F424466

General Info

Members Datasets Scaffolds Average Seq Length
367 157 734 242

Family's Representative Sequence

Representative Sequence 3300046525|Ga0495663_0005808|Ga0495663_0005808_1062_1886
Length 274
Sequence MTGRLAGKPDERLEAAPGSSAAASAARAFSFPTRKQEEWRYADLDALRPVWERLADPRTLTLAPGESLEEVWLATGEDVQVRRMQIALGEGAKARLFVLNTAQVYGRVELEVSLEADADFELFAANIGDGQSTNEIVTNVKHIGERGRSRQTVRSVLGGSAVGSYLGKVEVARGAQQTDGEQSVKAMLLNRGATANCKPELEIFADDVKCAHGATVGELDETQLFYAMSRGLDPASARALLLEGFVMGLWDDIADEAQRDAIGNAARDALRRVA

Samples

Sample ID Description Type Environment
1 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
132 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
152 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
153 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
154 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
155 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
156 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
157 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.09
Metatranscriptomes 0
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.18
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495663_0005808 3300046525 Bacteria 3416
2 JGI24747J21853_1002919 3300001978 Bacteria 1441
3 JGI24740J21852_10013141 3300001979 Bacteria 3099
4 JGI24739J22299_10008422 3300001989 Bacteria 3852
5 JGI24739J22299_10022368 3300001989 Bacteria 2243
6 JGI24737J22298_10016062 3300001990 Bacteria 2417
7 JGI24738J21930_10001827 3300002075 Bacteria 5766
8 JGI24744J21845_10004337 3300002077 Bacteria 2929
9 JGI24742J22300_10024522 3300002244 Bacteria 1040
10 Ga0065704_10145755 3300005289 Bacteria 1473
11 Ga0065712_10012271 3300005290 Bacteria 2253
12 Ga0065715_10214463 3300005293 Bacteria 1297
13 Ga0065715_10423017 3300005293 Bacteria 856
14 Ga0070658_10068154 3300005327 Bacteria 2908
15 Ga0070658_10175915 3300005327 Bacteria 1800
16 Ga0070676_10024882 3300005328 Bacteria 3378
17 Ga0070676_10110587 3300005328 Bacteria 1710
18 Ga0070676_10206451 3300005328 Bacteria 1290
19 Ga0070670_100001880 3300005331 Bacteria 17138
20 Ga0070670_100043056 3300005331 Bacteria 3882
21 Ga0070670_100052439 3300005331 Bacteria 3503
22 Ga0070670_100264263 3300005331 Bacteria 1501
23 Ga0070677_10018571 3300005333 Bacteria 2505
24 Ga0068869_100042802 3300005334 Bacteria 3249
25 Ga0068869_100095139 3300005334 Bacteria 2247
26 Ga0070666_10077425 3300005335 Bacteria 2270
27 Ga0068868_100001128 3300005338 Bacteria 18247
28 Ga0068868_100064630 3300005338 Bacteria 2905
29 Ga0070660_100060459 3300005339 Bacteria 2940
30 Ga0070660_100090994 3300005339 Bacteria 2406
31 Ga0070660_100137760 3300005339 Bacteria 1956
32 Ga0070661_100088607 3300005344 Bacteria 2291
33 Ga0070661_100245990 3300005344 Bacteria 1379
34 Ga0070668_100040465 3300005347 Bacteria 3567
35 Ga0070668_100044906 3300005347 Bacteria 3390
36 Ga0070668_100189677 3300005347 Bacteria 1683
37 Ga0070668_100249287 3300005347 Bacteria 1473
38 Ga0070668_100613613 3300005347 Bacteria 953
39 Ga0070669_100000174 3300005353 Bacteria 56290
40 Ga0070669_100095533 3300005353 Bacteria 2235
41 Ga0070669_100166345 3300005353 Bacteria 1717
42 Ga0070669_100336203 3300005353 Bacteria 1223
43 Ga0070675_100002250 3300005354 Bacteria 14308
44 Ga0070675_100026829 3300005354 Bacteria 4624
45 Ga0070671_100001083 3300005355 Bacteria 20150
46 Ga0070671_100111330 3300005355 Bacteria 2300
47 Ga0070671_100142598 3300005355 Bacteria 2022
48 Ga0070674_100108445 3300005356 Bacteria 2035
49 Ga0070674_100236642 3300005356 Bacteria 1427
50 Ga0070673_100086003 3300005364 Bacteria 2561
51 Ga0070673_100481999 3300005364 Bacteria 1120
52 Ga0070659_100035120 3300005366 Bacteria 3902
53 Ga0070667_100026107 3300005367 Bacteria 4858
54 Ga0070663_100254189 3300005455 Bacteria 1392
55 Ga0070663_100301384 3300005455 Bacteria 1283
56 Ga0070663_100354644 3300005455 Bacteria 1188
57 Ga0070678_100090164 3300005456 Bacteria 2349
58 Ga0070678_100182342 3300005456 Bacteria 1720
59 Ga0070662_100010601 3300005457 Bacteria 6058
60 Ga0070662_100013148 3300005457 Bacteria 5502
61 Ga0070662_100027100 3300005457 Bacteria 3975
62 Ga0070662_100064162 3300005457 Bacteria 2689
63 Ga0070662_100447469 3300005457 Bacteria 1072
64 Ga0070662_100558621 3300005457 Bacteria 960
65 Ga0070662_100625477 3300005457 Bacteria 907
66 Ga0068867_100000662 3300005459 Bacteria 22816
67 Ga0068853_100000811 3300005539 Bacteria 21781
68 Ga0068853_100325937 3300005539 Bacteria 1424
69 Ga0070672_100001827 3300005543 Bacteria 13276
70 Ga0070672_100019546 3300005543 Bacteria 4918
71 Ga0070672_100363400 3300005543 Bacteria 1236
72 Ga0070665_100023392 3300005548 Bacteria 6220
73 Ga0070665_100417523 3300005548 Bacteria 1350
74 Ga0068855_100003418 3300005563 Bacteria 19430
75 Ga0068855_100003900 3300005563 Bacteria 18212
76 Ga0070664_100001469 3300005564 Bacteria 18785
77 Ga0070664_100061567 3300005564 Bacteria 3199
78 Ga0070664_100159857 3300005564 Bacteria 1993
79 Ga0070664_100163206 3300005564 Bacteria 1972
80 Ga0070664_100276687 3300005564 Bacteria 1513
81 Ga0068857_100005757 3300005577 Bacteria 10597
82 Ga0068857_100011078 3300005577 Bacteria 7845
83 Ga0068854_100011508 3300005578 Bacteria 5764
84 Ga0068854_100049324 3300005578 Bacteria 3006
85 Ga0068854_100049937 3300005578 Bacteria 2990
86 Ga0068852_100001448 3300005616 Bacteria 16016
87 Ga0068852_100220415 3300005616 Bacteria 1804
88 Ga0068852_100485407 3300005616 Bacteria 1228
89 Ga0068859_100023839 3300005617 Bacteria 6143
90 Ga0068864_100044810 3300005618 Bacteria 3793
91 Ga0068866_10039647 3300005718 Bacteria 2326
92 Ga0068861_100108444 3300005719 Bacteria 2221
93 Ga0068851_10051282 3300005834 Bacteria 2096
94 Ga0068863_100021584 3300005841 Bacteria 6141
95 Ga0068858_100000620 3300005842 Bacteria 36979
96 Ga0068860_100273313 3300005843 Bacteria 1650
97 Ga0068862_100389151 3300005844 Bacteria 1302
98 Ga0068871_100026337 3300006358 Bacteria 4536
99 Ga0068865_100000928 3300006881 Bacteria 16628
100 Ga0097620_100023842 3300006931 Bacteria 6143
101 Ga0105240_10158288 3300009093 Bacteria 2692
102 Ga0105245_10000229 3300009098 Bacteria 53255
103 Ga0105245_10072816 3300009098 Bacteria 3122
104 Ga0105243_10207624 3300009148 Bacteria 1722
105 Ga0105243_10338062 3300009148 Bacteria 1378
106 Ga0105241_10283991 3300009174 Bacteria 1415
107 Ga0105248_10001364 3300009177 Bacteria 27266
108 Ga0105239_10373198 3300010375 Bacteria 1612
109 Ga0157373_10020548 3300013100 Bacteria 4798
110 Ga0157373_10157156 3300013100 Bacteria 1599
111 Ga0157371_10003444 3300013102 Bacteria 14349
112 Ga0157378_10000154 3300013297 Bacteria 64986
113 Ga0157378_10214785 3300013297 Bacteria 1825
114 Ga0163162_10071370 3300013306 Bacteria 3525
115 Ga0157372_10079136 3300013307 Bacteria 3716
116 Ga0157375_10037150 3300013308 Bacteria 4665
117 Ga0163163_10416637 3300014325 Bacteria 1402
118 Ga0157380_10224061 3300014326 Bacteria 1684
119 Ga0157377_10042308 3300014745 Bacteria 2530
120 Ga0157379_10058108 3300014968 Bacteria 3458
121 Ga0163161_10340217 3300017792 Bacteria 1190
122 Ga0207697_10001966 3300025315 Bacteria 10909
123 Ga0207656_10108603 3300025321 Bacteria 1280
124 Ga0207713_1004070 3300025735 Bacteria 9645
125 Ga0207682_10014876 3300025893 Bacteria 3030
126 Ga0207688_10000595 3300025901 Bacteria 17763
127 Ga0207688_10131967 3300025901 Bacteria 1465
128 Ga0207688_10183039 3300025901 Bacteria 1250
129 Ga0207680_10195750 3300025903 Bacteria 1375
130 Ga0207647_10000090 3300025904 Bacteria 69395
131 Ga0207645_10014142 3300025907 Bacteria 5346
132 Ga0207645_10049577 3300025907 Bacteria 2681
133 Ga0207645_10098403 3300025907 Bacteria 1886
134 Ga0207645_10368249 3300025907 Bacteria 963
135 Ga0207705_10010417 3300025909 Bacteria 6757
136 Ga0207705_10251455 3300025909 Bacteria 1348
137 Ga0207654_10268968 3300025911 Bacteria 1149
138 Ga0207660_10000522 3300025917 Bacteria 25663
139 Ga0207657_10002682 3300025919 Bacteria 19192
140 Ga0207657_10027079 3300025919 Bacteria 5255
141 Ga0207657_10039308 3300025919 Bacteria 4206
142 Ga0207657_10102626 3300025919 Bacteria 2372
143 Ga0207649_10257775 3300025920 Bacteria 1259
144 Ga0207649_10265841 3300025920 Bacteria 1241
145 Ga0207649_10272023 3300025920 Bacteria 1228
146 Ga0207681_10040784 3300025923 Bacteria 3091
147 Ga0207681_10164164 3300025923 Bacteria 1677
148 Ga0207650_10001425 3300025925 Bacteria 17234
149 Ga0207650_10028467 3300025925 Bacteria 4007
150 Ga0207650_10084622 3300025925 Bacteria 2411
151 Ga0207659_10001814 3300025926 Bacteria 12637
152 Ga0207659_10025454 3300025926 Bacteria 3977
153 Ga0207659_10070015 3300025926 Bacteria 2557
154 Ga0207659_10822828 3300025926 Bacteria 798
155 Ga0207687_10038652 3300025927 Bacteria 3262
156 Ga0207664_10427683 3300025929 Bacteria 1180
157 Ga0207644_10135685 3300025931 Bacteria 1889
158 Ga0207644_10266805 3300025931 Bacteria 1370
159 Ga0207690_10016821 3300025932 Bacteria 4456
160 Ga0207690_10059171 3300025932 Bacteria 2595
161 Ga0207690_10082860 3300025932 Bacteria 2244
162 Ga0207690_10465255 3300025932 Bacteria 1018
163 Ga0207706_10001429 3300025933 Bacteria 23905
164 Ga0207706_10109208 3300025933 Bacteria 2434
165 Ga0207706_10109313 3300025933 Bacteria 2433
166 Ga0207706_10117905 3300025933 Bacteria 2335
167 Ga0207706_10127261 3300025933 Bacteria 2240
168 Ga0207706_10200722 3300025933 Bacteria 1749
169 Ga0207669_10002095 3300025937 Bacteria 8458
170 Ga0207669_10063236 3300025937 Bacteria 2283
171 Ga0207704_10014927 3300025938 Bacteria 3942
172 Ga0207691_10021931 3300025940 Bacteria 6027
173 Ga0207691_10027371 3300025940 Bacteria 5344
174 Ga0207691_10304889 3300025940 Bacteria 1367
175 Ga0207711_10373120 3300025941 Bacteria 1323
176 Ga0207689_10000226 3300025942 Bacteria 50110
177 Ga0207689_10284130 3300025942 Bacteria 1370
178 Ga0207679_10106091 3300025945 Bacteria 2208
179 Ga0207679_10137934 3300025945 Bacteria 1967
180 Ga0207679_10167947 3300025945 Bacteria 1803
181 Ga0207667_10102292 3300025949 Bacteria 2956
182 Ga0207651_10016674 3300025960 Bacteria 4313
183 Ga0207651_10043084 3300025960 Bacteria 3009
184 Ga0207651_10447842 3300025960 Bacteria 1107
185 Ga0207668_10035311 3300025972 Bacteria 3327
186 Ga0207668_10351209 3300025972 Bacteria 1233
187 Ga0207640_10036791 3300025981 Bacteria 3076
188 Ga0207640_10243049 3300025981 Bacteria 1392
189 Ga0207677_10011520 3300026023 Bacteria 5047
190 Ga0207677_10060771 3300026023 Bacteria 2613
191 Ga0207639_10406058 3300026041 Bacteria 1228
192 Ga0207678_10044523 3300026067 Bacteria 3839
193 Ga0207678_10095495 3300026067 Bacteria 2541
194 Ga0207678_10163369 3300026067 Bacteria 1902
195 Ga0207678_10249372 3300026067 Bacteria 1520
196 Ga0207678_10399265 3300026067 Bacteria 1190
197 Ga0207641_10003834 3300026088 Bacteria 13168
198 Ga0207648_10002102 3300026089 Bacteria 21704
199 Ga0207648_10080342 3300026089 Bacteria 2844
200 Ga0207648_10130223 3300026089 Bacteria 2214
201 Ga0207674_10000531 3300026116 Bacteria 49979
202 Ga0207674_10132395 3300026116 Bacteria 2456
203 Ga0207674_10211205 3300026116 Bacteria 1890
204 Ga0207675_100039465 3300026118 Bacteria 4406
205 Ga0207675_100563375 3300026118 Bacteria 1139
206 Ga0207683_10221045 3300026121 Bacteria 1726
207 Ga0207683_10357320 3300026121 Bacteria 1341
208 Ga0207698_10112763 3300026142 Bacteria 2283
209 Ga0268266_10002799 3300028379 Bacteria 18189
210 Ga0268266_10014935 3300028379 Bacteria 6668
211 Ga0307408_100001159 3300031548 Bacteria 20050
212 Ga0307408_100206899 3300031548 Bacteria 1592
213 Ga0307408_100231003 3300031548 Bacteria 1515
214 Ga0307408_100304519 3300031548 Bacteria 1336
215 Ga0307405_10000240 3300031731 Bacteria 19933
216 Ga0307405_10019686 3300031731 Bacteria 3755
217 Ga0307405_10191244 3300031731 Bacteria 1478
218 Ga0307413_10000616 3300031824 Bacteria 11983
219 Ga0307413_10002633 3300031824 Bacteria 7345
220 Ga0307413_10012640 3300031824 Bacteria 4208
221 Ga0307413_10025910 3300031824 Bacteria 3223
222 Ga0307413_10027487 3300031824 Bacteria 3153
223 Ga0307413_10080549 3300031824 Bacteria 2085
224 Ga0307413_10112039 3300031824 Bacteria 1828
225 Ga0307413_10171170 3300031824 Bacteria 1537
226 Ga0307413_10274691 3300031824 Bacteria 1264
227 Ga0307413_10292011 3300031824 Bacteria 1232
228 Ga0307413_10441797 3300031824 Bacteria 1030
229 Ga0307413_10577154 3300031824 Bacteria 916
230 Ga0307410_10011968 3300031852 Bacteria 4989
231 Ga0307410_10016045 3300031852 Bacteria 4455
232 Ga0307410_10017901 3300031852 Bacteria 4267
233 Ga0307410_10029803 3300031852 Bacteria 3479
234 Ga0307410_10052862 3300031852 Bacteria 2746
235 Ga0307410_10091864 3300031852 Bacteria 2156
236 Ga0307410_10104049 3300031852 Bacteria 2040
237 Ga0307410_10107851 3300031852 Bacteria 2009
238 Ga0307410_10115873 3300031852 Bacteria 1946
239 Ga0307410_10134525 3300031852 Bacteria 1820
240 Ga0307410_10149529 3300031852 Bacteria 1737
241 Ga0307410_10156587 3300031852 Bacteria 1702
242 Ga0307410_10222299 3300031852 Bacteria 1453
243 Ga0307410_10250851 3300031852 Bacteria 1376
244 Ga0307410_10339189 3300031852 Bacteria 1197
245 Ga0307410_10550242 3300031852 Bacteria 956
246 Ga0307406_10033340 3300031901 Bacteria 3152
247 Ga0307406_10111908 3300031901 Bacteria 1881
248 Ga0307406_10204720 3300031901 Bacteria 1455
249 Ga0307406_10243633 3300031901 Bacteria 1350
250 Ga0307406_10326325 3300031901 Bacteria 1189
251 Ga0307407_10000541 3300031903 Bacteria 11794
252 Ga0307407_10007778 3300031903 Bacteria 4876
253 Ga0307407_10017016 3300031903 Bacteria 3636
254 Ga0307407_10019151 3300031903 Bacteria 3479
255 Ga0307407_10074055 3300031903 Bacteria 2036
256 Ga0307407_10075338 3300031903 Bacteria 2022
257 Ga0307407_10091745 3300031903 Bacteria 1863
258 Ga0307407_10170258 3300031903 Bacteria 1434
259 Ga0307412_10000248 3300031911 Bacteria 35008
260 Ga0307412_10066046 3300031911 Bacteria 2450
261 Ga0307412_10353686 3300031911 Bacteria 1180
262 Ga0307409_100003998 3300031995 Bacteria 8178
263 Ga0307409_100004995 3300031995 Bacteria 7552
264 Ga0307409_100013953 3300031995 Bacteria 5199
265 Ga0307409_100014408 3300031995 Bacteria 5142
266 Ga0307409_100048713 3300031995 Bacteria 3227
267 Ga0307409_100089184 3300031995 Bacteria 2520
268 Ga0307409_100114662 3300031995 Bacteria 2267
269 Ga0307409_100122257 3300031995 Bacteria 2207
270 Ga0307409_100132764 3300031995 Bacteria 2131
271 Ga0307409_100166607 3300031995 Bacteria 1934
272 Ga0307409_100266865 3300031995 Bacteria 1574
273 Ga0307409_100288633 3300031995 Bacteria 1520
274 Ga0307409_100435517 3300031995 Bacteria 1261
275 Ga0307409_100474455 3300031995 Bacteria 1212
276 Ga0307416_100001974 3300032002 Bacteria 11501
277 Ga0307416_100004905 3300032002 Bacteria 8147
278 Ga0307416_100055888 3300032002 Bacteria 3181
279 Ga0307416_100070989 3300032002 Bacteria 2891
280 Ga0307416_100274843 3300032002 Bacteria 1657
281 Ga0307416_100557236 3300032002 Bacteria 1220
282 Ga0307416_100666158 3300032002 Bacteria 1127
283 Ga0307416_100961071 3300032002 Bacteria 956
284 Ga0307414_10006155 3300032004 Bacteria 6668
285 Ga0307414_10006463 3300032004 Bacteria 6537
286 Ga0307414_10017302 3300032004 Bacteria 4407
287 Ga0307414_10024839 3300032004 Bacteria 3828
288 Ga0307414_10054846 3300032004 Bacteria 2787
289 Ga0307414_10064787 3300032004 Bacteria 2604
290 Ga0307414_10081371 3300032004 Bacteria 2371
291 Ga0307414_10122257 3300032004 Bacteria 2003
292 Ga0307414_10148122 3300032004 Bacteria 1848
293 Ga0307414_10182925 3300032004 Bacteria 1687
294 Ga0307414_10292200 3300032004 Bacteria 1374
295 Ga0307414_10416906 3300032004 Bacteria 1170
296 Ga0307414_10423842 3300032004 Bacteria 1161
297 Ga0307411_10001520 3300032005 Bacteria 9552
298 Ga0307411_10005922 3300032005 Bacteria 6070
299 Ga0307411_10006005 3300032005 Bacteria 6034
300 Ga0307411_10013356 3300032005 Bacteria 4529
301 Ga0307411_10044538 3300032005 Bacteria 2847
302 Ga0307411_10053278 3300032005 Bacteria 2649
303 Ga0307411_10066465 3300032005 Bacteria 2422
304 Ga0307411_10101445 3300032005 Bacteria 2036
305 Ga0307411_10124085 3300032005 Bacteria 1874
306 Ga0307411_10146712 3300032005 Bacteria 1747
307 Ga0307415_100021651 3300032126 Bacteria 3956
308 Ga0307415_100038762 3300032126 Bacteria 3143
309 Ga0307415_100048033 3300032126 Bacteria 2877
310 Ga0307415_100055162 3300032126 Bacteria 2717
311 Ga0307415_100126447 3300032126 Bacteria 1927
312 Ga0307415_100159581 3300032126 Bacteria 1746
313 Ga0307415_100170551 3300032126 Bacteria 1696
314 Ga0307415_100264315 3300032126 Bacteria 1406
315 Ga0307415_100542746 3300032126 Bacteria 1025
316 Ga0395899_0069450 3300037312 Bacteria 2580
317 Ga0395899_0288929 3300037312 Bacteria 1113
318 Ga0395900_0043920 3300037418 Bacteria 4606
319 Ga0395900_0103678 3300037418 Bacteria 2921
320 Ga0395900_0143630 3300037418 Bacteria 2442
321 Ga0395900_0363902 3300037418 Bacteria 1417
322 Ga0395900_0396314 3300037418 Bacteria 1345
323 Ga0395898_0312789 3300037466 Bacteria 1498
324 Ga0395898_0545824 3300037466 Bacteria 1101
325 Ga0395905_0005435 3300037471 Bacteria 13014
326 Ga0395905_0096444 3300037471 Bacteria 2776
327 Ga0395905_0108207 3300037471 Bacteria 2609
328 Ga0395905_0192996 3300037471 Bacteria 1910
329 Ga0395905_0648301 3300037471 Bacteria 958
330 Ga0395901_0035640 3300038443 Bacteria 5141
331 Ga0395901_0107018 3300038443 Bacteria 2935
332 Ga0395901_0184031 3300038443 Bacteria 2191
333 Ga0395901_0232054 3300038443 Bacteria 1926
334 Ga0439465_0123479 3300041413 Bacteria 909
335 Ga0439432_013514 3300042006 Bacteria 2776
336 Ga0439449_0008014 3300042007 Bacteria 4012
337 Ga0439462_0066582 3300042015 Bacteria 977
338 Ga0450920_006029 3300042122 Bacteria 2169
339 Ga0439434_0141144 3300042435 Bacteria 794
340 Ga0466966_0017971 3300044684 Bacteria 4669
341 Ga0466967_0192587 3300045976 Bacteria 1928
342 Ga0495598_0011219 3300046537 Bacteria 2166
343 Ga0495598_0080504 3300046537 Bacteria 1044
344 Ga0495621_0015823 3300046539 Bacteria 2411
345 Ga0495633_0017963 3300046558 Bacteria 3599
346 Ga0495668_0016346 3300046616 Bacteria 4312
347 Ga0495625_0082535 3300046660 Bacteria 2235
348 Ga0495669_0003969 3300046684 Bacteria 6089
349 Ga0495669_0025777 3300046684 Bacteria 2566
350 Ga0495670_0015867 3300046691 Bacteria 3701
351 Ga0495670_0134873 3300046691 Bacteria 1288
352 Ga0495677_0018110 3300047445 Bacteria 2553
353 Ga0496103_0196612 3300048906 Bacteria 1297
354 Ga0496107_0122903 3300048910 Bacteria 1913
355 Ga0496109_0137693 3300048912 Bacteria 2282
356 Ga0496110_0033204 3300048913 Bacteria 4462
357 Ga0496111_0019385 3300048914 Bacteria 4723
358 Ga0496112_0095708 3300048915 Bacteria 2939
359 Ga0496114_0000016 3300048917 Bacteria 274656
360 Ga0496114_0380156 3300048917 Bacteria 1250
361 2738710571 2738541275 Bacteria 4830863
362 2738848996 2738541301 Bacteria 4834102
363 2738864725 2738541304 Bacteria 4833665
364 2739297243 2738543022 Bacteria 4835059
365 2739358921 2738543033 Bacteria 4833336
366 2928100670 2928100450 Bacteria 4837635
367 2928960733 2928959182 Bacteria 4725774
368 Ga0495663_0005808
369 JGI24747J21853_1002919
370 JGI24740J21852_10013141
371 JGI24739J22299_10008422
372 JGI24739J22299_10022368
373 JGI24737J22298_10016062
374 JGI24738J21930_10001827
375 JGI24744J21845_10004337
376 JGI24742J22300_10024522
377 Ga0065704_10145755
378 Ga0065712_10012271
379 Ga0065715_10214463
380 Ga0065715_10423017
381 Ga0070658_10068154
382 Ga0070658_10175915
383 Ga0070676_10024882
384 Ga0070676_10110587
385 Ga0070676_10206451
386 Ga0070670_100001880
387 Ga0070670_100043056
388 Ga0070670_100052439
389 Ga0070670_100264263
390 Ga0070677_10018571
391 Ga0068869_100042802
392 Ga0068869_100095139
393 Ga0070666_10077425
394 Ga0068868_100001128
395 Ga0068868_100064630
396 Ga0070660_100060459
397 Ga0070660_100090994
398 Ga0070660_100137760
399 Ga0070661_100088607
400 Ga0070661_100245990
401 Ga0070668_100040465
402 Ga0070668_100044906
403 Ga0070668_100189677
404 Ga0070668_100249287
405 Ga0070668_100613613
406 Ga0070669_100000174
407 Ga0070669_100095533
408 Ga0070669_100166345
409 Ga0070669_100336203
410 Ga0070675_100002250
411 Ga0070675_100026829
412 Ga0070671_100001083
413 Ga0070671_100111330
414 Ga0070671_100142598
415 Ga0070674_100108445
416 Ga0070674_100236642
417 Ga0070673_100086003
418 Ga0070673_100481999
419 Ga0070659_100035120
420 Ga0070667_100026107
421 Ga0070663_100254189
422 Ga0070663_100301384
423 Ga0070663_100354644
424 Ga0070678_100090164
425 Ga0070678_100182342
426 Ga0070662_100010601
427 Ga0070662_100013148
428 Ga0070662_100027100
429 Ga0070662_100064162
430 Ga0070662_100447469
431 Ga0070662_100558621
432 Ga0070662_100625477
433 Ga0068867_100000662
434 Ga0068853_100000811
435 Ga0068853_100325937
436 Ga0070672_100001827
437 Ga0070672_100019546
438 Ga0070672_100363400
439 Ga0070665_100023392
440 Ga0070665_100417523
441 Ga0068855_100003418
442 Ga0068855_100003900
443 Ga0070664_100001469
444 Ga0070664_100061567
445 Ga0070664_100159857
446 Ga0070664_100163206
447 Ga0070664_100276687
448 Ga0068857_100005757
449 Ga0068857_100011078
450 Ga0068854_100011508
451 Ga0068854_100049324
452 Ga0068854_100049937
453 Ga0068852_100001448
454 Ga0068852_100220415
455 Ga0068852_100485407
456 Ga0068859_100023839
457 Ga0068864_100044810
458 Ga0068866_10039647
459 Ga0068861_100108444
460 Ga0068851_10051282
461 Ga0068863_100021584
462 Ga0068858_100000620
463 Ga0068860_100273313
464 Ga0068862_100389151
465 Ga0068871_100026337
466 Ga0068865_100000928
467 Ga0097620_100023842
468 Ga0105240_10158288
469 Ga0105245_10000229
470 Ga0105245_10072816
471 Ga0105243_10207624
472 Ga0105243_10338062
473 Ga0105241_10283991
474 Ga0105248_10001364
475 Ga0105239_10373198
476 Ga0157373_10020548
477 Ga0157373_10157156
478 Ga0157371_10003444
479 Ga0157378_10000154
480 Ga0157378_10214785
481 Ga0163162_10071370
482 Ga0157372_10079136
483 Ga0157375_10037150
484 Ga0163163_10416637
485 Ga0157380_10224061
486 Ga0157377_10042308
487 Ga0157379_10058108
488 Ga0163161_10340217
489 Ga0207697_10001966
490 Ga0207656_10108603
491 Ga0207713_1004070
492 Ga0207682_10014876
493 Ga0207688_10000595
494 Ga0207688_10131967
495 Ga0207688_10183039
496 Ga0207680_10195750
497 Ga0207647_10000090
498 Ga0207645_10014142
499 Ga0207645_10049577
500 Ga0207645_10098403
501 Ga0207645_10368249
502 Ga0207705_10010417
503 Ga0207705_10251455
504 Ga0207654_10268968
505 Ga0207660_10000522
506 Ga0207657_10002682
507 Ga0207657_10027079
508 Ga0207657_10039308
509 Ga0207657_10102626
510 Ga0207649_10257775
511 Ga0207649_10265841
512 Ga0207649_10272023
513 Ga0207681_10040784
514 Ga0207681_10164164
515 Ga0207650_10001425
516 Ga0207650_10028467
517 Ga0207650_10084622
518 Ga0207659_10001814
519 Ga0207659_10025454
520 Ga0207659_10070015
521 Ga0207659_10822828
522 Ga0207687_10038652
523 Ga0207664_10427683
524 Ga0207644_10135685
525 Ga0207644_10266805
526 Ga0207690_10016821
527 Ga0207690_10059171
528 Ga0207690_10082860
529 Ga0207690_10465255
530 Ga0207706_10001429
531 Ga0207706_10109208
532 Ga0207706_10109313
533 Ga0207706_10117905
534 Ga0207706_10127261
535 Ga0207706_10200722
536 Ga0207669_10002095
537 Ga0207669_10063236
538 Ga0207704_10014927
539 Ga0207691_10021931
540 Ga0207691_10027371
541 Ga0207691_10304889
542 Ga0207711_10373120
543 Ga0207689_10000226
544 Ga0207689_10284130
545 Ga0207679_10106091
546 Ga0207679_10137934
547 Ga0207679_10167947
548 Ga0207667_10102292
549 Ga0207651_10016674
550 Ga0207651_10043084
551 Ga0207651_10447842
552 Ga0207668_10035311
553 Ga0207668_10351209
554 Ga0207640_10036791
555 Ga0207640_10243049
556 Ga0207677_10011520
557 Ga0207677_10060771
558 Ga0207639_10406058
559 Ga0207678_10044523
560 Ga0207678_10095495
561 Ga0207678_10163369
562 Ga0207678_10249372
563 Ga0207678_10399265
564 Ga0207641_10003834
565 Ga0207648_10002102
566 Ga0207648_10080342
567 Ga0207648_10130223
568 Ga0207674_10000531
569 Ga0207674_10132395
570 Ga0207674_10211205
571 Ga0207675_100039465
572 Ga0207675_100563375
573 Ga0207683_10221045
574 Ga0207683_10357320
575 Ga0207698_10112763
576 Ga0268266_10002799
577 Ga0268266_10014935
578 Ga0307408_100001159
579 Ga0307408_100206899
580 Ga0307408_100231003
581 Ga0307408_100304519
582 Ga0307405_10000240
583 Ga0307405_10019686
584 Ga0307405_10191244
585 Ga0307413_10000616
586 Ga0307413_10002633
587 Ga0307413_10012640
588 Ga0307413_10025910
589 Ga0307413_10027487
590 Ga0307413_10080549
591 Ga0307413_10112039
592 Ga0307413_10171170
593 Ga0307413_10274691
594 Ga0307413_10292011
595 Ga0307413_10441797
596 Ga0307413_10577154
597 Ga0307410_10011968
598 Ga0307410_10016045
599 Ga0307410_10017901
600 Ga0307410_10029803
601 Ga0307410_10052862
602 Ga0307410_10091864
603 Ga0307410_10104049
604 Ga0307410_10107851
605 Ga0307410_10115873
606 Ga0307410_10134525
607 Ga0307410_10149529
608 Ga0307410_10156587
609 Ga0307410_10222299
610 Ga0307410_10250851
611 Ga0307410_10339189
612 Ga0307410_10550242
613 Ga0307406_10033340
614 Ga0307406_10111908
615 Ga0307406_10204720
616 Ga0307406_10243633
617 Ga0307406_10326325
618 Ga0307407_10000541
619 Ga0307407_10007778
620 Ga0307407_10017016
621 Ga0307407_10019151
622 Ga0307407_10074055
623 Ga0307407_10075338
624 Ga0307407_10091745
625 Ga0307407_10170258
626 Ga0307412_10000248
627 Ga0307412_10066046
628 Ga0307412_10353686
629 Ga0307409_100003998
630 Ga0307409_100004995
631 Ga0307409_100013953
632 Ga0307409_100014408
633 Ga0307409_100048713
634 Ga0307409_100089184
635 Ga0307409_100114662
636 Ga0307409_100122257
637 Ga0307409_100132764
638 Ga0307409_100166607
639 Ga0307409_100266865
640 Ga0307409_100288633
641 Ga0307409_100435517
642 Ga0307409_100474455
643 Ga0307416_100001974
644 Ga0307416_100004905
645 Ga0307416_100055888
646 Ga0307416_100070989
647 Ga0307416_100274843
648 Ga0307416_100557236
649 Ga0307416_100666158
650 Ga0307416_100961071
651 Ga0307414_10006155
652 Ga0307414_10006463
653 Ga0307414_10017302
654 Ga0307414_10024839
655 Ga0307414_10054846
656 Ga0307414_10064787
657 Ga0307414_10081371
658 Ga0307414_10122257
659 Ga0307414_10148122
660 Ga0307414_10182925
661 Ga0307414_10292200
662 Ga0307414_10416906
663 Ga0307414_10423842
664 Ga0307411_10001520
665 Ga0307411_10005922
666 Ga0307411_10006005
667 Ga0307411_10013356
668 Ga0307411_10044538
669 Ga0307411_10053278
670 Ga0307411_10066465
671 Ga0307411_10101445
672 Ga0307411_10124085
673 Ga0307411_10146712
674 Ga0307415_100021651
675 Ga0307415_100038762
676 Ga0307415_100048033
677 Ga0307415_100055162
678 Ga0307415_100126447
679 Ga0307415_100159581
680 Ga0307415_100170551
681 Ga0307415_100264315
682 Ga0307415_100542746
683 Ga0395899_0069450
684 Ga0395899_0288929
685 Ga0395900_0043920
686 Ga0395900_0103678
687 Ga0395900_0143630
688 Ga0395900_0363902
689 Ga0395900_0396314
690 Ga0395898_0312789
691 Ga0395898_0545824
692 Ga0395905_0005435
693 Ga0395905_0096444
694 Ga0395905_0108207
695 Ga0395905_0192996
696 Ga0395905_0648301
697 Ga0395901_0035640
698 Ga0395901_0107018
699 Ga0395901_0184031
700 Ga0395901_0232054
701 Ga0439465_0123479
702 Ga0439432_013514
703 Ga0439449_0008014
704 Ga0439462_0066582
705 Ga0450920_006029
706 Ga0439434_0141144
707 Ga0466966_0017971
708 Ga0466967_0192587
709 Ga0495598_0011219
710 Ga0495598_0080504
711 Ga0495621_0015823
712 Ga0495633_0017963
713 Ga0495668_0016346
714 Ga0495625_0082535
715 Ga0495669_0003969
716 Ga0495669_0025777
717 Ga0495670_0015867
718 Ga0495670_0134873
719 Ga0495677_0018110
720 Ga0496103_0196612
721 Ga0496107_0122903
722 Ga0496109_0137693
723 Ga0496110_0033204
724 Ga0496111_0019385
725 Ga0496112_0095708
726 Ga0496114_0000016
727 Ga0496114_0380156
728 2738710571
729 2738848996
730 2738864725
731 2739297243
732 2739358921
733 2928100670
734 2928960733

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01458

SUFBD

SUF system FeS cluster assembly, SufBD

69

245

0.96

Map