F424584

General Info

Members Datasets Scaffolds Average Seq Length
368 177 736 161

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100003580|Ga0070689_1000035803
Length 178
Sequence MRYFFKQMAKTKNQKSKIKNPLVSIIMGSTSDWETMRNASDILNDFGVAHETKVVSAHRTPDLLFEFAKTAESRGIEVIIAGAGGAAHLPGMCASQTVLPVLGVPVQSKALSGMDSLLSIVQMPFGVPVGTLAIGTAGAKNAALFAISILANSRKDLRKKLHEFRNEQTQTVLDSELI

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
168 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
169 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
173 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 1.9
Rhizosphere 96.47
Stem 0
Stem Tuber 0
Unclassified 12.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100003580 3300005340 Bacteria 10351
2 LJQas_1000149 3300000549 Bacteria 12392
3 Ga0065704_10147246 3300005289 Bacteria 1460
4 Ga0065704_10178734 3300005289 Bacteria 1249
5 Ga0065712_10283886 3300005290 Bacteria 890
6 Ga0065715_10433327 3300005293 Bacteria 842
7 Ga0065707_10156784 3300005295 Bacteria 1601
8 Ga0070658_10016341 3300005327 Bacteria 5940
9 Ga0070658_10041767 3300005327 Bacteria 3700
10 Ga0070658_10974690 3300005327 Unclassified 737
11 Ga0070676_10078978 3300005328 Bacteria 1992
12 Ga0070676_10528120 3300005328 Bacteria 842
13 Ga0070683_100355181 3300005329 Bacteria 1396
14 Ga0070690_100047814 3300005330 Bacteria 2722
15 Ga0070670_100011684 3300005331 Bacteria 7511
16 Ga0070670_100022580 3300005331 Bacteria 5414
17 Ga0070670_100079038 3300005331 Bacteria 2826
18 Ga0070670_100593124 3300005331 Bacteria 991
19 Ga0070677_10055256 3300005333 Bacteria 1620
20 Ga0070680_100441086 3300005336 Bacteria 1112
21 Ga0070682_100090045 3300005337 Unclassified 2005
22 Ga0070682_100597260 3300005337 Bacteria 871
23 Ga0070660_100006301 3300005339 Bacteria 8215
24 Ga0070689_100322397 3300005340 Bacteria 1290
25 Ga0070687_100070231 3300005343 Bacteria 1878
26 Ga0070675_100054893 3300005354 Bacteria 3279
27 Ga0070675_100139523 3300005354 Bacteria 2071
28 Ga0070675_100404417 3300005354 Bacteria 1218
29 Ga0070675_100483488 3300005354 Bacteria 1114
30 Ga0070671_100016257 3300005355 Bacteria 6018
31 Ga0070671_100104060 3300005355 Bacteria 2382
32 Ga0070671_100200812 3300005355 Bacteria 1690
33 Ga0070671_101514837 3300005355 Bacteria 594
34 Ga0070674_100114370 3300005356 Bacteria 1987
35 Ga0070673_100210258 3300005364 Bacteria 1680
36 Ga0070673_100823663 3300005364 Bacteria 858
37 Ga0070673_101020344 3300005364 Bacteria 771
38 Ga0070688_100007346 3300005365 Bacteria 5938
39 Ga0070659_100072029 3300005366 Unclassified 2749
40 Ga0070659_101452854 3300005366 Bacteria 610
41 Ga0070667_100070525 3300005367 Bacteria 2974
42 Ga0070667_100085977 3300005367 Bacteria 2698
43 Ga0070667_100446624 3300005367 Bacteria 1181
44 Ga0070700_100096590 3300005441 Bacteria 1939
45 Ga0070694_100189933 3300005444 Bacteria 1525
46 Ga0070708_100551429 3300005445 Bacteria 1087
47 Ga0070663_100129781 3300005455 Bacteria 1913
48 Ga0070663_100938923 3300005455 Bacteria 749
49 Ga0070678_100052320 3300005456 Bacteria 2965
50 Ga0070678_100841112 3300005456 Bacteria 836
51 Ga0070662_100023215 3300005457 Unclassified 4259
52 Ga0070662_100314171 3300005457 Bacteria 1276
53 Ga0070662_100608154 3300005457 Bacteria 920
54 Ga0070681_10008047 3300005458 Bacteria 10320
55 Ga0070681_10082918 3300005458 Unclassified 3160
56 Ga0070681_11015444 3300005458 Bacteria 749
57 Ga0068867_101117261 3300005459 Bacteria 720
58 Ga0070685_10020061 3300005466 Unclassified 3614
59 Ga0070679_100097846 3300005530 Unclassified 2922
60 Ga0070679_100506825 3300005530 Bacteria 1151
61 Ga0070679_100528597 3300005530 Bacteria 1123
62 Ga0070684_100212837 3300005535 Bacteria 1762
63 Ga0070684_100879377 3300005535 Bacteria 839
64 Ga0068853_100066330 3300005539 Unclassified 3134
65 Ga0068853_100584111 3300005539 Bacteria 1060
66 Ga0070672_100147490 3300005543 Bacteria 1945
67 Ga0070672_100236829 3300005543 Bacteria 1534
68 Ga0070672_100488439 3300005543 Bacteria 1064
69 Ga0070686_100062187 3300005544 Bacteria 2415
70 Ga0070686_100737526 3300005544 Bacteria 789
71 Ga0070695_100654463 3300005545 Bacteria 830
72 Ga0068855_100378537 3300005563 Bacteria 1554
73 Ga0070664_100029247 3300005564 Unclassified 4593
74 Ga0070664_100107066 3300005564 Bacteria 2437
75 Ga0070664_100294202 3300005564 Unclassified 1466
76 Ga0070664_100780509 3300005564 Bacteria 893
77 Ga0068857_100049101 3300005577 Unclassified 3745
78 Ga0068857_100123049 3300005577 Unclassified 2337
79 Ga0068854_100042779 3300005578 Unclassified 3208
80 Ga0068854_100777941 3300005578 Bacteria 832
81 Ga0068856_100922304 3300005614 Bacteria 892
82 Ga0070702_100062041 3300005615 Bacteria 2178
83 Ga0068852_100142275 3300005616 Bacteria 2221
84 Ga0068852_100164697 3300005616 Bacteria 2073
85 Ga0068852_100182139 3300005616 Unclassified 1976
86 Ga0068852_100246649 3300005616 Bacteria 1709
87 Ga0068852_100271037 3300005616 Bacteria 1633
88 Ga0068859_100007860 3300005617 Bacteria 10824
89 Ga0068859_100008333 3300005617 Bacteria 10505
90 Ga0068859_100025422 3300005617 Bacteria 5939
91 Ga0068859_100313440 3300005617 Bacteria 1662
92 Ga0068864_100042593 3300005618 Bacteria 3885
93 Ga0068864_100104551 3300005618 Bacteria 2515
94 Ga0068864_100123497 3300005618 Bacteria 2317
95 Ga0068864_100856996 3300005618 Bacteria 895
96 Ga0068861_100042010 3300005719 Bacteria 3426
97 Ga0068861_100106354 3300005719 Bacteria 2241
98 Ga0068861_100175548 3300005719 Bacteria 1779
99 Ga0068861_100980945 3300005719 Bacteria 805
100 Ga0068861_101136254 3300005719 Bacteria 752
101 Ga0068870_10027811 3300005840 Bacteria 2833
102 Ga0068863_100053075 3300005841 Bacteria 3841
103 Ga0068858_100029636 3300005842 Bacteria 5083
104 Ga0068858_100074899 3300005842 Bacteria 3143
105 Ga0068858_101383809 3300005842 Bacteria 693
106 Ga0068860_100010789 3300005843 Bacteria 9018
107 Ga0068860_100037822 3300005843 Bacteria 4618
108 Ga0068860_100055958 3300005843 Unclassified 3750
109 Ga0068862_100153097 3300005844 Bacteria 2053
110 Ga0068862_100376946 3300005844 Bacteria 1322
111 Ga0068862_100674941 3300005844 Bacteria 999
112 Ga0097621_100476680 3300006237 Bacteria 1127
113 Ga0097621_100519358 3300006237 Bacteria 1081
114 Ga0097621_100717024 3300006237 Bacteria 922
115 Ga0068871_100031619 3300006358 Bacteria 4175
116 Ga0068871_100203125 3300006358 Bacteria 1711
117 Ga0097620_100007859 3300006931 Bacteria 10824
118 Ga0097620_100008333 3300006931 Bacteria 10505
119 Ga0097620_100025422 3300006931 Bacteria 5939
120 Ga0097620_100313451 3300006931 Bacteria 1662
121 Ga0105251_10031991 3300009011 Bacteria 2626
122 Ga0105240_10086419 3300009093 Bacteria 3841
123 Ga0111539_10284137 3300009094 Bacteria 1926
124 Ga0105245_11964942 3300009098 Bacteria 638
125 Ga0105247_10050365 3300009101 Bacteria 2563
126 Ga0105241_10100751 3300009174 Unclassified 2296
127 Ga0105248_10017235 3300009177 Bacteria 7960
128 Ga0105248_10064410 3300009177 Bacteria 4116
129 Ga0105248_10102827 3300009177 Bacteria 3220
130 Ga0105237_10007128 3300009545 Bacteria 12280
131 Ga0105238_11476598 3300009551 Bacteria 708
132 Ga0105249_10044357 3300009553 Bacteria 4044
133 Ga0105249_10058653 3300009553 Bacteria 3528
134 Ga0105249_10193833 3300009553 Unclassified 1985
135 Ga0105249_10194453 3300009553 Bacteria 1982
136 Ga0105249_10361046 3300009553 Bacteria 1474
137 Ga0105239_10151489 3300010375 Bacteria 2588
138 Ga0157373_10004741 3300013100 Bacteria 10231
139 Ga0157373_10124828 3300013100 Bacteria 1810
140 Ga0157370_10157273 3300013104 Unclassified 2115
141 Ga0157369_10305886 3300013105 Bacteria 1653
142 Ga0157374_10040480 3300013296 Bacteria 4292
143 Ga0157374_10144326 3300013296 Bacteria 2312
144 Ga0157378_10016180 3300013297 Bacteria 6532
145 Ga0157378_10048487 3300013297 Bacteria 3777
146 Ga0163162_10081195 3300013306 Bacteria 3312
147 Ga0163162_10162132 3300013306 Bacteria 2358
148 Ga0163162_10257026 3300013306 Bacteria 1878
149 Ga0163162_10894765 3300013306 Bacteria 1001
150 Ga0163162_11175836 3300013306 Bacteria 870
151 Ga0163162_11210802 3300013306 Bacteria 857
152 Ga0163162_11649182 3300013306 Bacteria 732
153 Ga0157372_10019809 3300013307 Bacteria 7250
154 Ga0157372_10033481 3300013307 Bacteria 5645
155 Ga0157375_10096660 3300013308 Unclassified 3027
156 Ga0157375_10197771 3300013308 Unclassified 2165
157 Ga0157375_10355230 3300013308 Bacteria 1631
158 Ga0157375_11145662 3300013308 Bacteria 911
159 Ga0163163_10233407 3300014325 Bacteria 1889
160 Ga0163163_10837940 3300014325 Bacteria 983
161 Ga0157380_10135574 3300014326 Bacteria 2106
162 Ga0157380_10257957 3300014326 Bacteria 1582
163 Ga0157377_10597141 3300014745 Bacteria 787
164 Ga0157379_10206729 3300014968 Bacteria 1776
165 Ga0157376_10196502 3300014969 Bacteria 1853
166 Ga0157376_10220044 3300014969 Bacteria 1758
167 Ga0157376_10516753 3300014969 Bacteria 1176
168 Ga0163161_10002102 3300017792 Bacteria 14422
169 Ga0163161_10105648 3300017792 Bacteria 2101
170 Ga0163161_10205224 3300017792 Bacteria 1520
171 Ga0213876_10126205 3300021384 Bacteria 1359
172 Ga0207697_10056299 3300025315 Bacteria 1631
173 Ga0207682_10049826 3300025893 Bacteria 1730
174 Ga0207682_10095399 3300025893 Bacteria 1295
175 Ga0207710_10007652 3300025900 Unclassified 4570
176 Ga0207647_10083555 3300025904 Bacteria 1912
177 Ga0207645_10047751 3300025907 Bacteria 2733
178 Ga0207643_10027070 3300025908 Bacteria 3178
179 Ga0207705_10019661 3300025909 Bacteria 4829
180 Ga0207705_10260366 3300025909 Bacteria 1324
181 Ga0207707_10013585 3300025912 Bacteria 7099
182 Ga0207707_10140400 3300025912 Unclassified 2112
183 Ga0207695_11430907 3300025913 Bacteria 572
184 Ga0207671_10644227 3300025914 Bacteria 844
185 Ga0207657_10020007 3300025919 Bacteria 6340
186 Ga0207649_10165110 3300025920 Unclassified 1537
187 Ga0207652_10288180 3300025921 Unclassified 1482
188 Ga0207652_10409206 3300025921 Bacteria 1224
189 Ga0207652_10552440 3300025921 Bacteria 1035
190 Ga0207650_10005127 3300025925 Bacteria 8941
191 Ga0207650_10006392 3300025925 Bacteria 8024
192 Ga0207650_10124275 3300025925 Bacteria 2012
193 Ga0207650_10477034 3300025925 Bacteria 1040
194 Ga0207650_10804951 3300025925 Bacteria 796
195 Ga0207659_10085999 3300025926 Bacteria 2337
196 Ga0207659_10146613 3300025926 Bacteria 1838
197 Ga0207687_11179089 3300025927 Bacteria 658
198 Ga0207644_10015376 3300025931 Bacteria 5135
199 Ga0207644_10209756 3300025931 Bacteria 1540
200 Ga0207644_10293733 3300025931 Bacteria 1308
201 Ga0207644_10464974 3300025931 Bacteria 1040
202 Ga0207690_10998747 3300025932 Bacteria 696
203 Ga0207690_11023723 3300025932 Bacteria 687
204 Ga0207706_10098222 3300025933 Bacteria 2575
205 Ga0207706_10173513 3300025933 Unclassified 1894
206 Ga0207706_10582235 3300025933 Bacteria 962
207 Ga0207670_10091161 3300025936 Bacteria 2155
208 Ga0207669_10090726 3300025937 Bacteria 1988
209 Ga0207669_10435037 3300025937 Unclassified 1036
210 Ga0207704_10205568 3300025938 Bacteria 1445
211 Ga0207691_10041651 3300025940 Bacteria 4239
212 Ga0207691_10328366 3300025940 Bacteria 1311
213 Ga0207691_10953725 3300025940 Bacteria 717
214 Ga0207711_10028886 3300025941 Bacteria 4671
215 Ga0207679_10230813 3300025945 Unclassified 1562
216 Ga0207679_10374725 3300025945 Unclassified 1246
217 Ga0207679_10809963 3300025945 Bacteria 854
218 Ga0207667_10104381 3300025949 Unclassified 2923
219 Ga0207712_10005880 3300025961 Bacteria 7734
220 Ga0207712_10275050 3300025961 Bacteria 1372
221 Ga0207640_10029445 3300025981 Unclassified 3371
222 Ga0207640_10139194 3300025981 Bacteria 1767
223 Ga0207640_10927731 3300025981 Bacteria 762
224 Ga0207658_10188343 3300025986 Bacteria 1713
225 Ga0207703_10004918 3300026035 Bacteria 10847
226 Ga0207703_10349418 3300026035 Bacteria 1361
227 Ga0207639_10117625 3300026041 Unclassified 2178
228 Ga0207639_10322397 3300026041 Bacteria 1372
229 Ga0207708_10133740 3300026075 Bacteria 1941
230 Ga0207702_10387159 3300026078 Bacteria 1346
231 Ga0207641_10092201 3300026088 Bacteria 2653
232 Ga0207641_10379364 3300026088 Bacteria 1353
233 Ga0207676_10003539 3300026095 Bacteria 11047
234 Ga0207676_10034811 3300026095 Bacteria 3815
235 Ga0207676_10818278 3300026095 Bacteria 909
236 Ga0207674_10026629 3300026116 Bacteria 6135
237 Ga0207674_10030101 3300026116 Bacteria 5710
238 Ga0207674_10186461 3300026116 Unclassified 2025
239 Ga0207675_100130347 3300026118 Bacteria 2384
240 Ga0207675_100152789 3300026118 Bacteria 2198
241 Ga0207675_100259988 3300026118 Bacteria 1682
242 Ga0207675_100286422 3300026118 Bacteria 1602
243 Ga0207675_100407465 3300026118 Bacteria 1341
244 Ga0209998_10084764 3300027717 Bacteria 771
245 Ga0268265_10356480 3300028380 Bacteria 1337
246 Ga0268264_10010483 3300028381 Bacteria 7663
247 Ga0268264_10119689 3300028381 Bacteria 2319
248 Ga0265330_10000001 3300031235 Bacteria 499696
249 Ga0265332_10000063 3300031238 Bacteria 94736
250 Ga0265320_10005479 3300031240 Bacteria 8136
251 Ga0265340_10223974 3300031247 Bacteria 842
252 Ga0265339_10015463 3300031249 Unclassified 4573
253 Ga0265331_10016743 3300031250 Bacteria 3842
254 Ga0265316_10000040 3300031344 Bacteria 142879
255 Ga0307408_100043731 3300031548 Bacteria 3188
256 Ga0307408_100046708 3300031548 Bacteria 3098
257 Ga0307408_100092273 3300031548 Bacteria 2289
258 Ga0307408_100136331 3300031548 Bacteria 1921
259 Ga0307408_100387836 3300031548 Bacteria 1196
260 Ga0265314_10000004 3300031711 Bacteria 939480
261 Ga0265342_10000020 3300031712 Bacteria 175977
262 Ga0307516_10119603 3300031730 Bacteria 2427
263 Ga0307405_10067373 3300031731 Bacteria 2287
264 Ga0307405_10167663 3300031731 Bacteria 1563
265 Ga0307405_10270972 3300031731 Unclassified 1273
266 Ga0307405_10588326 3300031731 Bacteria 906
267 Ga0307405_10927388 3300031731 Bacteria 738
268 Ga0307413_10001545 3300031824 Bacteria 8847
269 Ga0307413_10002584 3300031824 Bacteria 7402
270 Ga0307413_10017391 3300031824 Bacteria 3742
271 Ga0307413_10095286 3300031824 Unclassified 1951
272 Ga0307413_10202525 3300031824 Bacteria 1435
273 Ga0307413_10260547 3300031824 Bacteria 1292
274 Ga0307413_10281481 3300031824 Bacteria 1251
275 Ga0307413_11052478 3300031824 Bacteria 700
276 Ga0307410_10000355 3300031852 Bacteria 17795
277 Ga0307410_10043865 3300031852 Bacteria 2967
278 Ga0307410_10150223 3300031852 Bacteria 1734
279 Ga0307410_10190546 3300031852 Bacteria 1559
280 Ga0307410_10249216 3300031852 Bacteria 1380
281 Ga0307410_10387047 3300031852 Unclassified 1127
282 Ga0307410_10484945 3300031852 Bacteria 1015
283 Ga0307410_10931683 3300031852 Bacteria 746
284 Ga0307406_10003016 3300031901 Bacteria 9162
285 Ga0307406_10034115 3300031901 Bacteria 3120
286 Ga0307406_10064599 3300031901 Bacteria 2376
287 Ga0307406_10098540 3300031901 Unclassified 1985
288 Ga0307406_10247726 3300031901 Unclassified 1340
289 Ga0307406_10625388 3300031901 Bacteria 891
290 Ga0307407_10002312 3300031903 Bacteria 7403
291 Ga0307407_10004174 3300031903 Bacteria 6089
292 Ga0307407_10014471 3300031903 Bacteria 3865
293 Ga0307407_10062103 3300031903 Bacteria 2187
294 Ga0307407_10074204 3300031903 Bacteria 2035
295 Ga0307412_10002274 3300031911 Bacteria 10630
296 Ga0307412_10013735 3300031911 Bacteria 4757
297 Ga0307412_10602127 3300031911 Bacteria 931
298 Ga0307412_10605359 3300031911 Bacteria 929
299 Ga0307412_10807815 3300031911 Bacteria 815
300 Ga0307412_11072682 3300031911 Unclassified 715
301 Ga0307409_100014252 3300031995 Bacteria 5160
302 Ga0307409_100076907 3300031995 Bacteria 2678
303 Ga0307409_100203305 3300031995 Bacteria 1774
304 Ga0307409_100604188 3300031995 Unclassified 1084
305 Ga0307409_100680039 3300031995 Bacteria 1026
306 Ga0307416_100005297 3300032002 Bacteria 7905
307 Ga0307416_100092409 3300032002 Bacteria 2602
308 Ga0307416_100223977 3300032002 Bacteria 1807
309 Ga0307416_100505465 3300032002 Bacteria 1274
310 Ga0307416_100695997 3300032002 Bacteria 1105
311 Ga0307414_10001151 3300032004 Bacteria 13568
312 Ga0307414_10005777 3300032004 Bacteria 6839
313 Ga0307414_10212727 3300032004 Bacteria 1581
314 Ga0307414_10283178 3300032004 Unclassified 1394
315 Ga0307414_10309190 3300032004 Bacteria 1341
316 Ga0307411_10004887 3300032005 Bacteria 6511
317 Ga0307411_10008253 3300032005 Bacteria 5378
318 Ga0307411_10016988 3300032005 Bacteria 4132
319 Ga0307411_10059505 3300032005 Bacteria 2533
320 Ga0307411_10165528 3300032005 Bacteria 1662
321 Ga0307411_10779098 3300032005 Bacteria 840
322 Ga0307415_100011467 3300032126 Bacteria 5074
323 Ga0307415_100015648 3300032126 Bacteria 4500
324 Ga0307415_100018749 3300032126 Bacteria 4186
325 Ga0307415_100113236 3300032126 Bacteria 2017
326 Ga0307415_100146938 3300032126 Unclassified 1809
327 Ga0307415_100204204 3300032126 Bacteria 1571
328 Ga0307415_100403282 3300032126 Bacteria 1168
329 Ga0307415_100517304 3300032126 Bacteria 1047
330 Ga0307415_100555172 3300032126 Bacteria 1014
331 Ga0307415_101696850 3300032126 Bacteria 609
332 Ga0373943_0698848 3300035170 Bacteria 601
333 Ga0395905_0066552 3300037471 Bacteria 3374
334 Ga0395905_0495133 3300037471 Bacteria 1122
335 Ga0436365_0057073 3300039437 Bacteria 657
336 Ga0436365_0759538 3300039437 Bacteria 1654
337 Ga0436360_1030234 3300039438 Bacteria 1516
338 Ga0439465_0372567 3300041413 Bacteria 541
339 Ga0451797_0021751 3300041453 Bacteria 636
340 Ga0451800_1179435 3300041459 Bacteria 790
341 Ga0451837_0968205 3300041494 Bacteria 1570
342 Ga0451577_0006653 3300042876 Bacteria 11477
343 Ga0451577_0584704 3300042876 Bacteria 1013
344 Ga0495629_0128810 3300046459 Bacteria 1763
345 Ga0495616_0217695 3300046513 Bacteria 833
346 Ga0495628_0605595 3300046516 Bacteria 782
347 Ga0495598_0014790 3300046537 Bacteria 1957
348 Ga0495658_0771187 3300046683 Bacteria 616
349 Ga0495672_0235842 3300047320 Bacteria 896
350 Ga0496104_0553555 3300048907 Bacteria 1061
351 Ga0496105_0397238 3300048908 Bacteria 1095
352 Ga0496108_0920131 3300048911 Bacteria 750
353 Ga0496109_0010551 3300048912 Bacteria 7898
354 Ga0496114_0159407 3300048917 Bacteria 1961
355 Ga0501072_0026357 3300049588 Bacteria 4532
356 Ga0501074_0190539 3300049590 Bacteria 1462
357 Ga0501199_018032 3300049650 Unclassified 804
358 Ga0501235_091694 3300049669 Unclassified 734
359 Ga0501259_036988 3300049688 Bacteria 946
360 Ga0501225_0048798 3300049705 Unclassified 1176
361 Ga0501080_0810163 3300049742 Bacteria 821
362 Ga0501267_000678 3300049764 Bacteria 2717
363 Ga0501268_004328 3300049765 Bacteria 1993
364 nmdc:mga08y16_219840_c1 3300050511 Bacteria 1967
365 nmdc:mga08y16_483695_c1 3300050511 Bacteria 1259
366 Ga0495619_1058226 3300053085 Bacteria 541
367 Ga0500577_0001837 3300053142 Bacteria 5428
368 Ga0501084_0346251 3300054114 Bacteria 1255
369 Ga0070689_100003580
370 LJQas_1000149
371 Ga0065704_10147246
372 Ga0065704_10178734
373 Ga0065712_10283886
374 Ga0065715_10433327
375 Ga0065707_10156784
376 Ga0070658_10016341
377 Ga0070658_10041767
378 Ga0070658_10974690
379 Ga0070676_10078978
380 Ga0070676_10528120
381 Ga0070683_100355181
382 Ga0070690_100047814
383 Ga0070670_100011684
384 Ga0070670_100022580
385 Ga0070670_100079038
386 Ga0070670_100593124
387 Ga0070677_10055256
388 Ga0070680_100441086
389 Ga0070682_100090045
390 Ga0070682_100597260
391 Ga0070660_100006301
392 Ga0070689_100322397
393 Ga0070687_100070231
394 Ga0070675_100054893
395 Ga0070675_100139523
396 Ga0070675_100404417
397 Ga0070675_100483488
398 Ga0070671_100016257
399 Ga0070671_100104060
400 Ga0070671_100200812
401 Ga0070671_101514837
402 Ga0070674_100114370
403 Ga0070673_100210258
404 Ga0070673_100823663
405 Ga0070673_101020344
406 Ga0070688_100007346
407 Ga0070659_100072029
408 Ga0070659_101452854
409 Ga0070667_100070525
410 Ga0070667_100085977
411 Ga0070667_100446624
412 Ga0070700_100096590
413 Ga0070694_100189933
414 Ga0070708_100551429
415 Ga0070663_100129781
416 Ga0070663_100938923
417 Ga0070678_100052320
418 Ga0070678_100841112
419 Ga0070662_100023215
420 Ga0070662_100314171
421 Ga0070662_100608154
422 Ga0070681_10008047
423 Ga0070681_10082918
424 Ga0070681_11015444
425 Ga0068867_101117261
426 Ga0070685_10020061
427 Ga0070679_100097846
428 Ga0070679_100506825
429 Ga0070679_100528597
430 Ga0070684_100212837
431 Ga0070684_100879377
432 Ga0068853_100066330
433 Ga0068853_100584111
434 Ga0070672_100147490
435 Ga0070672_100236829
436 Ga0070672_100488439
437 Ga0070686_100062187
438 Ga0070686_100737526
439 Ga0070695_100654463
440 Ga0068855_100378537
441 Ga0070664_100029247
442 Ga0070664_100107066
443 Ga0070664_100294202
444 Ga0070664_100780509
445 Ga0068857_100049101
446 Ga0068857_100123049
447 Ga0068854_100042779
448 Ga0068854_100777941
449 Ga0068856_100922304
450 Ga0070702_100062041
451 Ga0068852_100142275
452 Ga0068852_100164697
453 Ga0068852_100182139
454 Ga0068852_100246649
455 Ga0068852_100271037
456 Ga0068859_100007860
457 Ga0068859_100008333
458 Ga0068859_100025422
459 Ga0068859_100313440
460 Ga0068864_100042593
461 Ga0068864_100104551
462 Ga0068864_100123497
463 Ga0068864_100856996
464 Ga0068861_100042010
465 Ga0068861_100106354
466 Ga0068861_100175548
467 Ga0068861_100980945
468 Ga0068861_101136254
469 Ga0068870_10027811
470 Ga0068863_100053075
471 Ga0068858_100029636
472 Ga0068858_100074899
473 Ga0068858_101383809
474 Ga0068860_100010789
475 Ga0068860_100037822
476 Ga0068860_100055958
477 Ga0068862_100153097
478 Ga0068862_100376946
479 Ga0068862_100674941
480 Ga0097621_100476680
481 Ga0097621_100519358
482 Ga0097621_100717024
483 Ga0068871_100031619
484 Ga0068871_100203125
485 Ga0097620_100007859
486 Ga0097620_100008333
487 Ga0097620_100025422
488 Ga0097620_100313451
489 Ga0105251_10031991
490 Ga0105240_10086419
491 Ga0111539_10284137
492 Ga0105245_11964942
493 Ga0105247_10050365
494 Ga0105241_10100751
495 Ga0105248_10017235
496 Ga0105248_10064410
497 Ga0105248_10102827
498 Ga0105237_10007128
499 Ga0105238_11476598
500 Ga0105249_10044357
501 Ga0105249_10058653
502 Ga0105249_10193833
503 Ga0105249_10194453
504 Ga0105249_10361046
505 Ga0105239_10151489
506 Ga0157373_10004741
507 Ga0157373_10124828
508 Ga0157370_10157273
509 Ga0157369_10305886
510 Ga0157374_10040480
511 Ga0157374_10144326
512 Ga0157378_10016180
513 Ga0157378_10048487
514 Ga0163162_10081195
515 Ga0163162_10162132
516 Ga0163162_10257026
517 Ga0163162_10894765
518 Ga0163162_11175836
519 Ga0163162_11210802
520 Ga0163162_11649182
521 Ga0157372_10019809
522 Ga0157372_10033481
523 Ga0157375_10096660
524 Ga0157375_10197771
525 Ga0157375_10355230
526 Ga0157375_11145662
527 Ga0163163_10233407
528 Ga0163163_10837940
529 Ga0157380_10135574
530 Ga0157380_10257957
531 Ga0157377_10597141
532 Ga0157379_10206729
533 Ga0157376_10196502
534 Ga0157376_10220044
535 Ga0157376_10516753
536 Ga0163161_10002102
537 Ga0163161_10105648
538 Ga0163161_10205224
539 Ga0213876_10126205
540 Ga0207697_10056299
541 Ga0207682_10049826
542 Ga0207682_10095399
543 Ga0207710_10007652
544 Ga0207647_10083555
545 Ga0207645_10047751
546 Ga0207643_10027070
547 Ga0207705_10019661
548 Ga0207705_10260366
549 Ga0207707_10013585
550 Ga0207707_10140400
551 Ga0207695_11430907
552 Ga0207671_10644227
553 Ga0207657_10020007
554 Ga0207649_10165110
555 Ga0207652_10288180
556 Ga0207652_10409206
557 Ga0207652_10552440
558 Ga0207650_10005127
559 Ga0207650_10006392
560 Ga0207650_10124275
561 Ga0207650_10477034
562 Ga0207650_10804951
563 Ga0207659_10085999
564 Ga0207659_10146613
565 Ga0207687_11179089
566 Ga0207644_10015376
567 Ga0207644_10209756
568 Ga0207644_10293733
569 Ga0207644_10464974
570 Ga0207690_10998747
571 Ga0207690_11023723
572 Ga0207706_10098222
573 Ga0207706_10173513
574 Ga0207706_10582235
575 Ga0207670_10091161
576 Ga0207669_10090726
577 Ga0207669_10435037
578 Ga0207704_10205568
579 Ga0207691_10041651
580 Ga0207691_10328366
581 Ga0207691_10953725
582 Ga0207711_10028886
583 Ga0207679_10230813
584 Ga0207679_10374725
585 Ga0207679_10809963
586 Ga0207667_10104381
587 Ga0207712_10005880
588 Ga0207712_10275050
589 Ga0207640_10029445
590 Ga0207640_10139194
591 Ga0207640_10927731
592 Ga0207658_10188343
593 Ga0207703_10004918
594 Ga0207703_10349418
595 Ga0207639_10117625
596 Ga0207639_10322397
597 Ga0207708_10133740
598 Ga0207702_10387159
599 Ga0207641_10092201
600 Ga0207641_10379364
601 Ga0207676_10003539
602 Ga0207676_10034811
603 Ga0207676_10818278
604 Ga0207674_10026629
605 Ga0207674_10030101
606 Ga0207674_10186461
607 Ga0207675_100130347
608 Ga0207675_100152789
609 Ga0207675_100259988
610 Ga0207675_100286422
611 Ga0207675_100407465
612 Ga0209998_10084764
613 Ga0268265_10356480
614 Ga0268264_10010483
615 Ga0268264_10119689
616 Ga0265330_10000001
617 Ga0265332_10000063
618 Ga0265320_10005479
619 Ga0265340_10223974
620 Ga0265339_10015463
621 Ga0265331_10016743
622 Ga0265316_10000040
623 Ga0307408_100043731
624 Ga0307408_100046708
625 Ga0307408_100092273
626 Ga0307408_100136331
627 Ga0307408_100387836
628 Ga0265314_10000004
629 Ga0265342_10000020
630 Ga0307516_10119603
631 Ga0307405_10067373
632 Ga0307405_10167663
633 Ga0307405_10270972
634 Ga0307405_10588326
635 Ga0307405_10927388
636 Ga0307413_10001545
637 Ga0307413_10002584
638 Ga0307413_10017391
639 Ga0307413_10095286
640 Ga0307413_10202525
641 Ga0307413_10260547
642 Ga0307413_10281481
643 Ga0307413_11052478
644 Ga0307410_10000355
645 Ga0307410_10043865
646 Ga0307410_10150223
647 Ga0307410_10190546
648 Ga0307410_10249216
649 Ga0307410_10387047
650 Ga0307410_10484945
651 Ga0307410_10931683
652 Ga0307406_10003016
653 Ga0307406_10034115
654 Ga0307406_10064599
655 Ga0307406_10098540
656 Ga0307406_10247726
657 Ga0307406_10625388
658 Ga0307407_10002312
659 Ga0307407_10004174
660 Ga0307407_10014471
661 Ga0307407_10062103
662 Ga0307407_10074204
663 Ga0307412_10002274
664 Ga0307412_10013735
665 Ga0307412_10602127
666 Ga0307412_10605359
667 Ga0307412_10807815
668 Ga0307412_11072682
669 Ga0307409_100014252
670 Ga0307409_100076907
671 Ga0307409_100203305
672 Ga0307409_100604188
673 Ga0307409_100680039
674 Ga0307416_100005297
675 Ga0307416_100092409
676 Ga0307416_100223977
677 Ga0307416_100505465
678 Ga0307416_100695997
679 Ga0307414_10001151
680 Ga0307414_10005777
681 Ga0307414_10212727
682 Ga0307414_10283178
683 Ga0307414_10309190
684 Ga0307411_10004887
685 Ga0307411_10008253
686 Ga0307411_10016988
687 Ga0307411_10059505
688 Ga0307411_10165528
689 Ga0307411_10779098
690 Ga0307415_100011467
691 Ga0307415_100015648
692 Ga0307415_100018749
693 Ga0307415_100113236
694 Ga0307415_100146938
695 Ga0307415_100204204
696 Ga0307415_100403282
697 Ga0307415_100517304
698 Ga0307415_100555172
699 Ga0307415_101696850
700 Ga0373943_0698848
701 Ga0395905_0066552
702 Ga0395905_0495133
703 Ga0436365_0057073
704 Ga0436365_0759538
705 Ga0436360_1030234
706 Ga0439465_0372567
707 Ga0451797_0021751
708 Ga0451800_1179435
709 Ga0451837_0968205
710 Ga0451577_0006653
711 Ga0451577_0584704
712 Ga0495629_0128810
713 Ga0495616_0217695
714 Ga0495628_0605595
715 Ga0495598_0014790
716 Ga0495658_0771187
717 Ga0495672_0235842
718 Ga0496104_0553555
719 Ga0496105_0397238
720 Ga0496108_0920131
721 Ga0496109_0010551
722 Ga0496114_0159407
723 Ga0501072_0026357
724 Ga0501074_0190539
725 Ga0501199_018032
726 Ga0501235_091694
727 Ga0501259_036988
728 Ga0501225_0048798
729 Ga0501080_0810163
730 Ga0501267_000678
731 Ga0501268_004328
732 nmdc:mga08y16_219840_c1
733 nmdc:mga08y16_483695_c1
734 Ga0495619_1058226
735 Ga0500577_0001837
736 Ga0501084_0346251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

22

171

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ate-assembly1.cif.gz_A structure of the complex of pure with nitroair 0.9848 8 160
2nsl-assembly1.cif.gz_A e. coli pure h45n mutant complexed with cair 0.9847 8 160
2nsh-assembly1.cif.gz_A e. coli pure h45q mutant complexed with nitro-air 0.9846 7 161
3oow-assembly1.cif.gz_D octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from francisella tularensis subsp. tularensis schu s4. 0.9838 7 161
4grd-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole carboxylase catalytic subunit from burkholderia cenocepacia j2315 0.9807 5 164
ID Description Score Start End Superfamily
af_Q2FZJ5_1_139_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9833 29 158 3.40.50.1970
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9792 13 159 3.40.50.1970
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.974 1 159 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9729 5 164 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9605 9 159 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A259P420-F1-model_v4 Multifunctional fusion protein [Includes: N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase); N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase)] 0.9959 9 137 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034023
GO:0034028
GO:0046872
AF-A0A0S8D631-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9909 6 163 GO:0006189
GO:0034023
AF-A0A017HSY8-F1-model_v4 Multifunctional fusion protein [Includes: N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase); N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase)] 0.9905 7 132 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034023
GO:0034028
GO:0046872
AF-A0A2U1DF56-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.99 7 159 GO:0006189
GO:0034023
AF-A0A2K8K487-F1-model_v4 deleted 0.9899 6 159

Map