F424861

General Info

Members Datasets Scaffolds Average Seq Length
368 177 736 110

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_1159923_c1|nmdc:mga08y16_1159923_c1_333_704
Length 123
Sequence MELGMHNDPAEVKKTVRQYLMVGAALFVGTVITVAANQVHLAVPLAITVGLIIATLKGSLVAGVFMHLSHEKKWIYGSLFLTVAFFIVLMMVPFLTIHDTIGTPIHAPGAATHGAAEAGHEGH

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.43
Rhizosphere 94.29
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_1159923_c1 3300050511 Bacteria 745
2 Ga0065704_10797148 3300005289 Bacteria 526
3 Ga0065715_10268030 3300005293 Bacteria 1119
4 Ga0065707_10018539 3300005295 Bacteria 2200
5 Ga0065707_10172434 3300005295 Bacteria 1475
6 Ga0065707_10197348 3300005295 Bacteria 1328
7 Ga0065707_10336368 3300005295 Bacteria 941
8 Ga0065707_10866359 3300005295 Bacteria 577
9 Ga0070676_10058633 3300005328 Bacteria 2282
10 Ga0070690_100163110 3300005330 Bacteria 1529
11 Ga0070690_100589056 3300005330 Bacteria 843
12 Ga0068869_102003685 3300005334 Bacteria 520
13 Ga0070666_10146700 3300005335 Bacteria 1645
14 Ga0070666_10327178 3300005335 Bacteria 1094
15 Ga0070666_10681701 3300005335 Bacteria 753
16 Ga0070666_11121643 3300005335 Bacteria 585
17 Ga0070680_101435093 3300005336 Unclassified 598
18 Ga0068868_100076005 3300005338 Bacteria 2685
19 Ga0068868_100139802 3300005338 Bacteria 1987
20 Ga0068868_100470811 3300005338 Bacteria 1096
21 Ga0068868_100756185 3300005338 Bacteria 874
22 Ga0070689_100115523 3300005340 Bacteria 2139
23 Ga0070689_100134237 3300005340 Bacteria 1986
24 Ga0070687_100033473 3300005343 Bacteria 2538
25 Ga0070687_101304920 3300005343 Unclassified 539
26 Ga0070668_100086888 3300005347 Bacteria 2460
27 Ga0070669_100626744 3300005353 Bacteria 903
28 Ga0070669_100801184 3300005353 Bacteria 801
29 Ga0070675_100581764 3300005354 Bacteria 1014
30 Ga0070671_100164038 3300005355 Bacteria 1878
31 Ga0070671_102000567 3300005355 Bacteria 516
32 Ga0070674_100491086 3300005356 Bacteria 1021
33 Ga0070674_100883841 3300005356 Unclassified 777
34 Ga0070673_100071637 3300005364 Bacteria 2785
35 Ga0070673_100314590 3300005364 Bacteria 1382
36 Ga0070688_100832249 3300005365 Bacteria 724
37 Ga0070659_100404428 3300005366 Bacteria 1153
38 Ga0070667_100230321 3300005367 Bacteria 1652
39 Ga0070710_10662853 3300005437 Bacteria 733
40 Ga0070705_100168931 3300005440 Bacteria 1470
41 Ga0070705_100486313 3300005440 Bacteria 934
42 Ga0070705_101522533 3300005440 Bacteria 561
43 Ga0070694_100622462 3300005444 Unclassified 871
44 Ga0070694_101889117 3300005444 Bacteria 510
45 Ga0070663_101290457 3300005455 Bacteria 644
46 Ga0070678_102401667 3300005456 Bacteria 501
47 Ga0068867_100012807 3300005459 Bacteria 5934
48 Ga0068867_100186083 3300005459 Bacteria 1654
49 Ga0068867_100286765 3300005459 Bacteria 1352
50 Ga0070685_10359941 3300005466 Bacteria 997
51 Ga0070698_100895453 3300005471 Bacteria 833
52 Ga0070698_101443420 3300005471 Bacteria 639
53 Ga0070684_101366076 3300005535 Bacteria 667
54 Ga0068853_100559555 3300005539 Bacteria 1084
55 Ga0070672_100016241 3300005543 Bacteria 5325
56 Ga0070686_100002486 3300005544 Bacteria 10150
57 Ga0070686_100490476 3300005544 Bacteria 952
58 Ga0070686_100610137 3300005544 Bacteria 861
59 Ga0070686_100641884 3300005544 Bacteria 841
60 Ga0070686_101359981 3300005544 Bacteria 595
61 Ga0070696_100675510 3300005546 Bacteria 840
62 Ga0070665_100008701 3300005548 Bacteria 10272
63 Ga0070665_100024772 3300005548 Bacteria 6045
64 Ga0068855_100388237 3300005563 Bacteria 1532
65 Ga0068855_101641088 3300005563 Bacteria 657
66 Ga0070664_101721635 3300005564 Unclassified 594
67 Ga0068857_101744603 3300005577 Bacteria 609
68 Ga0068854_100021646 3300005578 Bacteria 4365
69 Ga0068854_100112789 3300005578 Bacteria 2053
70 Ga0068854_100759006 3300005578 Bacteria 842
71 Ga0070702_101185269 3300005615 Bacteria 615
72 Ga0070702_101409934 3300005615 Bacteria 570
73 Ga0068852_100163187 3300005616 Bacteria 2082
74 Ga0068859_100195942 3300005617 Bacteria 2105
75 Ga0068859_101253972 3300005617 Bacteria 817
76 Ga0068859_101824257 3300005617 Bacteria 672
77 Ga0068859_102999491 3300005617 Bacteria 516
78 Ga0068864_100497590 3300005618 Bacteria 1172
79 Ga0068864_100521025 3300005618 Bacteria 1146
80 Ga0068866_10090411 3300005718 Bacteria 1666
81 Ga0068861_101130881 3300005719 Bacteria 754
82 Ga0068861_101784607 3300005719 Bacteria 610
83 Ga0068870_10254561 3300005840 Bacteria 1090
84 Ga0068863_100140616 3300005841 Unclassified 2307
85 Ga0068863_100518591 3300005841 Bacteria 1175
86 Ga0068863_101242254 3300005841 Bacteria 751
87 Ga0068863_101433118 3300005841 Bacteria 699
88 Ga0068863_102488559 3300005841 Bacteria 527
89 Ga0068858_100021298 3300005842 Bacteria 6055
90 Ga0068858_100172126 3300005842 Bacteria 2042
91 Ga0068858_100182129 3300005842 Bacteria 1984
92 Ga0068858_100637942 3300005842 Bacteria 1035
93 Ga0068858_101496040 3300005842 Bacteria 666
94 Ga0068860_100079376 3300005843 Bacteria 3120
95 Ga0068860_100299197 3300005843 Bacteria 1576
96 Ga0068860_100560044 3300005843 Bacteria 1146
97 Ga0068860_100725367 3300005843 Bacteria 1005
98 Ga0068860_101339702 3300005843 Bacteria 737
99 Ga0081455_10042166 3300005937 Bacteria 4006
100 Ga0081455_10492122 3300005937 Bacteria 826
101 Ga0081540_1064403 3300005983 Bacteria 1729
102 Ga0070717_11666143 3300006028 Unclassified 577
103 Ga0070716_101193462 3300006173 Bacteria 611
104 Ga0097621_100050539 3300006237 Bacteria 3381
105 Ga0097621_100198719 3300006237 Bacteria 1740
106 Ga0097621_100213675 3300006237 Bacteria 1678
107 Ga0068871_100012578 3300006358 Bacteria 6248
108 Ga0068871_100064303 3300006358 Bacteria 3004
109 Ga0068871_100107765 3300006358 Bacteria 2341
110 Ga0068871_100225559 3300006358 Bacteria 1625
111 Ga0075428_100116199 3300006844 Bacteria 2914
112 Ga0075428_100480489 3300006844 Bacteria 1330
113 Ga0075431_100247931 3300006847 Bacteria 1810
114 Ga0075433_10004207 3300006852 Bacteria 11171
115 Ga0075433_10371612 3300006852 Bacteria 1263
116 Ga0075433_11209280 3300006852 Bacteria 656
117 Ga0075433_11270281 3300006852 Unclassified 638
118 Ga0075434_100021223 3300006871 Bacteria 6312
119 Ga0075434_100916316 3300006871 Bacteria 891
120 Ga0075434_101821531 3300006871 Bacteria 615
121 Ga0075434_102535599 3300006871 Bacteria 514
122 Ga0075429_100129856 3300006880 Bacteria 2204
123 Ga0075429_100388746 3300006880 Unclassified 1221
124 Ga0068865_100247886 3300006881 Bacteria 1404
125 Ga0068865_100768591 3300006881 Bacteria 829
126 Ga0068865_101407132 3300006881 Bacteria 623
127 Ga0068865_101615962 3300006881 Bacteria 583
128 Ga0075436_100010393 3300006914 Bacteria 6379
129 Ga0075436_100321548 3300006914 Bacteria 1111
130 Ga0097620_100195915 3300006931 Bacteria 2105
131 Ga0097620_101253960 3300006931 Bacteria 817
132 Ga0097620_101823947 3300006931 Bacteria 672
133 Ga0097620_102999414 3300006931 Bacteria 516
134 Ga0075435_100022377 3300007076 Bacteria 4877
135 Ga0075435_100485047 3300007076 Bacteria 1068
136 Ga0105240_10501759 3300009093 Bacteria 1349
137 Ga0111539_10013059 3300009094 Bacteria 10392
138 Ga0105245_10008265 3300009098 Bacteria 9099
139 Ga0105245_10044442 3300009098 Bacteria 3965
140 Ga0105245_10194588 3300009098 Bacteria 1944
141 Ga0105245_10338044 3300009098 Bacteria 1488
142 Ga0105245_10848612 3300009098 Bacteria 953
143 Ga0105247_10689618 3300009101 Bacteria 768
144 Ga0114129_10001435 3300009147 Bacteria 32173
145 Ga0114129_10022782 3300009147 Bacteria 8880
146 Ga0114129_10045015 3300009147 Bacteria 6206
147 Ga0114129_10113164 3300009147 Bacteria 3742
148 Ga0105243_10447806 3300009148 Bacteria 1211
149 Ga0105243_10924509 3300009148 Bacteria 869
150 Ga0105243_11221434 3300009148 Unclassified 766
151 Ga0105243_12637783 3300009148 Bacteria 542
152 Ga0105241_10037687 3300009174 Bacteria 3642
153 Ga0105241_10866044 3300009174 Bacteria 837
154 Ga0105242_10017552 3300009176 Bacteria 5580
155 Ga0105242_10033222 3300009176 Bacteria 4130
156 Ga0105242_11073736 3300009176 Bacteria 817
157 Ga0105248_10018733 3300009177 Bacteria 7655
158 Ga0105248_10032706 3300009177 Bacteria 5809
159 Ga0105248_10085283 3300009177 Bacteria 3554
160 Ga0105248_10089169 3300009177 Bacteria 3472
161 Ga0105237_10110937 3300009545 Bacteria 2734
162 Ga0105237_10666104 3300009545 Bacteria 1047
163 Ga0105238_10392931 3300009551 Bacteria 1379
164 Ga0105238_11328158 3300009551 Bacteria 745
165 Ga0105238_11405536 3300009551 Bacteria 725
166 Ga0105249_11034232 3300009553 Bacteria 891
167 Ga0105249_12124355 3300009553 Bacteria 634
168 Ga0105239_11987208 3300010375 Bacteria 675
169 Ga0105246_10611202 3300011119 Bacteria 943
170 Ga0157374_10054298 3300013296 Bacteria 3737
171 Ga0157374_11376446 3300013296 Unclassified 728
172 Ga0157374_12040768 3300013296 Bacteria 600
173 Ga0157378_10066721 3300013297 Bacteria 3223
174 Ga0157378_10735217 3300013297 Bacteria 1008
175 Ga0163162_10068005 3300013306 Bacteria 3613
176 Ga0163162_12246285 3300013306 Bacteria 627
177 Ga0163162_13265490 3300013306 Bacteria 520
178 Ga0157375_10111312 3300013308 Bacteria 2837
179 Ga0157375_12941696 3300013308 Unclassified 569
180 Ga0163163_10241674 3300014325 Bacteria 1855
181 Ga0163163_11634810 3300014325 Bacteria 705
182 Ga0163163_12020635 3300014325 Bacteria 636
183 Ga0157380_12361239 3300014326 Bacteria 597
184 Ga0157377_10041426 3300014745 Bacteria 2555
185 Ga0157379_10008200 3300014968 Bacteria 9072
186 Ga0157379_10040273 3300014968 Bacteria 4169
187 Ga0157379_10299413 3300014968 Bacteria 1466
188 Ga0157379_11120164 3300014968 Unclassified 754
189 Ga0157379_11188937 3300014968 Bacteria 733
190 Ga0157379_11629591 3300014968 Bacteria 631
191 Ga0157376_10008296 3300014969 Bacteria 7487
192 Ga0157376_10033860 3300014969 Bacteria 4118
193 Ga0157376_10104160 3300014969 Bacteria 2486
194 Ga0157376_10302406 3300014969 Bacteria 1515
195 Ga0182007_10235126 3300015262 Bacteria 652
196 Ga0163161_10134671 3300017792 Bacteria 1867
197 Ga0207697_10180171 3300025315 Bacteria 926
198 Ga0207697_10289702 3300025315 Bacteria 726
199 Ga0207692_10483709 3300025898 Bacteria 783
200 Ga0207688_10820840 3300025901 Unclassified 589
201 Ga0207680_10149595 3300025903 Bacteria 1555
202 Ga0207680_10463322 3300025903 Bacteria 900
203 Ga0207685_10837551 3300025905 Bacteria 509
204 Ga0207699_10056009 3300025906 Bacteria 2348
205 Ga0207645_10091823 3300025907 Bacteria 1953
206 Ga0207645_10133052 3300025907 Bacteria 1619
207 Ga0207662_10003313 3300025918 Bacteria 8263
208 Ga0207662_10108916 3300025918 Bacteria 1725
209 Ga0207662_10251568 3300025918 Bacteria 1160
210 Ga0207662_10972142 3300025918 Bacteria 602
211 Ga0207646_10938557 3300025922 Bacteria 766
212 Ga0207681_10712802 3300025923 Bacteria 835
213 Ga0207681_11434033 3300025923 Bacteria 579
214 Ga0207659_11288210 3300025926 Bacteria 627
215 Ga0207687_10005201 3300025927 Bacteria 8632
216 Ga0207687_10068617 3300025927 Bacteria 2526
217 Ga0207687_10357708 3300025927 Bacteria 1191
218 Ga0207687_10552722 3300025927 Bacteria 966
219 Ga0207687_10663231 3300025927 Unclassified 883
220 Ga0207644_10031442 3300025931 Bacteria 3698
221 Ga0207644_10210598 3300025931 Bacteria 1537
222 Ga0207644_11502958 3300025931 Bacteria 565
223 Ga0207706_10599034 3300025933 Bacteria 947
224 Ga0207686_10001967 3300025934 Bacteria 11329
225 Ga0207686_10067071 3300025934 Bacteria 2294
226 Ga0207686_10095760 3300025934 Bacteria 1970
227 Ga0207686_10502985 3300025934 Bacteria 940
228 Ga0207686_10531361 3300025934 Bacteria 917
229 Ga0207709_11487641 3300025935 Bacteria 562
230 Ga0207670_10055732 3300025936 Bacteria 2673
231 Ga0207670_10704028 3300025936 Bacteria 836
232 Ga0207669_10185085 3300025937 Bacteria 1497
233 Ga0207669_10735000 3300025937 Bacteria 814
234 Ga0207704_10717899 3300025938 Bacteria 829
235 Ga0207704_10977117 3300025938 Bacteria 715
236 Ga0207665_10681925 3300025939 Bacteria 807
237 Ga0207691_10027126 3300025940 Bacteria 5374
238 Ga0207691_10218420 3300025940 Bacteria 1654
239 Ga0207711_10019243 3300025941 Bacteria 5684
240 Ga0207711_10040651 3300025941 Bacteria 3956
241 Ga0207711_10155461 3300025941 Bacteria 2067
242 Ga0207711_10185737 3300025941 Bacteria 1892
243 Ga0207711_10327526 3300025941 Bacteria 1416
244 Ga0207711_10725686 3300025941 Bacteria 927
245 Ga0207689_10178380 3300025942 Bacteria 1752
246 Ga0207679_10869997 3300025945 Bacteria 824
247 Ga0207679_11091963 3300025945 Bacteria 732
248 Ga0207651_10205573 3300025960 Bacteria 1581
249 Ga0207651_10275714 3300025960 Bacteria 1387
250 Ga0207651_11512461 3300025960 Unclassified 604
251 Ga0207712_10168098 3300025961 Bacteria 1711
252 Ga0207712_11267318 3300025961 Bacteria 658
253 Ga0207640_10015460 3300025981 Bacteria 4418
254 Ga0207640_10082191 3300025981 Bacteria 2205
255 Ga0207640_10622844 3300025981 Bacteria 916
256 Ga0207640_11193396 3300025981 Unclassified 676
257 Ga0207658_10316043 3300025986 Bacteria 1350
258 Ga0207677_10054066 3300026023 Bacteria 2737
259 Ga0207677_10134912 3300026023 Bacteria 1880
260 Ga0207677_10324864 3300026023 Bacteria 1280
261 Ga0207677_10819229 3300026023 Bacteria 834
262 Ga0207677_10843022 3300026023 Bacteria 823
263 Ga0207703_10024929 3300026035 Bacteria 4706
264 Ga0207703_10042300 3300026035 Bacteria 3654
265 Ga0207703_10088300 3300026035 Bacteria 2602
266 Ga0207639_10219335 3300026041 Bacteria 1642
267 Ga0207708_10294735 3300026075 Bacteria 1318
268 Ga0207708_11567635 3300026075 Unclassified 579
269 Ga0207641_10002008 3300026088 Bacteria 19393
270 Ga0207641_10112287 3300026088 Unclassified 2418
271 Ga0207641_10458969 3300026088 Bacteria 1232
272 Ga0207641_10842889 3300026088 Bacteria 908
273 Ga0207641_11932987 3300026088 Bacteria 591
274 Ga0207648_10018889 3300026089 Bacteria 6227
275 Ga0207648_10201095 3300026089 Bacteria 1767
276 Ga0207648_10397428 3300026089 Bacteria 1248
277 Ga0207648_10702419 3300026089 Bacteria 937
278 Ga0207675_100070825 3300026118 Bacteria 3259
279 Ga0207675_100316772 3300026118 Bacteria 1522
280 Ga0207675_100497637 3300026118 Bacteria 1213
281 Ga0207675_101977614 3300026118 Bacteria 601
282 Ga0207675_102241314 3300026118 Bacteria 561
283 Ga0207683_10108486 3300026121 Bacteria 2484
284 Ga0207683_10572893 3300026121 Bacteria 1044
285 Ga0207698_10930077 3300026142 Bacteria 878
286 Ga0207698_11126273 3300026142 Bacteria 798
287 Ga0207428_10080724 3300027907 Bacteria 2540
288 Ga0268266_10006329 3300028379 Bacteria 10851
289 Ga0268266_10057208 3300028379 Bacteria 3355
290 Ga0268265_10619423 3300028380 Bacteria 1037
291 Ga0268264_10182673 3300028381 Bacteria 1906
292 Ga0268264_10487846 3300028381 Bacteria 1199
293 Ga0268264_10509691 3300028381 Bacteria 1174
294 Ga0268264_10549327 3300028381 Bacteria 1133
295 Ga0268264_10739379 3300028381 Bacteria 979
296 Ga0268264_11256429 3300028381 Bacteria 750
297 Ga0373958_0050662 3300034819 Bacteria 876
298 Ga0373929_0162192 3300035085 Bacteria 606
299 Ga0373934_0062530 3300035086 Bacteria 1484
300 Ga0373940_0371549 3300035088 Bacteria 505
301 Ga0373949_0064445 3300035090 Unclassified 949
302 Ga0373953_0462934 3300035117 Bacteria 561
303 Ga0373957_0086039 3300035120 Bacteria 1245
304 Ga0373955_0058325 3300035172 Bacteria 2124
305 Ga0373962_0027962 3300035242 Bacteria 1528
306 Ga0373924_0124636 3300035410 Bacteria 1119
307 Ga0373931_0109925 3300035691 Bacteria 1563
308 Ga0373927_0449543 3300035695 Bacteria 851
309 Ga0373933_1103429 3300035724 Bacteria 523
310 Ga0373937_0516671 3300036401 Bacteria 1135
311 Ga0373937_0625768 3300036401 Bacteria 1021
312 Ga0373937_0742795 3300036401 Bacteria 929
313 Ga0373937_1991936 3300036401 Bacteria 527
314 Ga0451839_1595475 3300041496 Bacteria 583
315 Ga0495629_0307124 3300046459 Bacteria 1086
316 Ga0495629_0349373 3300046459 Bacteria 1009
317 Ga0495580_0910299 3300046472 Bacteria 565
318 Ga0495584_0690840 3300046491 Bacteria 520
319 Ga0495628_0290045 3300046516 Bacteria 1213
320 Ga0495586_0243616 3300046535 Bacteria 1025
321 Ga0495656_0281557 3300046615 Bacteria 848
322 Ga0495647_0052576 3300046681 Bacteria 1587
323 Ga0495658_0510505 3300046683 Bacteria 769
324 Ga0495669_0004209 3300046684 Bacteria 5923
325 Ga0495613_0505179 3300046689 Bacteria 814
326 Ga0495602_0242158 3300048088 Bacteria 1349
327 Ga0496100_0074296 3300048903 Bacteria 2277
328 Ga0496101_0000685 3300048904 Bacteria 20428
329 Ga0496103_0545866 3300048906 Unclassified 740
330 Ga0496105_0042435 3300048908 Bacteria 3750
331 Ga0496106_0066523 3300048909 Bacteria 2745
332 Ga0496106_0526660 3300048909 Unclassified 949
333 Ga0496107_0309762 3300048910 Bacteria 1175
334 Ga0496107_1005409 3300048910 Bacteria 605
335 Ga0496108_0029582 3300048911 Bacteria 4538
336 Ga0496109_0056363 3300048912 Bacteria 3587
337 Ga0496109_0354160 3300048912 Bacteria 1387
338 Ga0496110_0151334 3300048913 Bacteria 2101
339 Ga0496110_0584500 3300048913 Bacteria 1014
340 Ga0496112_0218191 3300048915 Unclassified 1864
341 Ga0496112_0393112 3300048915 Bacteria 1327
342 Ga0496112_1058553 3300048915 Bacteria 730
343 Ga0496114_0070631 3300048917 Bacteria 2933
344 Ga0496114_0127885 3300048917 Bacteria 2192
345 Ga0496115_0368111 3300048918 Bacteria 1170
346 Ga0496115_0546472 3300048918 Bacteria 926
347 nmdc:mga05p37_46505_c1 3300050507 Bacteria 5336
348 nmdc:mga05p37_78239_c1 3300050507 Bacteria 4072
349 nmdc:mga05p37_9103_c1 3300050507 Bacteria 11737
350 nmdc:mga05p37_993178_c1 3300050507 Bacteria 893
351 nmdc:mga09592_145268_c1 3300050508 Bacteria 2045
352 nmdc:mga06r32_208009_c1 3300050510 Bacteria 1945
353 nmdc:mga08y16_52037_c1 3300050511 Bacteria 4285
354 nmdc:mga0n895_108320_c1 3300050512 Bacteria 2793
355 nmdc:mga0n895_1395785_c1 3300050512 Bacteria 669
356 nmdc:mga0n895_1718130_c1 3300050512 Unclassified 590
357 nmdc:mga0n895_195187_c1 3300050512 Bacteria 2055
358 nmdc:mga0n895_1975846_c1 3300050512 Unclassified 541
359 nmdc:mga0rr50_22625_c1 3300050513 Bacteria 4318
360 nmdc:mga0rr50_341682_c1 3300050513 Bacteria 1258
361 nmdc:mga08x19_263107_c1 3300050514 Bacteria 1193
362 nmdc:mga0a205_1014672_c1 3300050515 Bacteria 677
363 nmdc:mga0a205_1231339_c1 3300050515 Unclassified 596
364 nmdc:mga0a205_216591_c1 3300050515 Bacteria 1802
365 nmdc:mga0a205_59591_c1 3300050515 Bacteria 3687
366 Ga0495601_0100577 3300053077 Bacteria 1867
367 Ga0495619_0028066 3300053085 Bacteria 3629
368 Ga0495619_0130958 3300053085 Bacteria 1724
369 nmdc:mga08y16_1159923_c1
370 Ga0065704_10797148
371 Ga0065715_10268030
372 Ga0065707_10018539
373 Ga0065707_10172434
374 Ga0065707_10197348
375 Ga0065707_10336368
376 Ga0065707_10866359
377 Ga0070676_10058633
378 Ga0070690_100163110
379 Ga0070690_100589056
380 Ga0068869_102003685
381 Ga0070666_10146700
382 Ga0070666_10327178
383 Ga0070666_10681701
384 Ga0070666_11121643
385 Ga0070680_101435093
386 Ga0068868_100076005
387 Ga0068868_100139802
388 Ga0068868_100470811
389 Ga0068868_100756185
390 Ga0070689_100115523
391 Ga0070689_100134237
392 Ga0070687_100033473
393 Ga0070687_101304920
394 Ga0070668_100086888
395 Ga0070669_100626744
396 Ga0070669_100801184
397 Ga0070675_100581764
398 Ga0070671_100164038
399 Ga0070671_102000567
400 Ga0070674_100491086
401 Ga0070674_100883841
402 Ga0070673_100071637
403 Ga0070673_100314590
404 Ga0070688_100832249
405 Ga0070659_100404428
406 Ga0070667_100230321
407 Ga0070710_10662853
408 Ga0070705_100168931
409 Ga0070705_100486313
410 Ga0070705_101522533
411 Ga0070694_100622462
412 Ga0070694_101889117
413 Ga0070663_101290457
414 Ga0070678_102401667
415 Ga0068867_100012807
416 Ga0068867_100186083
417 Ga0068867_100286765
418 Ga0070685_10359941
419 Ga0070698_100895453
420 Ga0070698_101443420
421 Ga0070684_101366076
422 Ga0068853_100559555
423 Ga0070672_100016241
424 Ga0070686_100002486
425 Ga0070686_100490476
426 Ga0070686_100610137
427 Ga0070686_100641884
428 Ga0070686_101359981
429 Ga0070696_100675510
430 Ga0070665_100008701
431 Ga0070665_100024772
432 Ga0068855_100388237
433 Ga0068855_101641088
434 Ga0070664_101721635
435 Ga0068857_101744603
436 Ga0068854_100021646
437 Ga0068854_100112789
438 Ga0068854_100759006
439 Ga0070702_101185269
440 Ga0070702_101409934
441 Ga0068852_100163187
442 Ga0068859_100195942
443 Ga0068859_101253972
444 Ga0068859_101824257
445 Ga0068859_102999491
446 Ga0068864_100497590
447 Ga0068864_100521025
448 Ga0068866_10090411
449 Ga0068861_101130881
450 Ga0068861_101784607
451 Ga0068870_10254561
452 Ga0068863_100140616
453 Ga0068863_100518591
454 Ga0068863_101242254
455 Ga0068863_101433118
456 Ga0068863_102488559
457 Ga0068858_100021298
458 Ga0068858_100172126
459 Ga0068858_100182129
460 Ga0068858_100637942
461 Ga0068858_101496040
462 Ga0068860_100079376
463 Ga0068860_100299197
464 Ga0068860_100560044
465 Ga0068860_100725367
466 Ga0068860_101339702
467 Ga0081455_10042166
468 Ga0081455_10492122
469 Ga0081540_1064403
470 Ga0070717_11666143
471 Ga0070716_101193462
472 Ga0097621_100050539
473 Ga0097621_100198719
474 Ga0097621_100213675
475 Ga0068871_100012578
476 Ga0068871_100064303
477 Ga0068871_100107765
478 Ga0068871_100225559
479 Ga0075428_100116199
480 Ga0075428_100480489
481 Ga0075431_100247931
482 Ga0075433_10004207
483 Ga0075433_10371612
484 Ga0075433_11209280
485 Ga0075433_11270281
486 Ga0075434_100021223
487 Ga0075434_100916316
488 Ga0075434_101821531
489 Ga0075434_102535599
490 Ga0075429_100129856
491 Ga0075429_100388746
492 Ga0068865_100247886
493 Ga0068865_100768591
494 Ga0068865_101407132
495 Ga0068865_101615962
496 Ga0075436_100010393
497 Ga0075436_100321548
498 Ga0097620_100195915
499 Ga0097620_101253960
500 Ga0097620_101823947
501 Ga0097620_102999414
502 Ga0075435_100022377
503 Ga0075435_100485047
504 Ga0105240_10501759
505 Ga0111539_10013059
506 Ga0105245_10008265
507 Ga0105245_10044442
508 Ga0105245_10194588
509 Ga0105245_10338044
510 Ga0105245_10848612
511 Ga0105247_10689618
512 Ga0114129_10001435
513 Ga0114129_10022782
514 Ga0114129_10045015
515 Ga0114129_10113164
516 Ga0105243_10447806
517 Ga0105243_10924509
518 Ga0105243_11221434
519 Ga0105243_12637783
520 Ga0105241_10037687
521 Ga0105241_10866044
522 Ga0105242_10017552
523 Ga0105242_10033222
524 Ga0105242_11073736
525 Ga0105248_10018733
526 Ga0105248_10032706
527 Ga0105248_10085283
528 Ga0105248_10089169
529 Ga0105237_10110937
530 Ga0105237_10666104
531 Ga0105238_10392931
532 Ga0105238_11328158
533 Ga0105238_11405536
534 Ga0105249_11034232
535 Ga0105249_12124355
536 Ga0105239_11987208
537 Ga0105246_10611202
538 Ga0157374_10054298
539 Ga0157374_11376446
540 Ga0157374_12040768
541 Ga0157378_10066721
542 Ga0157378_10735217
543 Ga0163162_10068005
544 Ga0163162_12246285
545 Ga0163162_13265490
546 Ga0157375_10111312
547 Ga0157375_12941696
548 Ga0163163_10241674
549 Ga0163163_11634810
550 Ga0163163_12020635
551 Ga0157380_12361239
552 Ga0157377_10041426
553 Ga0157379_10008200
554 Ga0157379_10040273
555 Ga0157379_10299413
556 Ga0157379_11120164
557 Ga0157379_11188937
558 Ga0157379_11629591
559 Ga0157376_10008296
560 Ga0157376_10033860
561 Ga0157376_10104160
562 Ga0157376_10302406
563 Ga0182007_10235126
564 Ga0163161_10134671
565 Ga0207697_10180171
566 Ga0207697_10289702
567 Ga0207692_10483709
568 Ga0207688_10820840
569 Ga0207680_10149595
570 Ga0207680_10463322
571 Ga0207685_10837551
572 Ga0207699_10056009
573 Ga0207645_10091823
574 Ga0207645_10133052
575 Ga0207662_10003313
576 Ga0207662_10108916
577 Ga0207662_10251568
578 Ga0207662_10972142
579 Ga0207646_10938557
580 Ga0207681_10712802
581 Ga0207681_11434033
582 Ga0207659_11288210
583 Ga0207687_10005201
584 Ga0207687_10068617
585 Ga0207687_10357708
586 Ga0207687_10552722
587 Ga0207687_10663231
588 Ga0207644_10031442
589 Ga0207644_10210598
590 Ga0207644_11502958
591 Ga0207706_10599034
592 Ga0207686_10001967
593 Ga0207686_10067071
594 Ga0207686_10095760
595 Ga0207686_10502985
596 Ga0207686_10531361
597 Ga0207709_11487641
598 Ga0207670_10055732
599 Ga0207670_10704028
600 Ga0207669_10185085
601 Ga0207669_10735000
602 Ga0207704_10717899
603 Ga0207704_10977117
604 Ga0207665_10681925
605 Ga0207691_10027126
606 Ga0207691_10218420
607 Ga0207711_10019243
608 Ga0207711_10040651
609 Ga0207711_10155461
610 Ga0207711_10185737
611 Ga0207711_10327526
612 Ga0207711_10725686
613 Ga0207689_10178380
614 Ga0207679_10869997
615 Ga0207679_11091963
616 Ga0207651_10205573
617 Ga0207651_10275714
618 Ga0207651_11512461
619 Ga0207712_10168098
620 Ga0207712_11267318
621 Ga0207640_10015460
622 Ga0207640_10082191
623 Ga0207640_10622844
624 Ga0207640_11193396
625 Ga0207658_10316043
626 Ga0207677_10054066
627 Ga0207677_10134912
628 Ga0207677_10324864
629 Ga0207677_10819229
630 Ga0207677_10843022
631 Ga0207703_10024929
632 Ga0207703_10042300
633 Ga0207703_10088300
634 Ga0207639_10219335
635 Ga0207708_10294735
636 Ga0207708_11567635
637 Ga0207641_10002008
638 Ga0207641_10112287
639 Ga0207641_10458969
640 Ga0207641_10842889
641 Ga0207641_11932987
642 Ga0207648_10018889
643 Ga0207648_10201095
644 Ga0207648_10397428
645 Ga0207648_10702419
646 Ga0207675_100070825
647 Ga0207675_100316772
648 Ga0207675_100497637
649 Ga0207675_101977614
650 Ga0207675_102241314
651 Ga0207683_10108486
652 Ga0207683_10572893
653 Ga0207698_10930077
654 Ga0207698_11126273
655 Ga0207428_10080724
656 Ga0268266_10006329
657 Ga0268266_10057208
658 Ga0268265_10619423
659 Ga0268264_10182673
660 Ga0268264_10487846
661 Ga0268264_10509691
662 Ga0268264_10549327
663 Ga0268264_10739379
664 Ga0268264_11256429
665 Ga0373958_0050662
666 Ga0373929_0162192
667 Ga0373934_0062530
668 Ga0373940_0371549
669 Ga0373949_0064445
670 Ga0373953_0462934
671 Ga0373957_0086039
672 Ga0373955_0058325
673 Ga0373962_0027962
674 Ga0373924_0124636
675 Ga0373931_0109925
676 Ga0373927_0449543
677 Ga0373933_1103429
678 Ga0373937_0516671
679 Ga0373937_0625768
680 Ga0373937_0742795
681 Ga0373937_1991936
682 Ga0451839_1595475
683 Ga0495629_0307124
684 Ga0495629_0349373
685 Ga0495580_0910299
686 Ga0495584_0690840
687 Ga0495628_0290045
688 Ga0495586_0243616
689 Ga0495656_0281557
690 Ga0495647_0052576
691 Ga0495658_0510505
692 Ga0495669_0004209
693 Ga0495613_0505179
694 Ga0495602_0242158
695 Ga0496100_0074296
696 Ga0496101_0000685
697 Ga0496103_0545866
698 Ga0496105_0042435
699 Ga0496106_0066523
700 Ga0496106_0526660
701 Ga0496107_0309762
702 Ga0496107_1005409
703 Ga0496108_0029582
704 Ga0496109_0056363
705 Ga0496109_0354160
706 Ga0496110_0151334
707 Ga0496110_0584500
708 Ga0496112_0218191
709 Ga0496112_0393112
710 Ga0496112_1058553
711 Ga0496114_0070631
712 Ga0496114_0127885
713 Ga0496115_0368111
714 Ga0496115_0546472
715 nmdc:mga05p37_46505_c1
716 nmdc:mga05p37_78239_c1
717 nmdc:mga05p37_9103_c1
718 nmdc:mga05p37_993178_c1
719 nmdc:mga09592_145268_c1
720 nmdc:mga06r32_208009_c1
721 nmdc:mga08y16_52037_c1
722 nmdc:mga0n895_108320_c1
723 nmdc:mga0n895_1395785_c1
724 nmdc:mga0n895_1718130_c1
725 nmdc:mga0n895_195187_c1
726 nmdc:mga0n895_1975846_c1
727 nmdc:mga0rr50_22625_c1
728 nmdc:mga0rr50_341682_c1
729 nmdc:mga08x19_263107_c1
730 nmdc:mga0a205_1014672_c1
731 nmdc:mga0a205_1231339_c1
732 nmdc:mga0a205_216591_c1
733 nmdc:mga0a205_59591_c1
734 Ga0495601_0100577
735 Ga0495619_0028066
736 Ga0495619_0130958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

20

92

0.84

Map