F424768

General Info

Members Datasets Scaffolds Average Seq Length
368 178 736 327

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0036245|Ga0373945_0036245_18_1088
Length 356
Sequence VINLKTAKALGLDDSAIGAGQCRRGDRMRRREFITLLGGAAASWPLAVRAQQGERMRRIGTLTGAAAGDPDAQARQAALIQGLAQLGWVEGRNLRIDARAAAGIADNIRKYAAELVALAPDVIVTGGSAPIELLLRATRTVPIVFTIAPDPVGAGYVKSLARPSGNATGFMMFEYNLSGKWLELLKEIAPSVTRAAVLRDAAITAGIGQFAVIQSVAPSLGVDVSAINLGDAAEIEDAVADFARAPNGGLILTASALATFHRDLIIALAARYKLPAVYISRFYVAGGGLISYGPDFVDQYRRAASYVDRIFKGEKPADLPVQVPTKYELIINLKTAKALGLIVPPSLLSRADEVIE

Samples

Sample ID Description Type Environment
1 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 20.65
Rhizosphere 77.45
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373945_0036245 3300035116 Bacteria 1766
2 Ga0070676_10013195 3300005328 Bacteria 4526
3 Ga0070683_100210007 3300005329 Bacteria 1849
4 Ga0070670_100024865 3300005331 Bacteria 5152
5 Ga0070670_100097218 3300005331 Bacteria 2533
6 Ga0070661_100004466 3300005344 Bacteria 9648
7 Ga0070668_100076320 3300005347 Bacteria 2617
8 Ga0070673_100512689 3300005364 Bacteria 1086
9 Ga0070713_100026819 3300005436 Bacteria 4529
10 Ga0070710_10032675 3300005437 Bacteria 2820
11 Ga0070711_100133537 3300005439 Bacteria 1852
12 Ga0070705_100019734 3300005440 Bacteria 3552
13 Ga0070694_100015417 3300005444 Bacteria 4801
14 Ga0070663_100290161 3300005455 Bacteria 1306
15 Ga0070663_100358170 3300005455 Bacteria 1183
16 Ga0070678_100014717 3300005456 Bacteria 4947
17 Ga0070662_100041807 3300005457 Bacteria 3272
18 Ga0070698_100062180 3300005471 Bacteria 3767
19 Ga0070679_100544118 3300005530 Bacteria 1105
20 Ga0070684_100003755 3300005535 Bacteria 11461
21 Ga0070697_100356756 3300005536 Bacteria 1263
22 Ga0070704_100126284 3300005549 Bacteria 1974
23 Ga0070664_100004596 3300005564 Bacteria 11077
24 Ga0070664_100083257 3300005564 Bacteria 2760
25 Ga0068856_100034837 3300005614 Bacteria 4932
26 Ga0068856_100229492 3300005614 Bacteria 1872
27 Ga0070702_100001431 3300005615 Bacteria 9750
28 Ga0068859_100109070 3300005617 Bacteria 2829
29 Ga0068864_100531474 3300005618 Bacteria 1135
30 Ga0068860_100092703 3300005843 Bacteria 2878
31 Ga0081455_10029984 3300005937 Bacteria 4950
32 Ga0081455_10107502 3300005937 Bacteria 2224
33 Ga0081455_10109822 3300005937 Bacteria 2194
34 Ga0081455_10110374 3300005937 Bacteria 2187
35 Ga0081455_10113870 3300005937 Bacteria 2144
36 Ga0081455_10116357 3300005937 Bacteria 2115
37 Ga0081540_1063265 3300005983 Bacteria 1752
38 Ga0070717_10037473 3300006028 Unclassified 3937
39 Ga0070717_10145569 3300006028 Bacteria 2046
40 Ga0075365_10064426 3300006038 Bacteria 2455
41 Ga0075364_10190216 3300006051 Bacteria 1390
42 Ga0070715_10068421 3300006163 Bacteria 1579
43 Ga0070712_100022015 3300006175 Bacteria 4193
44 Ga0075428_100112587 3300006844 Bacteria 2964
45 Ga0075428_100145344 3300006844 Bacteria 2577
46 Ga0075428_100219477 3300006844 Bacteria 2053
47 Ga0075428_100251621 3300006844 Bacteria 1904
48 Ga0075428_100310359 3300006844 Bacteria 1695
49 Ga0075428_100388287 3300006844 Unclassified 1496
50 Ga0075428_100396895 3300006844 Bacteria 1478
51 Ga0075430_100020860 3300006846 Bacteria 5570
52 Ga0075430_100052400 3300006846 Bacteria 3437
53 Ga0075430_100053341 3300006846 Bacteria 3404
54 Ga0075430_100367047 3300006846 Bacteria 1188
55 Ga0075431_100035472 3300006847 Bacteria 5135
56 Ga0075431_100140072 3300006847 Bacteria 2493
57 Ga0075431_100154164 3300006847 Bacteria 2364
58 Ga0075431_100198490 3300006847 Bacteria 2054
59 Ga0075429_100070160 3300006880 Bacteria 3051
60 Ga0075429_100113925 3300006880 Unclassified 2363
61 Ga0075429_100208422 3300006880 Bacteria 1712
62 Ga0075436_100022503 3300006914 Bacteria 4329
63 Ga0097620_100109072 3300006931 Bacteria 2829
64 Ga0075435_100067215 3300007076 Unclassified 2918
65 Ga0075435_100220449 3300007076 Bacteria 1611
66 Ga0099794_10005092 3300007265 Bacteria 5240
67 Ga0111539_10127558 3300009094 Bacteria 2980
68 Ga0111539_10536971 3300009094 Bacteria 1362
69 Ga0105245_10085898 3300009098 Bacteria 2885
70 Ga0105247_10134581 3300009101 Bacteria 1614
71 Ga0105247_10264153 3300009101 Bacteria 1181
72 Ga0114129_10624013 3300009147 Bacteria 1394
73 Ga0114129_10688007 3300009147 Unclassified 1316
74 Ga0105243_10428880 3300009148 Bacteria 1235
75 Ga0105243_10428928 3300009148 Bacteria 1235
76 Ga0105242_10022894 3300009176 Bacteria 4921
77 Ga0105242_10470660 3300009176 Bacteria 1189
78 Ga0105248_10618881 3300009177 Bacteria 1222
79 Ga0105249_10518224 3300009553 Bacteria 1239
80 Ga0105239_10009363 3300010375 Bacteria 11054
81 Ga0105239_10139702 3300010375 Bacteria 2699
82 Ga0105246_10032091 3300011119 Bacteria 3481
83 Ga0157374_10501417 3300013296 Bacteria 1218
84 Ga0157378_10040350 3300013297 Bacteria 4139
85 Ga0157378_10165600 3300013297 Bacteria 2070
86 Ga0157378_10333155 3300013297 Unclassified 1478
87 Ga0157378_10493584 3300013297 Bacteria 1222
88 Ga0163162_10154172 3300013306 Bacteria 2416
89 Ga0163162_10636123 3300013306 Unclassified 1191
90 Ga0157375_10001714 3300013308 Bacteria 18825
91 Ga0163163_10028952 3300014325 Bacteria 5325
92 Ga0163163_10071069 3300014325 Bacteria 3467
93 Ga0157380_10531948 3300014326 Bacteria 1149
94 Ga0157380_10638754 3300014326 Bacteria 1060
95 Ga0157379_10055702 3300014968 Bacteria 3533
96 Ga0157379_10334536 3300014968 Bacteria 1384
97 Ga0157376_10374222 3300014969 Bacteria 1370
98 Ga0157376_10523163 3300014969 Bacteria 1169
99 Ga0163161_10060015 3300017792 Bacteria 2767
100 Ga0207692_10073218 3300025898 Bacteria 1812
101 Ga0207645_10018983 3300025907 Bacteria 4515
102 Ga0207693_10019810 3300025915 Bacteria 5349
103 Ga0207693_10053197 3300025915 Bacteria 3177
104 Ga0207663_10026088 3300025916 Unclassified 3388
105 Ga0207663_10176020 3300025916 Bacteria 1524
106 Ga0207649_10311729 3300025920 Bacteria 1153
107 Ga0207652_10422656 3300025921 Bacteria 1202
108 Ga0207687_10136816 3300025927 Bacteria 1854
109 Ga0207700_10022879 3300025928 Unclassified 4296
110 Ga0207664_10087541 3300025929 Unclassified 2546
111 Ga0207706_10058634 3300025933 Bacteria 3391
112 Ga0207661_10020500 3300025944 Bacteria 4942
113 Ga0207679_10033810 3300025945 Bacteria 3601
114 Ga0207651_10028738 3300025960 Bacteria 3512
115 Ga0207651_10033741 3300025960 Bacteria 3305
116 Ga0207712_10378849 3300025961 Bacteria 1183
117 Ga0207668_10020583 3300025972 Bacteria 4194
118 Ga0207668_10433966 3300025972 Bacteria 1118
119 Ga0207678_10072380 3300026067 Bacteria 2954
120 Ga0207678_10331177 3300026067 Bacteria 1311
121 Ga0207702_10059958 3300026078 Bacteria 3243
122 Ga0207676_10365830 3300026095 Bacteria 1338
123 Ga0207675_100327225 3300026118 Bacteria 1497
124 Ga0207683_10118536 3300026121 Bacteria 2375
125 Ga0207683_10416301 3300026121 Bacteria 1237
126 Ga0209588_1006011 3300027671 Bacteria 3503
127 Ga0265357_1000752 3300028023 Bacteria 2093
128 Ga0268265_10283446 3300028380 Bacteria 1484
129 Ga0268265_10477277 3300028380 Bacteria 1170
130 Ga0268264_10113702 3300028381 Bacteria 2375
131 Ga0373926_0003644 3300035083 Bacteria 5001
132 Ga0373934_0030819 3300035086 Bacteria 2098
133 Ga0373934_0086648 3300035086 Bacteria 1260
134 Ga0373944_0011066 3300035089 Bacteria 2468
135 Ga0373936_0046853 3300035113 Bacteria 1743
136 Ga0373945_0009455 3300035116 Bacteria 3194
137 Ga0373954_0050891 3300035118 Bacteria 1944
138 Ga0373956_0129132 3300035119 Unclassified 1183
139 Ga0373957_0037303 3300035120 Bacteria 1815
140 Ga0373943_0001886 3300035170 Bacteria 9479
141 Ga0373943_0023695 3300035170 Bacteria 2855
142 Ga0373943_0103120 3300035170 Bacteria 1495
143 Ga0373943_0161703 3300035170 Bacteria 1219
144 Ga0373946_0000527 3300035171 Bacteria 12658
145 Ga0373946_0070059 3300035171 Bacteria 1512
146 Ga0373955_0021459 3300035172 Bacteria 3260
147 Ga0373955_0059751 3300035172 Bacteria 2100
148 Ga0373924_0009128 3300035410 Bacteria 3628
149 Ga0373924_0080957 3300035410 Bacteria 1381
150 Ga0373935_0002621 3300035692 Bacteria 10340
151 Ga0373935_0113346 3300035692 Bacteria 1802
152 Ga0373935_0152841 3300035692 Bacteria 1568
153 Ga0373927_0009155 3300035695 Bacteria 6646
154 Ga0373927_0035638 3300035695 Bacteria 3235
155 Ga0373927_0083676 3300035695 Bacteria 2069
156 Ga0373933_0146312 3300035724 Bacteria 1494
157 Ga0373933_0258156 3300035724 Bacteria 1123
158 Ga0373947_0029196 3300035725 Bacteria 3235
159 Ga0373947_0044434 3300035725 Bacteria 2655
160 Ga0373947_0136722 3300035725 Bacteria 1569
161 Ga0373947_0154442 3300035725 Bacteria 1480
162 Ga0373947_0165694 3300035725 Bacteria 1431
163 Ga0373947_0240271 3300035725 Unclassified 1195
164 Ga0373937_0017964 3300036401 Bacteria 6310
165 Ga0373937_0170778 3300036401 Bacteria 2040
166 Ga0373937_0241870 3300036401 Bacteria 1700
167 Ga0373937_0363159 3300036401 Bacteria 1372
168 Ga0373937_0717958 3300036401 Bacteria 946
169 Ga0373925_0010992 3300037068 Bacteria 6572
170 Ga0373925_0066329 3300037068 Bacteria 2720
171 Ga0373925_0196101 3300037068 Bacteria 1604
172 Ga0373925_0238804 3300037068 Bacteria 1455
173 Ga0395905_0226933 3300037471 Bacteria 1747
174 Ga0395901_0061271 3300038443 Bacteria 3915
175 Ga0495592_0036151 3300046454 Bacteria 3720
176 Ga0495592_0118441 3300046454 Bacteria 1865
177 Ga0495603_0032375 3300046455 Bacteria 3146
178 Ga0495603_0203268 3300046455 Bacteria 1145
179 Ga0495629_0231936 3300046459 Bacteria 1272
180 Ga0495629_0287006 3300046459 Bacteria 1128
181 Ga0495651_0139292 3300046462 Bacteria 1761
182 Ga0495651_0166534 3300046462 Bacteria 1573
183 Ga0495651_0264075 3300046462 Bacteria 1170
184 Ga0495653_0004185 3300046463 Bacteria 11679
185 Ga0495580_0008198 3300046472 Bacteria 8316
186 Ga0495580_0015880 3300046472 Bacteria 5667
187 Ga0495662_0075009 3300046476 Bacteria 1641
188 Ga0495662_0081918 3300046476 Bacteria 1570
189 Ga0495664_0201309 3300046477 Bacteria 1206
190 Ga0495584_0234322 3300046491 Bacteria 933
191 Ga0495585_0021190 3300046492 Bacteria 3734
192 Ga0495594_0222799 3300046499 Unclassified 1076
193 Ga0495608_0002502 3300046511 Bacteria 13180
194 Ga0495608_0174181 3300046511 Bacteria 1363
195 Ga0495618_0043220 3300046514 Bacteria 2842
196 Ga0495618_0061494 3300046514 Bacteria 2382
197 Ga0495618_0211061 3300046514 Bacteria 1227
198 Ga0495628_0055024 3300046516 Bacteria 3134
199 Ga0495628_0132263 3300046516 Bacteria 1907
200 Ga0495630_0027413 3300046517 Bacteria 4226
201 Ga0495630_0080381 3300046517 Bacteria 2459
202 Ga0495630_0121618 3300046517 Bacteria 1980
203 Ga0495631_0102595 3300046518 Bacteria 1231
204 Ga0495644_0004528 3300046523 Bacteria 5461
205 Ga0495666_0030130 3300046526 Bacteria 2665
206 Ga0495652_0028774 3300046529 Bacteria 4885
207 Ga0495652_0255477 3300046529 Bacteria 1296
208 Ga0495665_0050211 3300046531 Bacteria 2211
209 Ga0495640_0019774 3300046533 Bacteria 4967
210 Ga0495640_0044286 3300046533 Bacteria 3095
211 Ga0495640_0080526 3300046533 Bacteria 2165
212 Ga0495586_0095860 3300046535 Bacteria 1642
213 Ga0495586_0114425 3300046535 Bacteria 1503
214 Ga0495587_0069315 3300046536 Bacteria 2053
215 Ga0495587_0091988 3300046536 Bacteria 1751
216 Ga0495598_0008617 3300046537 Bacteria 2382
217 Ga0495645_0031373 3300046543 Bacteria 3872
218 Ga0495667_0010194 3300046559 Bacteria 6360
219 Ga0495667_0185436 3300046559 Bacteria 1334
220 Ga0495656_0011588 3300046615 Bacteria 3238
221 Ga0495656_0195059 3300046615 Bacteria 1002
222 Ga0495634_0018629 3300046642 Bacteria 4939
223 Ga0495634_0067738 3300046642 Bacteria 2360
224 Ga0495635_0005406 3300046663 Bacteria 8882
225 Ga0495635_0022224 3300046663 Bacteria 4417
226 Ga0495635_0033539 3300046663 Bacteria 3561
227 Ga0495635_0121156 3300046663 Bacteria 1784
228 Ga0495635_0122798 3300046663 Bacteria 1771
229 Ga0495657_0010982 3300046675 Bacteria 6792
230 Ga0495657_0017770 3300046675 Bacteria 5160
231 Ga0495599_0021936 3300046678 Bacteria 3985
232 Ga0495623_0168078 3300046679 Bacteria 1283
233 Ga0495623_0175141 3300046679 Bacteria 1250
234 Ga0495646_0009994 3300046680 Bacteria 6033
235 Ga0495646_0026307 3300046680 Bacteria 3654
236 Ga0495646_0061178 3300046680 Bacteria 2243
237 Ga0495647_0015914 3300046681 Bacteria 2641
238 Ga0495613_0177510 3300046689 Bacteria 1509
239 Ga0495613_0222553 3300046689 Bacteria 1324
240 Ga0495624_0018447 3300046690 Bacteria 4666
241 Ga0495624_0066075 3300046690 Bacteria 2258
242 Ga0495624_0157724 3300046690 Bacteria 1387
243 Ga0495589_0049727 3300046794 Bacteria 2075
244 Ga0495600_0130418 3300046809 Bacteria 1634
245 Ga0495600_0145607 3300046809 Bacteria 1535
246 Ga0495581_0010069 3300047315 Bacteria 5468
247 Ga0495581_0157614 3300047315 Bacteria 1327
248 Ga0495581_0204798 3300047315 Bacteria 1154
249 Ga0495604_0047017 3300047317 Bacteria 3363
250 Ga0495604_0058230 3300047317 Bacteria 2967
251 Ga0495674_0048017 3300047319 Bacteria 3780
252 Ga0495674_0225352 3300047319 Bacteria 1548
253 Ga0495676_0237133 3300047321 Unclassified 1250
254 Ga0495676_0298818 3300047321 Bacteria 1086
255 Ga0495680_0016631 3300047322 Bacteria 6311
256 Ga0495680_0080104 3300047322 Bacteria 2468
257 Ga0495675_0000714 3300047444 Bacteria 20736
258 Ga0495684_0039921 3300047471 Bacteria 3598
259 Ga0495684_0130785 3300047471 Bacteria 1885
260 Ga0495684_0237008 3300047471 Bacteria 1332
261 Ga0495593_0075532 3300047673 Bacteria 1747
262 Ga0495593_0096153 3300047673 Bacteria 1522
263 Ga0495602_0038538 3300048088 Bacteria 4417
264 Ga0495602_0257569 3300048088 Bacteria 1296
265 Ga0496100_0012319 3300048903 Bacteria 4898
266 Ga0496100_0031912 3300048903 Bacteria 3279
267 Ga0496100_0176696 3300048903 Bacteria 1542
268 Ga0496100_0323865 3300048903 Bacteria 1158
269 Ga0496101_0002262 3300048904 Bacteria 11759
270 Ga0496102_0001465 3300048905 Bacteria 20862
271 Ga0496102_0073895 3300048905 Unclassified 3133
272 Ga0496102_0148594 3300048905 Unclassified 2200
273 Ga0496102_0344524 3300048905 Bacteria 1403
274 Ga0496102_0376175 3300048905 Bacteria 1337
275 Ga0496102_0528676 3300048905 Bacteria 1102
276 Ga0496104_0036109 3300048907 Bacteria 4617
277 Ga0496104_0042299 3300048907 Bacteria 4275
278 Ga0496104_0047061 3300048907 Bacteria 4064
279 Ga0496104_0054592 3300048907 Bacteria 3776
280 Ga0496104_0060585 3300048907 Bacteria 3585
281 Ga0496104_0065020 3300048907 Bacteria 3461
282 Ga0496104_0075969 3300048907 Bacteria 3199
283 Ga0496104_0077115 3300048907 Bacteria 3175
284 Ga0496104_0081369 3300048907 Bacteria 3089
285 Ga0496104_0103303 3300048907 Bacteria 2730
286 Ga0496104_0155291 3300048907 Bacteria 2196
287 Ga0496104_0182319 3300048907 Bacteria 2010
288 Ga0496104_0339152 3300048907 Bacteria 1416
289 Ga0496105_0046533 3300048908 Bacteria 3581
290 Ga0496105_0047556 3300048908 Bacteria 3540
291 Ga0496105_0055844 3300048908 Bacteria 3260
292 Ga0496105_0056416 3300048908 Bacteria 3242
293 Ga0496105_0089598 3300048908 Bacteria 2541
294 Ga0496105_0126823 3300048908 Bacteria 2104
295 Ga0496105_0167177 3300048908 Bacteria 1804
296 Ga0496105_0338545 3300048908 Bacteria 1203
297 Ga0496106_0002276 3300048909 Bacteria 14319
298 Ga0496106_0006592 3300048909 Bacteria 8595
299 Ga0496106_0100466 3300048909 Unclassified 2243
300 Ga0496106_0168251 3300048909 Bacteria 1736
301 Ga0496106_0239766 3300048909 Bacteria 1449
302 Ga0496106_0342190 3300048909 Unclassified 1201
303 Ga0496107_0008190 3300048910 Bacteria 7228
304 Ga0496107_0114046 3300048910 Bacteria 1988
305 Ga0496107_0167626 3300048910 Bacteria 1629
306 Ga0496108_0025322 3300048911 Bacteria 4889
307 Ga0496108_0128846 3300048911 Bacteria 2174
308 Ga0496108_0242369 3300048911 Bacteria 1568
309 Ga0496108_0264686 3300048911 Bacteria 1496
310 Ga0496108_0269796 3300048911 Bacteria 1481
311 Ga0496109_0006384 3300048912 Bacteria 9925
312 Ga0496109_0037203 3300048912 Bacteria 4397
313 Ga0496109_0080956 3300048912 Bacteria 2992
314 Ga0496109_0086291 3300048912 Bacteria 2898
315 Ga0496109_0269982 3300048912 Bacteria 1602
316 Ga0496109_0339172 3300048912 Bacteria 1419
317 Ga0496110_0000859 3300048913 Bacteria 21434
318 Ga0496110_0034371 3300048913 Bacteria 4391
319 Ga0496110_0038871 3300048913 Bacteria 4142
320 Ga0496110_0047455 3300048913 Bacteria 3761
321 Ga0496110_0069877 3300048913 Bacteria 3110
322 Ga0496110_0335753 3300048913 Bacteria 1377
323 Ga0496110_0362929 3300048913 Bacteria 1320
324 Ga0496111_0066090 3300048914 Bacteria 2625
325 Ga0496111_0109684 3300048914 Bacteria 2032
326 Ga0496112_0007056 3300048915 Bacteria 9925
327 Ga0496112_0023811 3300048915 Bacteria 5857
328 Ga0496112_0083862 3300048915 Bacteria 3152
329 Ga0496112_0102792 3300048915 Bacteria 2827
330 Ga0496112_0112481 3300048915 Bacteria 2693
331 Ga0496112_0122659 3300048915 Bacteria 2569
332 Ga0496113_0009845 3300048916 Bacteria 6293
333 Ga0496113_0040302 3300048916 Bacteria 3441
334 Ga0496113_0108975 3300048916 Bacteria 2153
335 Ga0496113_0292647 3300048916 Bacteria 1303
336 Ga0496113_0323103 3300048916 Bacteria 1237
337 Ga0496114_0029231 3300048917 Bacteria 4528
338 Ga0496114_0082248 3300048917 Bacteria 2721
339 Ga0496114_0220881 3300048917 Bacteria 1663
340 Ga0496115_0001086 3300048918 Bacteria 19681
341 nmdc:mga00v17_222008_c1 3300050491 Bacteria 1223
342 nmdc:mga00v17_56318_c1 3300050491 Bacteria 2403
343 nmdc:mga00v17_94037_c1 3300050491 Bacteria 1457
344 nmdc:mga0yw44_202301_c1 3300050492 Bacteria 1312
345 nmdc:mga0yw44_4570_c1 3300050492 Bacteria 6376
346 nmdc:mga05p37_139418_c1 3300050507 Bacteria 2972
347 nmdc:mga09592_14117_c1 3300050508 Bacteria 6519
348 nmdc:mga09592_270853_c1 3300050508 Bacteria 1473
349 nmdc:mga0qj67_18717_c1 3300050509 Bacteria 5280
350 nmdc:mga0qj67_26526_c1 3300050509 Bacteria 4486
351 nmdc:mga06r32_100491_c1 3300050510 Bacteria 2838
352 nmdc:mga06r32_133757_c1 3300050510 Bacteria 2454
353 nmdc:mga06r32_219453_c1 3300050510 Bacteria 1890
354 nmdc:mga06r32_29140_c1 3300050510 Bacteria 5171
355 nmdc:mga06r32_47642_c1 3300050510 Bacteria 4095
356 nmdc:mga0n895_111227_c1 3300050512 Unclassified 2755
357 nmdc:mga0rr50_135506_c1 3300050513 Bacteria 1976
358 nmdc:mga0rr50_146794_c1 3300050513 Bacteria 1902
359 nmdc:mga08x19_102077_c1 3300050514 Bacteria 1904
360 nmdc:mga08x19_17534_c1 3300050514 Bacteria 4382
361 Ga0495601_0006137 3300053077 Bacteria 7008
362 Ga0495601_0151658 3300053077 Bacteria 1513
363 Ga0495601_0159577 3300053077 Bacteria 1473
364 Ga0495612_0017296 3300053078 Bacteria 2888
365 Ga0495612_0028600 3300053078 Bacteria 2244
366 Ga0495595_0008203 3300053084 Bacteria 4287
367 Ga0495595_0102501 3300053084 Bacteria 1382
368 Ga0495619_0057982 3300053085 Bacteria 2569
369 Ga0373945_0036245
370 Ga0070676_10013195
371 Ga0070683_100210007
372 Ga0070670_100024865
373 Ga0070670_100097218
374 Ga0070661_100004466
375 Ga0070668_100076320
376 Ga0070673_100512689
377 Ga0070713_100026819
378 Ga0070710_10032675
379 Ga0070711_100133537
380 Ga0070705_100019734
381 Ga0070694_100015417
382 Ga0070663_100290161
383 Ga0070663_100358170
384 Ga0070678_100014717
385 Ga0070662_100041807
386 Ga0070698_100062180
387 Ga0070679_100544118
388 Ga0070684_100003755
389 Ga0070697_100356756
390 Ga0070704_100126284
391 Ga0070664_100004596
392 Ga0070664_100083257
393 Ga0068856_100034837
394 Ga0068856_100229492
395 Ga0070702_100001431
396 Ga0068859_100109070
397 Ga0068864_100531474
398 Ga0068860_100092703
399 Ga0081455_10029984
400 Ga0081455_10107502
401 Ga0081455_10109822
402 Ga0081455_10110374
403 Ga0081455_10113870
404 Ga0081455_10116357
405 Ga0081540_1063265
406 Ga0070717_10037473
407 Ga0070717_10145569
408 Ga0075365_10064426
409 Ga0075364_10190216
410 Ga0070715_10068421
411 Ga0070712_100022015
412 Ga0075428_100112587
413 Ga0075428_100145344
414 Ga0075428_100219477
415 Ga0075428_100251621
416 Ga0075428_100310359
417 Ga0075428_100388287
418 Ga0075428_100396895
419 Ga0075430_100020860
420 Ga0075430_100052400
421 Ga0075430_100053341
422 Ga0075430_100367047
423 Ga0075431_100035472
424 Ga0075431_100140072
425 Ga0075431_100154164
426 Ga0075431_100198490
427 Ga0075429_100070160
428 Ga0075429_100113925
429 Ga0075429_100208422
430 Ga0075436_100022503
431 Ga0097620_100109072
432 Ga0075435_100067215
433 Ga0075435_100220449
434 Ga0099794_10005092
435 Ga0111539_10127558
436 Ga0111539_10536971
437 Ga0105245_10085898
438 Ga0105247_10134581
439 Ga0105247_10264153
440 Ga0114129_10624013
441 Ga0114129_10688007
442 Ga0105243_10428880
443 Ga0105243_10428928
444 Ga0105242_10022894
445 Ga0105242_10470660
446 Ga0105248_10618881
447 Ga0105249_10518224
448 Ga0105239_10009363
449 Ga0105239_10139702
450 Ga0105246_10032091
451 Ga0157374_10501417
452 Ga0157378_10040350
453 Ga0157378_10165600
454 Ga0157378_10333155
455 Ga0157378_10493584
456 Ga0163162_10154172
457 Ga0163162_10636123
458 Ga0157375_10001714
459 Ga0163163_10028952
460 Ga0163163_10071069
461 Ga0157380_10531948
462 Ga0157380_10638754
463 Ga0157379_10055702
464 Ga0157379_10334536
465 Ga0157376_10374222
466 Ga0157376_10523163
467 Ga0163161_10060015
468 Ga0207692_10073218
469 Ga0207645_10018983
470 Ga0207693_10019810
471 Ga0207693_10053197
472 Ga0207663_10026088
473 Ga0207663_10176020
474 Ga0207649_10311729
475 Ga0207652_10422656
476 Ga0207687_10136816
477 Ga0207700_10022879
478 Ga0207664_10087541
479 Ga0207706_10058634
480 Ga0207661_10020500
481 Ga0207679_10033810
482 Ga0207651_10028738
483 Ga0207651_10033741
484 Ga0207712_10378849
485 Ga0207668_10020583
486 Ga0207668_10433966
487 Ga0207678_10072380
488 Ga0207678_10331177
489 Ga0207702_10059958
490 Ga0207676_10365830
491 Ga0207675_100327225
492 Ga0207683_10118536
493 Ga0207683_10416301
494 Ga0209588_1006011
495 Ga0265357_1000752
496 Ga0268265_10283446
497 Ga0268265_10477277
498 Ga0268264_10113702
499 Ga0373926_0003644
500 Ga0373934_0030819
501 Ga0373934_0086648
502 Ga0373944_0011066
503 Ga0373936_0046853
504 Ga0373945_0009455
505 Ga0373954_0050891
506 Ga0373956_0129132
507 Ga0373957_0037303
508 Ga0373943_0001886
509 Ga0373943_0023695
510 Ga0373943_0103120
511 Ga0373943_0161703
512 Ga0373946_0000527
513 Ga0373946_0070059
514 Ga0373955_0021459
515 Ga0373955_0059751
516 Ga0373924_0009128
517 Ga0373924_0080957
518 Ga0373935_0002621
519 Ga0373935_0113346
520 Ga0373935_0152841
521 Ga0373927_0009155
522 Ga0373927_0035638
523 Ga0373927_0083676
524 Ga0373933_0146312
525 Ga0373933_0258156
526 Ga0373947_0029196
527 Ga0373947_0044434
528 Ga0373947_0136722
529 Ga0373947_0154442
530 Ga0373947_0165694
531 Ga0373947_0240271
532 Ga0373937_0017964
533 Ga0373937_0170778
534 Ga0373937_0241870
535 Ga0373937_0363159
536 Ga0373937_0717958
537 Ga0373925_0010992
538 Ga0373925_0066329
539 Ga0373925_0196101
540 Ga0373925_0238804
541 Ga0395905_0226933
542 Ga0395901_0061271
543 Ga0495592_0036151
544 Ga0495592_0118441
545 Ga0495603_0032375
546 Ga0495603_0203268
547 Ga0495629_0231936
548 Ga0495629_0287006
549 Ga0495651_0139292
550 Ga0495651_0166534
551 Ga0495651_0264075
552 Ga0495653_0004185
553 Ga0495580_0008198
554 Ga0495580_0015880
555 Ga0495662_0075009
556 Ga0495662_0081918
557 Ga0495664_0201309
558 Ga0495584_0234322
559 Ga0495585_0021190
560 Ga0495594_0222799
561 Ga0495608_0002502
562 Ga0495608_0174181
563 Ga0495618_0043220
564 Ga0495618_0061494
565 Ga0495618_0211061
566 Ga0495628_0055024
567 Ga0495628_0132263
568 Ga0495630_0027413
569 Ga0495630_0080381
570 Ga0495630_0121618
571 Ga0495631_0102595
572 Ga0495644_0004528
573 Ga0495666_0030130
574 Ga0495652_0028774
575 Ga0495652_0255477
576 Ga0495665_0050211
577 Ga0495640_0019774
578 Ga0495640_0044286
579 Ga0495640_0080526
580 Ga0495586_0095860
581 Ga0495586_0114425
582 Ga0495587_0069315
583 Ga0495587_0091988
584 Ga0495598_0008617
585 Ga0495645_0031373
586 Ga0495667_0010194
587 Ga0495667_0185436
588 Ga0495656_0011588
589 Ga0495656_0195059
590 Ga0495634_0018629
591 Ga0495634_0067738
592 Ga0495635_0005406
593 Ga0495635_0022224
594 Ga0495635_0033539
595 Ga0495635_0121156
596 Ga0495635_0122798
597 Ga0495657_0010982
598 Ga0495657_0017770
599 Ga0495599_0021936
600 Ga0495623_0168078
601 Ga0495623_0175141
602 Ga0495646_0009994
603 Ga0495646_0026307
604 Ga0495646_0061178
605 Ga0495647_0015914
606 Ga0495613_0177510
607 Ga0495613_0222553
608 Ga0495624_0018447
609 Ga0495624_0066075
610 Ga0495624_0157724
611 Ga0495589_0049727
612 Ga0495600_0130418
613 Ga0495600_0145607
614 Ga0495581_0010069
615 Ga0495581_0157614
616 Ga0495581_0204798
617 Ga0495604_0047017
618 Ga0495604_0058230
619 Ga0495674_0048017
620 Ga0495674_0225352
621 Ga0495676_0237133
622 Ga0495676_0298818
623 Ga0495680_0016631
624 Ga0495680_0080104
625 Ga0495675_0000714
626 Ga0495684_0039921
627 Ga0495684_0130785
628 Ga0495684_0237008
629 Ga0495593_0075532
630 Ga0495593_0096153
631 Ga0495602_0038538
632 Ga0495602_0257569
633 Ga0496100_0012319
634 Ga0496100_0031912
635 Ga0496100_0176696
636 Ga0496100_0323865
637 Ga0496101_0002262
638 Ga0496102_0001465
639 Ga0496102_0073895
640 Ga0496102_0148594
641 Ga0496102_0344524
642 Ga0496102_0376175
643 Ga0496102_0528676
644 Ga0496104_0036109
645 Ga0496104_0042299
646 Ga0496104_0047061
647 Ga0496104_0054592
648 Ga0496104_0060585
649 Ga0496104_0065020
650 Ga0496104_0075969
651 Ga0496104_0077115
652 Ga0496104_0081369
653 Ga0496104_0103303
654 Ga0496104_0155291
655 Ga0496104_0182319
656 Ga0496104_0339152
657 Ga0496105_0046533
658 Ga0496105_0047556
659 Ga0496105_0055844
660 Ga0496105_0056416
661 Ga0496105_0089598
662 Ga0496105_0126823
663 Ga0496105_0167177
664 Ga0496105_0338545
665 Ga0496106_0002276
666 Ga0496106_0006592
667 Ga0496106_0100466
668 Ga0496106_0168251
669 Ga0496106_0239766
670 Ga0496106_0342190
671 Ga0496107_0008190
672 Ga0496107_0114046
673 Ga0496107_0167626
674 Ga0496108_0025322
675 Ga0496108_0128846
676 Ga0496108_0242369
677 Ga0496108_0264686
678 Ga0496108_0269796
679 Ga0496109_0006384
680 Ga0496109_0037203
681 Ga0496109_0080956
682 Ga0496109_0086291
683 Ga0496109_0269982
684 Ga0496109_0339172
685 Ga0496110_0000859
686 Ga0496110_0034371
687 Ga0496110_0038871
688 Ga0496110_0047455
689 Ga0496110_0069877
690 Ga0496110_0335753
691 Ga0496110_0362929
692 Ga0496111_0066090
693 Ga0496111_0109684
694 Ga0496112_0007056
695 Ga0496112_0023811
696 Ga0496112_0083862
697 Ga0496112_0102792
698 Ga0496112_0112481
699 Ga0496112_0122659
700 Ga0496113_0009845
701 Ga0496113_0040302
702 Ga0496113_0108975
703 Ga0496113_0292647
704 Ga0496113_0323103
705 Ga0496114_0029231
706 Ga0496114_0082248
707 Ga0496114_0220881
708 Ga0496115_0001086
709 nmdc:mga00v17_222008_c1
710 nmdc:mga00v17_56318_c1
711 nmdc:mga00v17_94037_c1
712 nmdc:mga0yw44_202301_c1
713 nmdc:mga0yw44_4570_c1
714 nmdc:mga05p37_139418_c1
715 nmdc:mga09592_14117_c1
716 nmdc:mga09592_270853_c1
717 nmdc:mga0qj67_18717_c1
718 nmdc:mga0qj67_26526_c1
719 nmdc:mga06r32_100491_c1
720 nmdc:mga06r32_133757_c1
721 nmdc:mga06r32_219453_c1
722 nmdc:mga06r32_29140_c1
723 nmdc:mga06r32_47642_c1
724 nmdc:mga0n895_111227_c1
725 nmdc:mga0rr50_135506_c1
726 nmdc:mga0rr50_146794_c1
727 nmdc:mga08x19_102077_c1
728 nmdc:mga08x19_17534_c1
729 Ga0495601_0006137
730 Ga0495601_0151658
731 Ga0495601_0159577
732 Ga0495612_0017296
733 Ga0495612_0028600
734 Ga0495595_0008203
735 Ga0495595_0102501
736 Ga0495619_0057982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

68

355

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8964 29 328
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8916 29 327
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8907 29 328
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8831 29 327
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8749 32 328
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8928 151 328 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8755 151 328 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8699 151 327 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8477 151 327 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8305 32 299 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537NV14-F1-model_v4 ABC transporter substrate-binding protein 0.9911 64 329
AF-A0A537NV14-F1-model_v4 ABC transporter substrate-binding protein 0.9874 64 329
AF-A0A537MMK8-F1-model_v4 ABC transporter substrate-binding protein 0.9672 150 329
AF-A0A537NR15-F1-model_v4 ABC transporter substrate-binding protein 0.9632 189 329
AF-A0A537QMJ9-F1-model_v4 ABC transporter substrate-binding protein 0.961 42 329

Map