005842 Bacteria 12339
120 Ga0068858_100015929 3300005842 Bacteria 7063
121 Ga0068860_100004627 3300005843 Bacteria 14047
122 Ga0068862_100053069 3300005844 Bacteria 3469
123 Ga0068862_100210034 3300005844 Bacteria 1759
124 Ga0097621_100021240 3300006237 Bacteria 5017
125 Ga0068871_100081490 3300006358 Bacteria 2681
126 Ga0068865_100027328 3300006881 Bacteria 3768
127 Ga0097620_100008399 3300006931 Bacteria 10464
128 Ga0097620_100049319 3300006931 Bacteria 4228
129 Ga0097620_100082329 3300006931 Bacteria 3261
130 Ga0105245_10087793 3300009098 Bacteria 2855
131 Ga0105245_10099767 3300009098 Bacteria 2685
132 Ga0105248_10000362 3300009177 Bacteria 53018
133 Ga0105248_10032101 3300009177 Bacteria 5868
134 Ga0105248_10167570 3300009177 Bacteria 2476
135 Ga0105248_10532159 3300009177 Bacteria 1325
136 Ga0105237_10099102 3300009545 Bacteria 2906
137 Ga0105238_10046386 3300009551 Bacteria 4386
138 Ga0105238_10331763 3300009551 Bacteria 1508
139 Ga0105249_10004918 3300009553 Bacteria 11528
140 Ga0105239_10601876 3300010375 Bacteria 1254
141 Ga0105246_10119736 3300011119 Bacteria 1948
142 Ga0157373_10158407 3300013100 Bacteria 1593
143 Ga0157373_10217751 3300013100 Bacteria 1347
144 Ga0157371_10172880 3300013102 Bacteria 1544
145 Ga0157370_10544943 3300013104 Unclassified 1064
146 Ga0157369_10133680 3300013105 Bacteria 2627
147 Ga0157369_10173438 3300013105 Bacteria 2271
148 Ga0157374_10015436 3300013296 Bacteria 6699
149 Ga0157374_10104070 3300013296 Bacteria 2725
150 Ga0157378_10074649 3300013297 Bacteria 3052
151 Ga0157378_10294509 3300013297 Bacteria 1568
152 Ga0157378_10461016 3300013297 Bacteria 1263
153 Ga0163162_10030851 3300013306 Bacteria 5312
154 Ga0157372_10128430 3300013307 Bacteria 2915
155 Ga0157372_10208140 3300013307 Bacteria 2266
156 Ga0157375_10070022 3300013308 Bacteria 3516
157 Ga0157375_10079272 3300013308 Bacteria 3319
158 Ga0157375_10158568 3300013308 Bacteria 2403
159 Ga0157375_10560290 3300013308 Bacteria 1304
160 Ga0157379_10159414 3300014968 Bacteria 2036
161 Ga0157376_10006847 3300014969 Bacteria 8069
162 Ga0213876_10025465 3300021384 Bacteria 3120
163 Ga0207697_10005910 3300025315 Bacteria 5617
164 Ga0207697_10012963 3300025315 Bacteria 3484
165 Ga0207682_10039362 3300025893 Bacteria 1922
166 Ga0207642_10023912 3300025899 Bacteria 2449
167 Ga0207688_10074884 3300025901 Bacteria 1926
168 Ga0207680_10000626 3300025903 Bacteria 16644
169 Ga0207680_10022086 3300025903 Bacteria 3455
170 Ga0207680_10209572 3300025903 Bacteria 1332
171 Ga0207647_10080596 3300025904 Bacteria 1952
172 Ga0207645_10057703 3300025907 Bacteria 2479
173 Ga0207643_10140304 3300025908 Bacteria 1443
174 Ga0207705_10003304 3300025909 Bacteria 12267
175 Ga0207705_10012711 3300025909 Bacteria 6075
176 Ga0207705_10041654 3300025909 Bacteria 3295
177 Ga0207705_10054915 3300025909 Bacteria 2871
178 Ga0207707_10044736 3300025912 Bacteria 3858
179 Ga0207707_10184242 3300025912 Bacteria 1822
180 Ga0207707_10454913 3300025912 Bacteria 1095
181 Ga0207660_10043612 3300025917 Bacteria 3152
182 Ga0207662_10016498 3300025918 Bacteria 4170
183 Ga0207657_10012844 3300025919 Bacteria 8239
184 Ga0207657_10057473 3300025919 Bacteria 3352
185 Ga0207657_10129172 3300025919 Bacteria 2073
186 Ga0207657_10176455 3300025919 Bacteria 1729
187 Ga0207657_10184898 3300025919 Bacteria 1683
188 Ga0207649_10110934 3300025920 Bacteria 1832
189 Ga0207649_10385781 3300025920 Unclassified 1045
190 Ga0207652_10178437 3300025921 Bacteria 1908
191 Ga0207681_10060388 3300025923 Bacteria 2602
192 Ga0207694_10042511 3300025924 Bacteria 3505
193 Ga0207650_10151432 3300025925 Bacteria 1831
194 Ga0207650_10213186 3300025925 Bacteria 1551
195 Ga0207650_10454344 3300025925 Bacteria 1066
196 Ga0207687_10028127 3300025927 Bacteria 3777
197 Ga0207700_10053695 3300025928 Bacteria 3020
198 Ga0207700_10114775 3300025928 Bacteria 2173
199 Ga0207664_10046409 3300025929 Bacteria 3410
200 Ga0207664_10085224 3300025929 Bacteria 2578
201 Ga0207664_10159646 3300025929 Bacteria 1922
202 Ga0207644_10000324 3300025931 Bacteria 31071
203 Ga0207644_10002762 3300025931 Bacteria 11303
204 Ga0207644_10004177 3300025931 Bacteria 9367
205 Ga0207644_10035072 3300025931 Bacteria 3513
206 Ga0207690_10009242 3300025932 Bacteria 5854
207 Ga0207690_10017186 3300025932 Bacteria 4413
208 Ga0207690_10037075 3300025932 Bacteria 3163
209 Ga0207690_10205024 3300025932 Bacteria 1500
210 Ga0207706_10023239 3300025933 Bacteria 5569
211 Ga0207706_10036925 3300025933 Bacteria 4340
212 Ga0207706_10083142 3300025933 Bacteria 2814
213 Ga0207706_10136238 3300025933 Bacteria 2160
214 Ga0207669_10002475 3300025937 Bacteria 7880
215 Ga0207704_10006465 3300025938 Bacteria 5468
216 Ga0207704_10012434 3300025938 Bacteria 4225
217 Ga0207691_10012965 3300025940 Bacteria 7983
218 Ga0207691_10046627 3300025940 Bacteria 3981
219 Ga0207691_10111605 3300025940 Bacteria 2431
220 Ga0207711_10000610 3300025941 Bacteria 36080
221 Ga0207711_10004237 3300025941 Bacteria 12275
222 Ga0207711_10045486 3300025941 Bacteria 3751
223 Ga0207711_10091797 3300025941 Bacteria 2671
224 Ga0207711_10168741 3300025941 Bacteria 1985
225 Ga0207689_10013632 3300025942 Bacteria 6932
226 Ga0207689_10035418 3300025942 Bacteria 4147
227 Ga0207661_10023404 3300025944 Bacteria 4666
228 Ga0207679_10047713 3300025945 Bacteria 3113
229 Ga0207679_10051304 3300025945 Bacteria 3019
230 Ga0207679_10245529 3300025945 Bacteria 1519
231 Ga0207679_10360228 3300025945 Bacteria 1270
232 Ga0207667_10198336 3300025949 Bacteria 2059
233 Ga0207667_10282156 3300025949 Bacteria 1697
234 Ga0207667_10528715 3300025949 Bacteria 1194
235 Ga0207651_10010295 3300025960 Bacteria 5174
236 Ga0207651_10013637 3300025960 Bacteria 4659
237 Ga0207668_10055921 3300025972 Bacteria 2746
238 Ga0207668_10127975 3300025972 Bacteria 1935
239 Ga0207640_10007011 3300025981 Bacteria 6203
240 Ga0207640_10033174 3300025981 Bacteria 3210
241 Ga0207640_10161200 3300025981 Bacteria 1660
242 Ga0207640_10359070 3300025981 Unclassified 1173
243 Ga0207658_10071721 3300025986 Bacteria 2623
244 Ga0207677_10006702 3300026023 Bacteria 6327
245 Ga0207677_10483059 3300026023 Bacteria 1068
246 Ga0207703_10002355 3300026035 Bacteria 16457
247 Ga0207703_10005452 3300026035 Bacteria 10230
248 Ga0207703_10017409 3300026035 Bacteria 5609
249 Ga0207639_10145000 3300026041 Bacteria 1982
250 Ga0207639_10359520 3300026041 Bacteria 1302
251 Ga0207678_10001860 3300026067 Bacteria 19290
252 Ga0207678_10003690 3300026067 Bacteria 13762
253 Ga0207678_10009227 3300026067 Bacteria 8682
254 Ga0207678_10009524 3300026067 Bacteria 8546
255 Ga0207678_10146222 3300026067 Bacteria 2017
256 Ga0207702_10015146 3300026078 Bacteria 6394
257 Ga0207702_10111693 3300026078 Bacteria 2431
258 Ga0207702_10149598 3300026078 Bacteria 2122
259 Ga0207641_10006264 3300026088 Bacteria 10065
260 Ga0207641_10007303 3300026088 Bacteria 9206
261 Ga0207641_10023601 3300026088 Bacteria 5067
262 Ga0207641_10148648 3300026088 Bacteria 2120
263 Ga0207648_10005426 3300026089 Bacteria 12850
264 Ga0207648_10021875 3300026089 Bacteria 5745
265 Ga0207648_10071003 3300026089 Bacteria 3035
266 Ga0207676_10010195 3300026095 Bacteria 6686
267 Ga0207676_10111115 3300026095 Bacteria 2293
268 Ga0207676_10250712 3300026095 Bacteria 1593
269 Ga0207674_10001919 3300026116 Bacteria 26380
270 Ga0207674_10017244 3300026116 Bacteria 7878
271 Ga0207674_10019181 3300026116 Bacteria 7416
272 Ga0207674_10334523 3300026116 Bacteria 1464
273 Ga0207674_10336597 3300026116 Bacteria 1459
274 Ga0207674_10361248 3300026116 Bacteria 1404
275 Ga0207683_10003409 3300026121 Bacteria 13837
276 Ga0207683_10008253 3300026121 Bacteria 8907
277 Ga0207683_10039007 3300026121 Bacteria 4142
278 Ga0207683_10387590 3300026121 Bacteria 1285
279 Ga0207698_10075100 3300026142 Bacteria 2700
280 Ga0268266_10129420 3300028379 Bacteria 2256
281 Ga0268266_10347059 3300028379 Bacteria 1394
282 Ga0268265_10006414 3300028380 Bacteria 7975
283 Ga0268265_10026202 3300028380 Bacteria 4145
284 Ga0268264_10004911 3300028381 Bacteria 11332
285 Ga0307408_100105482 3300031548 Bacteria 2154
286 Ga0307412_10135549 3300031911 Bacteria 1795
287 Ga0307409_100024942 3300031995 Bacteria 4182
288 Ga0307416_100014810 3300032002 Bacteria 5361
289 Ga0307411_10001101 3300032005 Bacteria 10532
290 Ga0373946_0004744 3300035171 Bacteria 4887
291 Ga0373931_0143317 3300035691 Bacteria 1386
292 Ga0373935_0028014 3300035692 Bacteria 3482
293 Ga0373927_0171980 3300035695 Bacteria 1420
294 Ga0373925_0058073 3300037068 Bacteria 2900
295 Ga0395899_0005102 3300037312 Bacteria 10221
296 Ga0395899_0073941 3300037312 Bacteria 2491
297 Ga0395899_0122926 3300037312 Bacteria 1858
298 Ga0395900_0006142 3300037418 Bacteria 12535
299 Ga0395900_0008388 3300037418 Bacteria 10634
300 Ga0395900_0109096 3300037418 Bacteria 2843
301 Ga0395900_0132766 3300037418 Bacteria 2551
302 Ga0395900_0166842 3300037418 Bacteria 2243
303 Ga0395900_0209278 3300037418 Bacteria 1970
304 Ga0395900_0255292 3300037418 Unclassified 1753
305 Ga0395900_0564381 3300037418 Unclassified 1081
306 Ga0395898_0003482 3300037466 Bacteria 17583
307 Ga0395898_0049447 3300037466 Bacteria 4120
308 Ga0395898_0213030 3300037466 Bacteria 1843
309 Ga0395898_0334443 3300037466 Bacteria 1444
310 Ga0395905_0001408 3300037471 Bacteria 29105
311 Ga0395905_0007203 3300037471 Bacteria 11099
312 Ga0395905_0007351 3300037471 Bacteria 10967
313 Ga0395905_0012884 3300037471 Bacteria 8037
314 Ga0395905_0174504 3300037471 Bacteria 2018
315 Ga0395905_0293204 3300037471 Unclassified 1513
316 Ga0395905_0472257 3300037471 Bacteria 1153
317 Ga0395901_0004432 3300038443 Bacteria 14163
318 Ga0395901_0006471 3300038443 Bacteria 11862
319 Ga0395901_0007258 3300038443 Bacteria 11183
320 Ga0395901_0078196 3300038443 Bacteria 3454
321 Ga0395901_0130697 3300038443 Bacteria 2638
322 Ga0436365_1642997 3300039437 Bacteria 14325
323 Ga0439432_005870 3300042006 Bacteria 4407
324 Ga0439449_0013164 3300042007 Bacteria 3112
325 Ga0439458_0018557 3300042157 Bacteria 1595
326 Ga0466966_0011066 3300044684 Bacteria 5988
327 Ga0466966_0122107 3300044684 Bacteria 1599
328 Ga0466963_0022709 3300044694 Bacteria 3976
329 Ga0466964_0060433 3300044706 Bacteria 1576
330 Ga0466970_0022613 3300044765 Bacteria 3282
331 Ga0466970_0211331 3300044765 Unclassified 1081
332 Ga0466957_0227544 3300044842 Bacteria 1233
333 Ga0466959_0253816 3300045049 Bacteria 1212
334 Ga0466958_0166786 3300045836 Bacteria 1393
335 Ga0466958_0193555 3300045836 Bacteria 1293
336 Ga0466967_0136319 3300045976 Bacteria 2283
337 Ga0466967_0185485 3300045976 Bacteria 1964
338 Ga0495663_0016346 3300046525 Bacteria 2097
339 Ga0495621_0000194 3300046539 Bacteria 14011
340 Ga0495633_0020640 3300046558 Bacteria 3310
341 Ga0495668_0010612 3300046616 Bacteria 5566
342 Ga0495669_0002557 3300046684 Bacteria 7428
343 Ga0495669_0005935 3300046684 Bacteria 5090
344 Ga0495669_0050414 3300046684 Bacteria 1866
345 Ga0496100_0014655 3300048903 Bacteria 4557
346 Ga0496101_0012653 3300048904 Bacteria 5637
347 Ga0496101_0204382 3300048904 Bacteria 1528
348 Ga0496102_0082710 3300048905 Bacteria 2961
349 Ga0496104_0084239 3300048907 Bacteria 3033
350 Ga0496105_0055104 3300048908 Bacteria 3283
351 Ga0496106_0038953 3300048909 Bacteria 3559
352 Ga0496106_0082041 3300048909 Bacteria 2478
353 Ga0496107_0021732 3300048910 Bacteria 4534
354 Ga0496108_0001272 3300048911 Bacteria 19736
355 Ga0496108_0016911 3300048911 Bacteria 5961
356 Ga0496108_0019036 3300048911 Bacteria 5632
357 Ga0496109_0093071 3300048912 Bacteria 2789
358 Ga0496110_0003918 3300048913 Bacteria 11450
359 Ga0496112_0000761 3300048915 Bacteria 22616
360 Ga0496112_0195343 3300048915 Bacteria 1984
361 Ga0496112_0402303 3300048915 Bacteria 1309
362 Ga0496113_0003741 3300048916 Bacteria 9170
363 Ga0496114_0000019 3300048917 Bacteria 244365
364 Ga0501207_018155 3300049654 Bacteria 1104
365 Ga0501209_011301 3300049656 Bacteria 1866
366 Ga0501216_032818 3300049660 Bacteria 966
367 Ga0501239_008027 3300049672 Bacteria 1119
368 Ga0501273_007913 3300049770 Bacteria 1262
369 Ga0466962_0080223 3300061719 Bacteria 1560
370 Ga0070714_100020255
371 JGI24735J21928_10031771
372 JGI24034J26672_10009530
373 Ga0070658_10020575
374 Ga0070658_10151257
375 Ga0070658_10168459
376 Ga0070658_10258719
377 Ga0070676_10302525
378 Ga0070683_100330348
379 Ga0070690_100000784
380 Ga0070690_100001152
381 Ga0070670_100083454
382 Ga0070670_100216862
383 Ga0070670_100516599
384 Ga0070677_10011479
385 Ga0068869_100015636
386 Ga0070666_10000215
387 Ga0070666_10017898
388 Ga0070666_10035608
389 Ga0070666_10263693
390 Ga0070680_100466960
391 Ga0068868_100003281
392 Ga0068868_100403911
393 Ga0070660_100051047
394 Ga0070660_100060639
395 Ga0070660_100397400
396 Ga0070691_10060301
397 Ga0070687_100163893
398 Ga0070661_100082302
399 Ga0070661_100140876
400 Ga0070661_100141357
401 Ga0070661_100229772
402 Ga0070668_100326961
403 Ga0070669_100176071
404 Ga0070675_100026903
405 Ga0070675_100239319
406 Ga0070671_100021559
407 Ga0070671_100026121
408 Ga0070671_100055565
409 Ga0070671_100075186
410 Ga0070671_100318698
411 Ga0070674_100017266
412 Ga0070673_100010506
413 Ga0070673_100023662
414 Ga0070673_100214519
415 Ga0070688_100085263
416 Ga0070659_100008920
417 Ga0070659_100122753
418 Ga0070659_100288017
419 Ga0070659_100301055
420 Ga0070667_100016761
421 Ga0070667_100017923
422 Ga0070667_100024685
423 Ga0070667_100036753
424 Ga0070709_10259952
425 Ga0070714_100078946
426 Ga0070714_100081350
427 Ga0070714_100141888
428 Ga0070714_100207758
429 Ga0070713_100034212
430 Ga0070713_100078067
431 Ga0070713_100443197
432 Ga0070663_100027693
433 Ga0070663_100170107
434 Ga0070663_100295900
435 Ga0070678_100025250
436 Ga0070678_100039741
437 Ga0070678_100053090
438 Ga0070678_100170630
439 Ga0070678_100440170
440 Ga0070662_100015069
441 Ga0070662_100128119
442 Ga0070662_100192832
443 Ga0070662_100265024
444 Ga0068867_100041793
445 Ga0068867_100088130
446 Ga0070679_100169610
447 Ga0070679_100206662
448 Ga0068853_100010924
449 Ga0068853_100018188
450 Ga0068853_100067057
451 Ga0070672_100019010
452 Ga0070672_100043437
453 Ga0070672_100083735
454 Ga0070672_100270599
455 Ga0070696_100239673
456 Ga0070665_100051169
457 Ga0070665_100402517
458 Ga0070665_100420887
459 Ga0070664_100012608
460 Ga0070664_100012706
461 Ga0070664_100016941
462 Ga0070664_100209430
463 Ga0070664_100469703
464 Ga0068857_100029782
465 Ga0068857_100336736
466 Ga0068857_100337120
467 Ga0068854_100060499
468 Ga0068854_100060665
469 Ga0068854_100238217
470 Ga0068856_100211543
471 Ga0068856_100295374
472 Ga0068852_100008630
473 Ga0068852_100025151
474 Ga0068852_100098131
475 Ga0068852_100148960
476 Ga0068859_100008399
477 Ga0068859_100049319
478 Ga0068859_100082322
479 Ga0068864_100004613
480 Ga0068864_100090590
481 Ga0068864_100291354
482 Ga0068866_10054340
483 Ga0068866_10100372
484 Ga0068851_10141238
485 Ga0068863_100007871
486 Ga0068863_100031207
487 Ga0068858_100002324
488 Ga0068858_100005553
489 Ga0068858_100015929
490 Ga0068860_100004627
491 Ga0068862_100053069
492 Ga0068862_100210034
493 Ga0097621_100021240
494 Ga0068871_100081490
495 Ga0068865_100027328
496 Ga0097620_100008399
497 Ga0097620_100049319
498 Ga0097620_100082329
499 Ga0105245_10087793
500 Ga0105245_10099767
501 Ga0105248_10000362
502 Ga0105248_10032101
503 Ga0105248_10167570
504 Ga0105248_10532159
505 Ga0105237_10099102
506 Ga0105238_10046386
507 Ga0105238_10331763
508 Ga0105249_10004918
509 Ga0105239_10601876
510 Ga0105246_10119736
511 Ga0157373_10158407
512 Ga0157373_10217751
513 Ga0157371_10172880
514 Ga0157370_10544943
515 Ga0157369_10133680
516 Ga0157369_10173438
517 Ga0157374_10015436
518 Ga0157374_10104070
519 Ga0157378_10074649
520 Ga0157378_10294509
521 Ga0157378_10461016
522 Ga0163162_10030851
523 Ga0157372_10128430
524 Ga0157372_10208140
525 Ga0157375_10070022
526 Ga0157375_10079272
527 Ga0157375_10158568
528 Ga0157375_10560290
529 Ga0157379_10159414
530 Ga0157376_10006847
531 Ga0213876_10025465
532 Ga0207697_10005910
533 Ga0207697_10012963
534 Ga0207682_10039362
535 Ga0207642_10023912
536 Ga0207688_10074884
537 Ga0207680_10000626
538 Ga0207680_10022086
539 Ga0207680_10209572
540 Ga0207647_10080596
541 Ga0207645_10057703
542 Ga0207643_10140304
543 Ga0207705_10003304
544 Ga0207705_10012711
545 Ga0207705_10041654
546 Ga0207705_10054915
547 Ga0207707_10044736
548 Ga0207707_10184242
549 Ga0207707_10454913
550 Ga0207660_10043612
551 Ga0207662_10016498
552 Ga0207657_10012844
553 Ga0207657_10057473
554 Ga0207657_10129172
555 Ga0207657_10176455
556 Ga0207657_10184898
557 Ga0207649_10110934
558 Ga0207649_10385781
559 Ga0207652_10178437
560 Ga0207681_10060388
561 Ga0207694_10042511
562 Ga0207650_10151432
563 Ga0207650_10213186
564 Ga0207650_10454344
565 Ga0207687_10028127
566 Ga0207700_10053695
567 Ga0207700_10114775
568 Ga0207664_10046409
569 Ga0207664_10085224
570 Ga0207664_10159646
571 Ga0207644_10000324
572 Ga0207644_10002762
573 Ga0207644_10004177
574 Ga0207644_10035072
575 Ga0207690_10009242
576 Ga0207690_10017186
577 Ga0207690_10037075
578 Ga0207690_10205024
579 Ga0207706_10023239
580 Ga0207706_10036925
581 Ga0207706_10083142
582 Ga0207706_10136238
583 Ga0207669_10002475
584 Ga0207704_10006465
585 Ga0207704_10012434
586 Ga0207691_10012965
587 Ga0207691_10046627
588 Ga0207691_10111605
589 Ga0207711_10000610
590 Ga0207711_10004237
591 Ga0207711_10045486
592 Ga0207711_10091797
593 Ga0207711_10168741
594 Ga0207689_10013632
595 Ga0207689_10035418
596 Ga0207661_10023404
597 Ga0207679_10047713
598 Ga0207679_10051304
599 Ga0207679_10245529
600 Ga0207679_10360228
601 Ga0207667_10198336
602 Ga0207667_10282156
603 Ga0207667_10528715
604 Ga0207651_10010295
605 Ga0207651_10013637
606 Ga0207668_10055921
607 Ga0207668_10127975
608 Ga0207640_10007011
609 Ga0207640_10033174
610 Ga0207640_10161200
611 Ga0207640_10359070
612 Ga0207658_10071721
613 Ga0207677_10006702
614 Ga0207677_10483059
615 Ga0207703_10002355
616 Ga0207703_10005452
617 Ga0207703_10017409
618 Ga0207639_10145000
619 Ga0207639_10359520
620 Ga0207678_10001860
621 Ga0207678_10003690
622 Ga0207678_10009227
623 Ga0207678_10009524
624 Ga0207678_10146222
625 Ga0207702_10015146
626 Ga0207702_10111693
627 Ga0207702_10149598
628 Ga0207641_10006264
629 Ga0207641_10007303
630 Ga0207641_10023601
631 Ga0207641_10148648
632 Ga0207648_10005426
633 Ga0207648_10021875
634 Ga0207648_10071003
635 Ga0207676_10010195
636 Ga0207676_10111115
637 Ga0207676_10250712
638 Ga0207674_10001919
639 Ga0207674_10017244
640 Ga0207674_10019181
641 Ga0207674_10334523
642 Ga0207674_10336597
643 Ga0207674_10361248
644 Ga0207683_10003409
645 Ga0207683_10008253
646 Ga0207683_10039007
647 Ga0207683_10387590
648 Ga0207698_10075100
649 Ga0268266_10129420
650 Ga0268266_10347059
651 Ga0268265_10006414
652 Ga0268265_10026202
653 Ga0268264_10004911
654 Ga0307408_100105482
655 Ga0307412_10135549
656 Ga0307409_100024942
657 Ga0307416_100014810
658 Ga0307411_10001101
659 Ga0373946_0004744
660 Ga0373931_0143317
661 Ga0373935_0028014
662 Ga0373927_0171980
663 Ga0373925_0058073
664 Ga0395899_0005102
665 Ga0395899_0073941
666 Ga0395899_0122926
667 Ga0395900_0006142
668 Ga0395900_0008388
669 Ga0395900_0109096
670 Ga0395900_0132766
671 Ga0395900_0166842
672 Ga0395900_0209278
673 Ga0395900_0255292
674 Ga0395900_0564381
675 Ga0395898_0003482
676 Ga0395898_0049447
677 Ga0395898_0213030
678 Ga0395898_0334443
679 Ga0395905_0001408
680 Ga0395905_0007203
681 Ga0395905_0007351
682 Ga0395905_0012884
683 Ga0395905_0174504
684 Ga0395905_0293204
685 Ga0395905_0472257
686 Ga0395901_0004432
687 Ga0395901_0006471
688 Ga0395901_0007258
689 Ga0395901_0078196
690 Ga0395901_0130697
691 Ga0436365_1642997
692 Ga0439432_005870
693 Ga0439449_0013164
694 Ga0439458_0018557
695 Ga0466966_0011066
696 Ga0466966_0122107
697 Ga0466963_0022709
698 Ga0466964_0060433
699 Ga0466970_0022613
700 Ga0466970_0211331
701 Ga0466957_0227544
702 Ga0466959_0253816
703 Ga0466958_0166786
704 Ga0466958_0193555
705 Ga0466967_0136319
706 Ga0466967_0185485
707 Ga0495663_0016346
708 Ga0495621_0000194
709 Ga0495633_0020640
710 Ga0495668_0010612
711 Ga0495669_0002557
712 Ga0495669_0005935
713 Ga0495669_0050414
714 Ga0496100_0014655
715 Ga0496101_0012653
716 Ga0496101_0204382
717 Ga0496102_0082710
718 Ga0496104_0084239
719 Ga0496105_0055104
720 Ga0496106_0038953
721 Ga0496106_0082041
722 Ga0496107_0021732
723 Ga0496108_0001272
724 Ga0496108_0016911
725 Ga0496108_0019036
726 Ga0496109_0093071
727 Ga0496110_0003918
728 Ga0496112_0000761
729 Ga0496112_0195343
730 Ga0496112_0402303
731 Ga0496113_0003741
732 Ga0496114_0000019
733 Ga0501207_018155
734 Ga0501209_011301
735 Ga0501216_032818
736 Ga0501239_008027
737 Ga0501273_007913
738 Ga0466962_0080223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08238

Sel1

Sel1 repeat

52

87

0.97

PF08238

Sel1

Sel1 repeat

120

155

0.94

PF05036

SPOR

SPOR domain

232

304

0.91

PF08238

Sel1

Sel1 repeat

92

119

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ok0-assembly3.cif.gz_C crystal structure of sel1 repeat protein from oxalobacter formigenes 0.9065 31 144
6orc-assembly1.cif.gz_A crystal structure of sel1 repeat protein from oxalobacter formigenes 0.8821 33 154
1ouv-assembly1.cif.gz_A helicobacter cysteine rich protein c (hcpc) 0.8796 10 155
6ok3-assembly1.cif.gz_B crystal structure of sel1 repeat protein from oxalobacter formigenes 0.8707 26 171
4bwr-assembly1.cif.gz_A crystal structure of c5321: a protective antigen present in uropathogenic escherichia coli strains displaying an slr fold 0.8659 10 169
ID Description Score Start End Superfamily
af_G5EFG0_397_474_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9683 27 74 1.25.40.10
af_Q5W6N1_21_82_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9664 26 74 1.25.40.10
af_F4ISY9_62_119_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9565 26 75 1.25.40.10
af_Q94C27_104_187_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9468 41 119 1.25.40.10
af_I1JC67_78_165_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9393 42 119 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A848WEP1-F1-model_v4 Sel1 repeat family protein 0.9749 8 129
AF-A0A7X6WP97-F1-model_v4 deleted 0.9667 14 152
AF-A0A355DZ31-F1-model_v4 Sel1 repeat family protein 0.9662 26 149 GO:0016020
AF-C1N2B9-F1-model_v4 Predicted protein 0.9654 10 160
AF-A0A1C0YVP5-F1-model_v4 Suppressor of lin-12 (Sel-1L) 0.9614 10 155

Map