F424453

General Info

Members Datasets Scaffolds Average Seq Length
367 224 334 426

Family's Representative Sequence

Representative Sequence 3300046477|Ga0495664_0050646|Ga0495664_0050646_641_2071
Length 476
Sequence MARAADRFCRPETKSGTLRVRAQDRPARRSSEETILELHCAKPAEGDFAAAPTFSRTYAWIIFALTFGLLLSDYMSRQVLNAVFPLLKSAWGLSDTQLGSLSSVVALMVGLLTFPLSVLADRWGRVRSLILMAALWSLATLGCAFATNYGEMLVARAFVGLGEAAYGSVGIALILSIFPPHLRSTLTGAFMAGGAFGSVLGMALGGFVAVHFGWRSSFGAMACFGIVLVVAYRIVVSEKRIASRQPNRAGQEASRSDVVTSLRTLVAGLFSTVSVVCAYVGSGLQLFIMGAVLAWMPSFLNRSYGLAPDKAAAGAAVFVLLGALGMVACGIVTDRICRASPPRKWTTAVFYCLTSFALLATGFHLEPGALQLALLGAGIFLVAGTSGPAGAMVANLTPSSIHASAFATLTLANNLLGLAPGPLVTGLIADRIGLVGALQVIPLVSLAAALAFAIGRSRYARDLRRIDALRGKAVNQ

Samples

Sample ID Description Type Environment
1 2511231021 Pseudomonas sp. GM78 Isolate Nodule
2 2511231024 Pseudomonas sp. GM84 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
6 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
7 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
8 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
9 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
10 2643221645 Massilia sp. Root351 Isolate Unclassified
11 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
12 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
13 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
14 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
15 2739367700 Dyella sp. YR388 Isolate Unclassified
16 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
17 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
18 2818991452 Burkholderia cepacia 561 Isolate Unclassified
19 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
20 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
21 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
22 2922554459 Rhodococcus sp. 66b Isolate Unclassified
23 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
24 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
25 2928163908 Burkholderia sp. 567 Isolate Unclassified
26 2928170801 Burkholderia sp. 572 Isolate Unclassified
27 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
107 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
108 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
109 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
110 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
113 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
116 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
221 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
222 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
223 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
224 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.01
Metatranscriptomes 0
Isolates 8.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.81
Nodule 1.91
Rhizoplane 8.45
Rhizosphere 75.48
Stem 0
Stem Tuber 0
Unclassified 10.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000062 3300002067 Bacteria 44723
2 Ga0055532_1001430 3300003758 Bacteria 6659
3 Ga0055532_1002516 3300003758 Bacteria 3731
4 Ga0055527_1000165 3300003760 Bacteria 45611
5 Ga0055535_1000333 3300003761 Bacteria 47259
6 Ga0065714_10010179 3300005288 Bacteria 3325
7 Ga0065704_10007727 3300005289 Bacteria 3377
8 Ga0065704_10072024 3300005289 Bacteria 9363
9 Ga0070658_10049755 3300005327 Bacteria 3396
10 Ga0070658_10226800 3300005327 Bacteria 1581
11 Ga0070660_100000231 3300005339 Bacteria 37089
12 Ga0070675_100048111 3300005354 Bacteria 3495
13 Ga0070659_100000015 3300005366 Bacteria 176475
14 Ga0070701_10021741 3300005438 Bacteria 3067
15 Ga0070663_100004384 3300005455 Bacteria 8285
16 Ga0070663_100048934 3300005455 Bacteria 2999
17 Ga0070679_100028609 3300005530 Bacteria 5496
18 Ga0070665_100150127 3300005548 Bacteria 2333
19 Ga0068855_100014945 3300005563 Bacteria 9352
20 Ga0068852_100001244 3300005616 Bacteria 16975
21 Ga0068859_100085267 3300005617 Bacteria 3204
22 Ga0068858_100127166 3300005842 Bacteria 2387
23 Ga0075432_10004378 3300006058 Bacteria 4809
24 Ga0075432_10017292 3300006058 Bacteria 2460
25 Ga0097620_100085268 3300006931 Bacteria 3204
26 Ga0079104_1000155 3300006946 Bacteria 97065
27 Ga0105251_10011811 3300009011 Bacteria 4970
28 Ga0105244_10002710 3300009036 Bacteria 13248
29 Ga0105250_10002550 3300009092 Bacteria 9101
30 Ga0105240_10211515 3300009093 Bacteria 2266
31 Ga0105243_10005353 3300009148 Bacteria 10015
32 Ga0105243_10012013 3300009148 Bacteria 6546
33 Ga0105248_10095863 3300009177 Bacteria 3340
34 Ga0105237_10094996 3300009545 Bacteria 2970
35 Ga0105238_10038382 3300009551 Bacteria 4864
36 Ga0105238_10145664 3300009551 Bacteria 2345
37 Ga0105238_10240183 3300009551 Bacteria 1789
38 Ga0105249_10260018 3300009553 Bacteria 1724
39 Ga0105239_10013009 3300010375 Bacteria 9256
40 Ga0157373_10003162 3300013100 Bacteria 12438
41 Ga0157370_10003724 3300013104 Bacteria 17816
42 Ga0157369_10016780 3300013105 Bacteria 8230
43 Ga0163162_10014744 3300013306 Bacteria 7639
44 Ga0157372_10004097 3300013307 Bacteria 15629
45 Ga0157375_10203598 3300013308 Bacteria 2135
46 Ga0157380_10001078 3300014326 Bacteria 17526
47 Ga0182007_10001353 3300015262 Bacteria 13220
48 Ga0213872_10007478 3300021361 Bacteria 5372
49 Ga0209566_100258 3300025225 Bacteria 50542
50 Ga0209674_101371 3300025226 Bacteria 6596
51 Ga0209672_100037 3300025228 Bacteria 287776
52 Ga0209147_100049 3300025229 Bacteria 274980
53 Ga0209147_100091 3300025229 Bacteria 168353
54 Ga0209258_100066 3300025242 Bacteria 287776
55 Ga0209148_1000664 3300025254 Bacteria 29497
56 Ga0209759_1015874 3300025256 Bacteria 1925
57 Ga0209455_1000530 3300025272 Bacteria 26704
58 Ga0209025_1002150 3300025294 Bacteria 22035
59 Ga0207426_1001635 3300025302 Bacteria 17563
60 Ga0207696_1000016 3300025711 Bacteria 502467
61 Ga0207696_1005855 3300025711 Bacteria 5044
62 Ga0207655_1000302 3300025728 Bacteria 74492
63 Ga0207655_1014992 3300025728 Bacteria 4339
64 Ga0207713_1003013 3300025735 Bacteria 11768
65 Ga0207713_1003019 3300025735 Bacteria 11747
66 Ga0207713_1020424 3300025735 Bacteria 3209
67 Ga0207647_10003731 3300025904 Bacteria 11393
68 Ga0207705_10001444 3300025909 Bacteria 18966
69 Ga0207695_10000268 3300025913 Bacteria 130752
70 Ga0207695_10028943 3300025913 Bacteria 6132
71 Ga0207657_10000014 3300025919 Bacteria 175779
72 Ga0207652_10159736 3300025921 Bacteria 2020
73 Ga0207694_10016042 3300025924 Bacteria 5651
74 Ga0207659_10058750 3300025926 Bacteria 2762
75 Ga0207690_10000023 3300025932 Bacteria 196155
76 Ga0207690_10113843 3300025932 Bacteria 1953
77 Ga0207706_10018961 3300025933 Bacteria 6186
78 Ga0207711_10048724 3300025941 Bacteria 3625
79 Ga0207667_10003912 3300025949 Bacteria 18325
80 Ga0207667_10009541 3300025949 Bacteria 11420
81 Ga0207667_10167003 3300025949 Bacteria 2262
82 Ga0207712_10240280 3300025961 Bacteria 1458
83 Ga0207678_10018665 3300026067 Bacteria 6089
84 Ga0207678_10033471 3300026067 Bacteria 4476
85 Ga0207698_10084826 3300026142 Bacteria 2569
86 Ga0209281_1000013 3300027111 Bacteria 653449
87 Ga0207428_10023027 3300027907 Bacteria 5245
88 Ga0207428_10120736 3300027907 Bacteria 2010
89 Ga0268266_10120903 3300028379 Bacteria 2331
90 Ga0268265_10145147 3300028380 Bacteria 1993
91 Ga0307416_100083793 3300032002 Bacteria 2707
92 Ga0395899_0062069 3300037312 Bacteria 2752
93 Ga0395898_0028762 3300037466 Bacteria 5570
94 Ga0395905_0000029 3300037471 Bacteria 293016
95 Ga0395905_0185232 3300037471 Bacteria 1954
96 Ga0395901_0000087 3300038443 Bacteria 125110
97 Ga0395901_0007275 3300038443 Bacteria 11170
98 Ga0436361_0181463 3300039447 Bacteria 16266
99 Ga0439436_0001574 3300041404 Bacteria 6644
100 Ga0439438_000707 3300041405 Bacteria 14918
101 Ga0439466_0001377 3300041411 Bacteria 9463
102 Ga0439432_002924 3300042006 Bacteria 6369
103 Ga0439452_006977 3300042010 Bacteria 3493
104 Ga0450903_006262 3300042138 Bacteria 1981
105 Ga0439446_0005921 3300042156 Bacteria 3165
106 Ga0439434_0002964 3300042435 Bacteria 4962
107 Ga0495617_001545 3300046452 Bacteria 9972
108 Ga0495617_001645 3300046452 Bacteria 9607
109 Ga0495617_004458 3300046452 Bacteria 5093
110 Ga0495603_0000235 3300046455 Bacteria 28862
111 Ga0495603_0000965 3300046455 Bacteria 16548
112 Ga0495603_0016296 3300046455 Bacteria 4497
113 Ga0495590_0001868 3300046457 Bacteria 8905
114 Ga0495591_000143 3300046458 Bacteria 76321
115 Ga0495591_035626 3300046458 Bacteria 1454
116 Ga0495629_0140202 3300046459 Bacteria 1682
117 Ga0495638_0001489 3300046460 Bacteria 21175
118 Ga0495638_0022883 3300046460 Bacteria 4096
119 Ga0495638_0027244 3300046460 Bacteria 3700
120 Ga0495638_0030006 3300046460 Bacteria 3503
121 Ga0495651_0109644 3300046462 Bacteria 2043
122 Ga0495653_0000698 3300046463 Bacteria 25616
123 Ga0495653_0004373 3300046463 Bacteria 11419
124 Ga0495653_0081932 3300046463 Bacteria 2383
125 Ga0495650_0000129 3300046471 Bacteria 177255
126 Ga0495650_0000768 3300046471 Bacteria 39676
127 Ga0495650_0003199 3300046471 Bacteria 12183
128 Ga0495580_0004897 3300046472 Bacteria 11196
129 Ga0495580_0007102 3300046472 Bacteria 9023
130 Ga0495580_0021894 3300046472 Bacteria 4712
131 Ga0495582_0067475 3300046473 Bacteria 1976
132 Ga0495605_0008626 3300046474 Bacteria 5759
133 Ga0495605_0019747 3300046474 Bacteria 3593
134 Ga0495605_0049907 3300046474 Bacteria 2043
135 Ga0495639_0006749 3300046475 Bacteria 4936
136 Ga0495639_0035193 3300046475 Bacteria 2240
137 Ga0495662_0007626 3300046476 Bacteria 5339
138 Ga0495664_0050646 3300046477 Bacteria 2466
139 Ga0495584_0052518 3300046491 Bacteria 2051
140 Ga0495585_0029199 3300046492 Bacteria 3140
141 Ga0495594_0012216 3300046499 Bacteria 4472
142 Ga0495594_0086281 3300046499 Bacteria 1756
143 Ga0495596_0000050 3300046500 Bacteria 87493
144 Ga0495596_0033831 3300046500 Bacteria 2033
145 Ga0495596_0036649 3300046500 Bacteria 1942
146 Ga0495607_0001822 3300046501 Bacteria 18181
147 Ga0495607_0012902 3300046501 Bacteria 5495
148 Ga0495607_0014768 3300046501 Bacteria 5077
149 Ga0495607_0030199 3300046501 Bacteria 3329
150 Ga0495583_0066979 3300046506 Bacteria 1587
151 Ga0495606_0001973 3300046507 Bacteria 25319
152 Ga0495606_0028622 3300046507 Bacteria 3926
153 Ga0495610_0007522 3300046512 Bacteria 7222
154 Ga0495610_0035479 3300046512 Bacteria 2560
155 Ga0495616_0029182 3300046513 Bacteria 2914
156 Ga0495616_0037197 3300046513 Bacteria 2506
157 Ga0495620_0000056 3300046515 Bacteria 99298
158 Ga0495620_0014513 3300046515 Bacteria 4003
159 Ga0495620_0019005 3300046515 Bacteria 3391
160 Ga0495628_0104453 3300046516 Bacteria 2183
161 Ga0495628_0181239 3300046516 Bacteria 1593
162 Ga0495630_0025397 3300046517 Bacteria 4381
163 Ga0495631_0000946 3300046518 Bacteria 18094
164 Ga0495632_0000021 3300046519 Bacteria 187363
165 Ga0495632_0007452 3300046519 Bacteria 6872
166 Ga0495632_0033846 3300046519 Bacteria 2620
167 Ga0495632_0075477 3300046519 Bacteria 1613
168 Ga0495637_0001552 3300046520 Bacteria 13393
169 Ga0495637_0001865 3300046520 Bacteria 12042
170 Ga0495637_0002420 3300046520 Bacteria 10311
171 Ga0495637_0032598 3300046520 Bacteria 2293
172 Ga0495643_0000253 3300046522 Bacteria 78774
173 Ga0495643_0000297 3300046522 Bacteria 69703
174 Ga0495643_0010291 3300046522 Bacteria 5760
175 Ga0495643_0015199 3300046522 Bacteria 4556
176 Ga0495643_0015587 3300046522 Bacteria 4489
177 Ga0495644_0003951 3300046523 Bacteria 5826
178 Ga0495644_0020402 3300046523 Bacteria 2529
179 Ga0495648_0000099 3300046524 Bacteria 108810
180 Ga0495648_0001477 3300046524 Bacteria 22992
181 Ga0495648_0005739 3300046524 Bacteria 10241
182 Ga0495648_0012107 3300046524 Bacteria 6456
183 Ga0495648_0061165 3300046524 Bacteria 2238
184 Ga0495642_0001551 3300046528 Bacteria 10139
185 Ga0495652_0152386 3300046529 Bacteria 1804
186 Ga0495654_0002488 3300046530 Bacteria 11831
187 Ga0495654_0018863 3300046530 Bacteria 3610
188 Ga0495665_0008161 3300046531 Bacteria 5678
189 Ga0495665_0013625 3300046531 Bacteria 4395
190 Ga0495665_0045413 3300046531 Bacteria 2334
191 Ga0495586_0006765 3300046535 Bacteria 6121
192 Ga0495597_0011809 3300046542 Bacteria 4228
193 Ga0495645_0026044 3300046543 Bacteria 4244
194 Ga0495645_0026272 3300046543 Bacteria 4226
195 Ga0495667_0011865 3300046559 Bacteria 5904
196 Ga0495656_0022616 3300046615 Bacteria 2464
197 Ga0495668_0000990 3300046616 Bacteria 30837
198 Ga0495668_0001446 3300046616 Bacteria 22958
199 Ga0495668_0001607 3300046616 Bacteria 21184
200 Ga0495668_0061901 3300046616 Bacteria 2063
201 Ga0495634_0116309 3300046642 Bacteria 1715
202 Ga0495625_0020017 3300046660 Bacteria 5174
203 Ga0495625_0020663 3300046660 Bacteria 5077
204 Ga0495625_0058275 3300046660 Bacteria 2744
205 Ga0495635_0098474 3300046663 Bacteria 1999
206 Ga0495661_0026521 3300046665 Bacteria 3732
207 Ga0495661_0026585 3300046665 Bacteria 3726
208 Ga0495588_0010856 3300046674 Bacteria 4255
209 Ga0495588_0016513 3300046674 Bacteria 3569
210 Ga0495588_0156704 3300046674 Bacteria 1204
211 Ga0495657_0054500 3300046675 Bacteria 2671
212 Ga0495599_0005938 3300046678 Bacteria 7343
213 Ga0495623_0007115 3300046679 Bacteria 7268
214 Ga0495623_0093553 3300046679 Bacteria 1840
215 Ga0495623_0143699 3300046679 Bacteria 1417
216 Ga0495646_0010786 3300046680 Bacteria 5805
217 Ga0495646_0016453 3300046680 Bacteria 4695
218 Ga0495646_0137049 3300046680 Bacteria 1372
219 Ga0495669_0007200 3300046684 Bacteria 4663
220 Ga0495613_0104529 3300046689 Bacteria 2044
221 Ga0495624_0000416 3300046690 Bacteria 33753
222 Ga0495624_0022396 3300046690 Bacteria 4176
223 Ga0495670_0000224 3300046691 Bacteria 25770
224 Ga0495670_0006100 3300046691 Bacteria 5912
225 Ga0495670_0057085 3300046691 Bacteria 1959
226 Ga0495671_0018870 3300046692 Bacteria 3653
227 Ga0495649_0001943 3300046694 Bacteria 15047
228 Ga0495649_0007645 3300046694 Bacteria 6564
229 Ga0495649_0011792 3300046694 Bacteria 5113
230 Ga0495589_0011714 3300046794 Bacteria 4552
231 Ga0495589_0017027 3300046794 Bacteria 3732
232 Ga0495589_0017113 3300046794 Bacteria 3723
233 Ga0495589_0058570 3300046794 Bacteria 1894
234 Ga0495600_0096744 3300046809 Bacteria 1924
235 Ga0495660_0013888 3300046810 Bacteria 4667
236 Ga0495660_0068062 3300046810 Bacteria 1895
237 Ga0495581_0009011 3300047315 Bacteria 5774
238 Ga0495604_0022633 3300047317 Bacteria 5018
239 Ga0495604_0117754 3300047317 Bacteria 1926
240 Ga0495636_0000264 3300047318 Bacteria 20729
241 Ga0495636_0011834 3300047318 Bacteria 3456
242 Ga0495674_0001502 3300047319 Bacteria 22869
243 Ga0495674_0038814 3300047319 Bacteria 4272
244 Ga0495672_0002215 3300047320 Bacteria 18091
245 Ga0495672_0109622 3300047320 Bacteria 1483
246 Ga0495680_0003611 3300047322 Bacteria 15136
247 Ga0495683_0013711 3300047323 Bacteria 4233
248 Ga0495683_0017632 3300047323 Bacteria 3699
249 Ga0495683_0020588 3300047323 Bacteria 3402
250 Ga0495683_0034194 3300047323 Bacteria 2585
251 Ga0495683_0039920 3300047323 Bacteria 2372
252 Ga0495687_000020 3300047443 Bacteria 337717
253 Ga0495687_000565 3300047443 Bacteria 43614
254 Ga0495687_001045 3300047443 Bacteria 27496
255 Ga0495687_008096 3300047443 Bacteria 6073
256 Ga0495675_0073136 3300047444 Bacteria 2162
257 Ga0495675_0077829 3300047444 Bacteria 2089
258 Ga0495677_0028960 3300047445 Bacteria 2013
259 Ga0495679_011952 3300047446 Bacteria 3332
260 Ga0495685_023862 3300047447 Bacteria 2105
261 Ga0495673_0003696 3300047469 Bacteria 9962
262 Ga0495673_0007085 3300047469 Bacteria 6496
263 Ga0495673_0024054 3300047469 Bacteria 2952
264 Ga0495673_0026585 3300047469 Bacteria 2765
265 Ga0495681_0001281 3300047470 Bacteria 19038
266 Ga0495681_0002406 3300047470 Bacteria 13399
267 Ga0495681_0002741 3300047470 Bacteria 12469
268 Ga0495681_0025682 3300047470 Bacteria 3078
269 Ga0495681_0028231 3300047470 Bacteria 2891
270 Ga0495686_0132820 3300047472 Bacteria 1474
271 Ga0495593_0006449 3300047673 Bacteria 6877
272 Ga0495593_0007698 3300047673 Bacteria 6287
273 Ga0495593_0025232 3300047673 Bacteria 3290
274 Ga0495593_0039270 3300047673 Bacteria 2552
275 Ga0495593_0060675 3300047673 Bacteria 1980
276 Ga0495602_0017134 3300048088 Bacteria 7267
277 Ga0495602_0109581 3300048088 Bacteria 2246
278 Ga0495602_0190063 3300048088 Bacteria 1575
279 Ga0495614_0005428 3300048089 Bacteria 5748
280 Ga0495626_0001326 3300048091 Bacteria 20109
281 Ga0496100_0006590 3300048903 Bacteria 6343
282 Ga0496100_0010280 3300048903 Bacteria 5294
283 Ga0496100_0012529 3300048903 Bacteria 4864
284 Ga0496100_0046178 3300048903 Bacteria 2799
285 Ga0496101_0048826 3300048904 Bacteria 3042
286 Ga0496101_0071151 3300048904 Bacteria 2549
287 Ga0496102_0009547 3300048905 Bacteria 8344
288 Ga0496102_0095649 3300048905 Bacteria 2753
289 Ga0496104_0083844 3300048907 Bacteria 3040
290 Ga0496105_0003027 3300048908 Bacteria 12354
291 Ga0496105_0013851 3300048908 Bacteria 6405
292 Ga0496105_0068631 3300048908 Bacteria 2929
293 Ga0496105_0172409 3300048908 Bacteria 1773
294 Ga0496106_0094732 3300048909 Bacteria 2309
295 Ga0496107_0012609 3300048910 Bacteria 5903
296 Ga0496107_0050654 3300048910 Bacteria 2994
297 Ga0496107_0082217 3300048910 Bacteria 2349
298 Ga0496108_0044491 3300048911 Bacteria 3706
299 Ga0496108_0241063 3300048911 Bacteria 1573
300 Ga0496110_0033987 3300048913 Bacteria 4413
301 Ga0496111_0115566 3300048914 Bacteria 1978
302 Ga0496111_0129853 3300048914 Bacteria 1864
303 Ga0496112_0008097 3300048915 Bacteria 9385
304 Ga0496114_0017359 3300048917 Bacteria 5808
305 Ga0496114_0025131 3300048917 Bacteria 4866
306 Ga0496114_0191297 3300048917 Bacteria 1791
307 Ga0496115_0003920 3300048918 Bacteria 10722
308 Ga0496116_0009076 3300048919 Bacteria 8523
309 Ga0496116_0018841 3300048919 Bacteria 5303
310 Ga0496117_0000406 3300048920 Bacteria 72747
311 Ga0496117_0001813 3300048920 Bacteria 29024
312 Ga0496117_0001838 3300048920 Bacteria 28714
313 Ga0496117_0015719 3300048920 Bacteria 6428
314 Ga0496118_0001113 3300048921 Bacteria 41714
315 Ga0496118_0002545 3300048921 Bacteria 24414
316 Ga0496118_0117244 3300048921 Bacteria 1747
317 Ga0496121_0007914 3300048924 Bacteria 12712
318 Ga0496122_0002159 3300048925 Bacteria 28828
319 Ga0496122_0044813 3300048925 Bacteria 3447
320 Ga0496123_0000240 3300048926 Bacteria 110383
321 Ga0496124_0016038 3300048927 Bacteria 7150
322 Ga0496124_0026931 3300048927 Bacteria 5174
323 Ga0496125_0003020 3300048928 Bacteria 21043
324 Ga0496125_0018270 3300048928 Bacteria 6663
325 Ga0496125_0088140 3300048928 Bacteria 2340
326 Ga0496126_0108337 3300048929 Bacteria 2422
327 Ga0496126_0216158 3300048929 Bacteria 1612
328 Ga0495678_012207 3300049459 Bacteria 4079
329 Ga0495678_024025 3300049459 Bacteria 2638
330 Ga0495682_0000054 3300049460 Bacteria 104787
331 Ga0495682_0049228 3300049460 Bacteria 1535
332 Ga0501032_0024685 3300049569 Bacteria 4148
333 Ga0501034_0066486 3300049571 Bacteria 3618
334 Ga0501037_0088705 3300049573 Bacteria 2239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046679 Ga0495623_0143699 Ga0495623_0143699_34_1122 321
2 3300046522 Ga0495643_0010291 Ga0495643_0010291_12_1151 332
3 3300046674 Ga0495588_0156704 Ga0495588_0156704_99_1184 334
4 3300005548 Ga0070665_100150127 Ga0070665_1001501273 358
5 3300028379 Ga0268266_10120903 Ga0268266_101209032 358
6 3300046506 Ga0495583_0066979 Ga0495583_0066979_271_1539 372
7 3300047470 Ga0495681_0001281 Ga0495681_0001281_12832_14100 372
8 3300009551 Ga0105238_10038382 Ga0105238_100383823 373
9 3300013307 Ga0157372_10004097 Ga0157372_100040972 373
10 3300025913 Ga0207695_10028943 Ga0207695_100289433 373
11 3300025924 Ga0207694_10016042 Ga0207694_100160423 373
12 3300046472 Ga0495580_0021894 Ga0495580_0021894_2129_3451 373
13 3300047443 Ga0495687_000565 Ga0495687_000565_19368_20636 373
14 3300025294 Ga0209025_1002150 Ga0209025_100215016 375
15 3300042138 Ga0450903_006262 Ga0450903_006262_360_1670 380
16 3300006058 Ga0075432_10017292 Ga0075432_100172924 382
17 3300027907 Ga0207428_10120736 Ga0207428_101207362 382
18 3300046452 Ga0495617_001545 Ga0495617_001545_6263_7588 382
19 3300046452 Ga0495617_004458 Ga0495617_004458_799_2124 382
20 3300046457 Ga0495590_0001868 Ga0495590_0001868_1991_3316 382
21 3300046458 Ga0495591_000143 Ga0495591_000143_11044_12369 382
22 3300046458 Ga0495591_035626 Ga0495591_035626_33_1358 382
23 3300046460 Ga0495638_0022883 Ga0495638_0022883_2072_3397 382
24 3300046471 Ga0495650_0003199 Ga0495650_0003199_2317_3642 382
25 3300046474 Ga0495605_0019747 Ga0495605_0019747_1569_2894 382
26 3300046500 Ga0495596_0000050 Ga0495596_0000050_17040_18365 382
27 3300046501 Ga0495607_0012902 Ga0495607_0012902_4159_5484 382
28 3300046501 Ga0495607_0030199 Ga0495607_0030199_12_1337 382
29 3300046507 Ga0495606_0028622 Ga0495606_0028622_1902_3227 382
30 3300046512 Ga0495610_0007522 Ga0495610_0007522_2595_3920 382
31 3300046513 Ga0495616_0029182 Ga0495616_0029182_780_2105 382
32 3300046513 Ga0495616_0037197 Ga0495616_0037197_660_1985 382
33 3300046515 Ga0495620_0014513 Ga0495620_0014513_2029_3354 382
34 3300046518 Ga0495631_0000946 Ga0495631_0000946_14471_15796 382
35 3300046519 Ga0495632_0007452 Ga0495632_0007452_4204_5529 382
36 3300046520 Ga0495637_0001865 Ga0495637_0001865_8499_9824 382
37 3300046520 Ga0495637_0032598 Ga0495637_0032598_571_1896 382
38 3300046522 Ga0495643_0015199 Ga0495643_0015199_2173_3498 382
39 3300046522 Ga0495643_0015587 Ga0495643_0015587_992_2317 382
40 3300046523 Ga0495644_0003951 Ga0495644_0003951_944_2269 382
41 3300046524 Ga0495648_0012107 Ga0495648_0012107_1902_3227 382
42 3300046530 Ga0495654_0002488 Ga0495654_0002488_8464_9789 382
43 3300046530 Ga0495654_0018863 Ga0495654_0018863_2177_3502 382
44 3300046542 Ga0495597_0011809 Ga0495597_0011809_832_2157 382
45 3300046616 Ga0495668_0001607 Ga0495668_0001607_8840_10165 382
46 3300046660 Ga0495625_0020663 Ga0495625_0020663_1387_2712 382
47 3300046660 Ga0495625_0058275 Ga0495625_0058275_1397_2722 382
48 3300046665 Ga0495661_0026585 Ga0495661_0026585_2173_3498 382
49 3300046691 Ga0495670_0006100 Ga0495670_0006100_372_1697 382
50 3300046692 Ga0495671_0018870 Ga0495671_0018870_570_1895 382
51 3300046694 Ga0495649_0007645 Ga0495649_0007645_2043_3368 382
52 3300046794 Ga0495589_0017113 Ga0495589_0017113_1589_2914 382
53 3300046810 Ga0495660_0013888 Ga0495660_0013888_2572_3897 382
54 3300047320 Ga0495672_0109622 Ga0495672_0109622_46_1371 382
55 3300047323 Ga0495683_0013711 Ga0495683_0013711_1279_2604 382
56 3300047323 Ga0495683_0017632 Ga0495683_0017632_2327_3652 382
57 3300047469 Ga0495673_0007085 Ga0495673_0007085_1225_2550 382
58 3300047469 Ga0495673_0026585 Ga0495673_0026585_237_1562 382
59 3300047470 Ga0495681_0002406 Ga0495681_0002406_9100_10425 382
60 3300047470 Ga0495681_0002741 Ga0495681_0002741_2709_4034 382
61 3300047472 Ga0495686_0132820 Ga0495686_0132820_101_1426 382
62 3300048091 Ga0495626_0001326 Ga0495626_0001326_16883_18208 382
63 3300049459 Ga0495678_012207 Ga0495678_012207_816_2141 382
64 3300049459 Ga0495678_024025 Ga0495678_024025_805_2130 382
65 3300005327 Ga0070658_10226800 Ga0070658_102268001 383
66 3300006946 Ga0079104_1000155 Ga0079104_100015542 383
67 3300027111 Ga0209281_1000013 Ga0209281_1000013158 383
68 3300046460 Ga0495638_0030006 Ga0495638_0030006_596_1924 383
69 3300005288 Ga0065714_10010179 Ga0065714_100101794 384
70 3300032002 Ga0307416_100083793 Ga0307416_1000837932 385
71 3300046616 Ga0495668_0061901 Ga0495668_0061901_579_1847 385
72 3300005563 Ga0068855_100014945 Ga0068855_1000149454 386
73 3300005616 Ga0068852_100001244 Ga0068852_10000124413 386
74 3300013105 Ga0157369_10016780 Ga0157369_100167803 386
75 3300025949 Ga0207667_10167003 Ga0207667_101670032 386
76 3300026142 Ga0207698_10084826 Ga0207698_100848262 386
77 3300048924 Ga0496121_0007914 Ga0496121_0007914_30_1262 387
78 3300014326 Ga0157380_10001078 Ga0157380_100010789 388
79 3300048088 Ga0495602_0190063 Ga0495602_0190063_41_1330 388
80 3300049460 Ga0495682_0000054 Ga0495682_0000054_5033_6364 388
81 3300046501 Ga0495607_0001822 Ga0495607_0001822_12606_13898 389
82 3300046660 Ga0495625_0020017 Ga0495625_0020017_3576_4868 389
83 3300047320 Ga0495672_0002215 Ga0495672_0002215_4221_5513 389
84 3300047445 Ga0495677_0028960 Ga0495677_0028960_206_1498 389
85 3300047469 Ga0495673_0024054 Ga0495673_0024054_47_1339 389
86 3300049460 Ga0495682_0049228 Ga0495682_0049228_37_1329 389
87 3300005530 Ga0070679_100028609 Ga0070679_1000286093 391
88 3300013100 Ga0157373_10003162 Ga0157373_100031628 391
89 3300025921 Ga0207652_10159736 Ga0207652_101597362 391
90 3300025932 Ga0207690_10113843 Ga0207690_101138432 391
91 3300025933 Ga0207706_10018961 Ga0207706_100189615 391
92 3300037312 Ga0395899_0062069 Ga0395899_0062069_1423_2670 392
93 3300037466 Ga0395898_0028762 Ga0395898_0028762_731_1978 392
94 3300038443 Ga0395901_0007275 Ga0395901_0007275_729_1976 392
95 3300047447 Ga0495685_023862 Ga0495685_023862_55_1302 392
96 3300005289 Ga0065704_10072024 Ga0065704_100720247 393
97 3300009148 Ga0105243_10012013 Ga0105243_100120134 393
98 3300046500 Ga0495596_0036649 Ga0495596_0036649_249_1583 393
99 3300046515 Ga0495620_0000056 Ga0495620_0000056_63008_64342 393
100 3300046519 Ga0495632_0000021 Ga0495632_0000021_23036_24370 393
101 3300046522 Ga0495643_0000253 Ga0495643_0000253_54947_56281 393
102 3300046524 Ga0495648_0000099 Ga0495648_0000099_6998_8332 393
103 3300048919 Ga0496116_0009076 Ga0496116_0009076_1447_2781 393
104 3300048920 Ga0496117_0000406 Ga0496117_0000406_48730_50064 393
105 3300003758 Ga0055532_1001430 Ga0055532_10014306 396
106 3300003758 Ga0055532_1002516 Ga0055532_10025164 396
107 3300003760 Ga0055527_1000165 Ga0055527_100016520 396
108 3300003761 Ga0055535_1000333 Ga0055535_100033327 396
109 3300005339 Ga0070660_100000231 Ga0070660_1000002317 396
110 3300005366 Ga0070659_100000015 Ga0070659_1000000157 396
111 3300005455 Ga0070663_100004384 Ga0070663_1000043846 396
112 3300005842 Ga0068858_100127166 Ga0068858_1001271662 396
113 3300009545 Ga0105237_10094996 Ga0105237_100949962 396
114 3300009551 Ga0105238_10145664 Ga0105238_101456642 396
115 3300010375 Ga0105239_10013009 Ga0105239_100130095 396
116 3300025225 Ga0209566_100258 Ga0209566_10025823 396
117 3300025228 Ga0209672_100037 Ga0209672_100037251 396
118 3300025229 Ga0209147_100049 Ga0209147_100049236 396
119 3300025229 Ga0209147_100091 Ga0209147_10009165 396
120 3300025242 Ga0209258_100066 Ga0209258_100066251 396
121 3300025254 Ga0209148_1000664 Ga0209148_10006647 396
122 3300025256 Ga0209759_1015874 Ga0209759_10158742 396
123 3300025272 Ga0209455_1000530 Ga0209455_100053025 396
124 3300025904 Ga0207647_10003731 Ga0207647_100037313 396
125 3300025913 Ga0207695_10000268 Ga0207695_10000268127 396
126 3300025919 Ga0207657_10000014 Ga0207657_100000146 396
127 3300025932 Ga0207690_10000023 Ga0207690_10000023147 396
128 3300025949 Ga0207667_10009541 Ga0207667_100095417 396
129 3300026067 Ga0207678_10018665 Ga0207678_100186655 396
130 3300028380 Ga0268265_10145147 Ga0268265_101451472 396
131 3300046463 Ga0495653_0000698 Ga0495653_0000698_4692_5951 396
132 3300046472 Ga0495580_0004897 Ga0495580_0004897_575_1834 396
133 3300046501 Ga0495607_0014768 Ga0495607_0014768_1481_2797 396
134 3300046519 Ga0495632_0033846 Ga0495632_0033846_678_1994 396
135 3300046520 Ga0495637_0001552 Ga0495637_0001552_7104_8420 396
136 3300046524 Ga0495648_0005739 Ga0495648_0005739_3864_5123 396
137 3300046531 Ga0495665_0045413 Ga0495665_0045413_319_1578 396
138 3300046615 Ga0495656_0022616 Ga0495656_0022616_514_1833 396
139 3300046680 Ga0495646_0137049 Ga0495646_0137049_56_1315 396
140 3300046690 Ga0495624_0000416 Ga0495624_0000416_11662_12921 396
141 3300046694 Ga0495649_0001943 Ga0495649_0001943_7729_9045 396
142 3300047318 Ga0495636_0011834 Ga0495636_0011834_1927_3246 396
143 3300047319 Ga0495674_0001502 Ga0495674_0001502_4167_5426 396
144 3300047446 Ga0495679_011952 Ga0495679_011952_316_1575 396
145 3300047673 Ga0495593_0006449 Ga0495593_0006449_422_1681 396
146 3300005354 Ga0070675_100048111 Ga0070675_1000481113 397
147 3300025926 Ga0207659_10058750 Ga0207659_100587502 397
148 3300049571 Ga0501034_0066486 Ga0501034_0066486_1903_3204 397
149 iso_pu_bacteria 2643221645 2644252667 397
150 3300006058 Ga0075432_10004378 Ga0075432_100043783 398
151 3300027907 Ga0207428_10023027 Ga0207428_100230272 398
152 3300046452 Ga0495617_001645 Ga0495617_001645_2449_3768 398
153 3300046460 Ga0495638_0001489 Ga0495638_0001489_5159_6478 398
154 3300046520 Ga0495637_0002420 Ga0495637_0002420_3642_4961 398
155 3300046524 Ga0495648_0001477 Ga0495648_0001477_5992_7311 398
156 3300046691 Ga0495670_0000224 Ga0495670_0000224_18459_19778 398
157 3300047443 Ga0495687_001045 Ga0495687_001045_15712_17031 398
158 3300047469 Ga0495673_0003696 Ga0495673_0003696_2678_3997 398
159 3300048919 Ga0496116_0018841 Ga0496116_0018841_602_1876 398
160 3300048927 Ga0496124_0026931 Ga0496124_0026931_762_2036 398
161 iso_pu_bacteria 2643221663 2644352543 398
162 3300025226 Ga0209674_101371 Ga0209674_1013716 399
163 3300049569 Ga0501032_0024685 Ga0501032_0024685_554_1855 399
164 3300049573 Ga0501037_0088705 Ga0501037_0088705_428_1729 399
165 3300046471 Ga0495650_0000129 Ga0495650_0000129_64970_66250 400
166 3300046616 Ga0495668_0001446 Ga0495668_0001446_21357_22637 400
167 3300021361 Ga0213872_10007478 Ga0213872_100074782 401
168 3300039447 Ga0436361_0181463 Ga0436361_0181463_3572_4894 401
169 3300046519 Ga0495632_0075477 Ga0495632_0075477_166_1500 401
170 3300047470 Ga0495681_0028231 Ga0495681_0028231_645_1979 401
171 3300046455 Ga0495603_0000965 Ga0495603_0000965_902_2254 403
172 3300046499 Ga0495594_0012216 Ga0495594_0012216_3070_4422 403
173 3300046499 Ga0495594_0086281 Ga0495594_0086281_355_1635 403
174 3300037471 Ga0395905_0185232 Ga0395905_0185232_583_1908 404
175 iso_pu_bacteria 2511231021 2511360187 405
176 iso_pu_bacteria 2511231024 2511378029 406
177 3300005289 Ga0065704_10007727 Ga0065704_100077273 408
178 3300005438 Ga0070701_10021741 Ga0070701_100217413 408
179 3300005617 Ga0068859_100085267 Ga0068859_1000852673 408
180 3300006931 Ga0097620_100085268 Ga0097620_1000852682 408
181 3300009148 Ga0105243_10005353 Ga0105243_100053539 408
182 3300009553 Ga0105249_10260018 Ga0105249_102600182 408
183 3300025711 Ga0207696_1000016 Ga0207696_100001689 408
184 3300025728 Ga0207655_1014992 Ga0207655_10149922 408
185 3300025735 Ga0207713_1020424 Ga0207713_10204244 408
186 3300025961 Ga0207712_10240280 Ga0207712_102402801 408
187 3300041404 Ga0439436_0001574 Ga0439436_0001574_514_1812 408
188 3300041405 Ga0439438_000707 Ga0439438_000707_5176_6474 408
189 3300041411 Ga0439466_0001377 Ga0439466_0001377_6587_7885 408
190 3300042006 Ga0439432_002924 Ga0439432_002924_3862_5160 408
191 3300042010 Ga0439452_006977 Ga0439452_006977_1562_2860 408
192 3300042156 Ga0439446_0005921 Ga0439446_0005921_1393_2691 408
193 3300042435 Ga0439434_0002964 Ga0439434_0002964_2082_3380 408
194 3300048920 Ga0496117_0001838 Ga0496117_0001838_7037_8371 408
195 3300048921 Ga0496118_0001113 Ga0496118_0001113_33365_34699 408
196 3300048928 Ga0496125_0003020 Ga0496125_0003020_7029_8363 408
197 3300048929 Ga0496126_0108337 Ga0496126_0108337_367_1701 408
198 iso_pu_bacteria 2565956761 2566994471 408
199 iso_pu_bacteria 2904535858 2904535998 408
200 iso_pu_bacteria 2922554459 2922555957 408
201 3300047318 Ga0495636_0000264 Ga0495636_0000264_13925_15277 409
202 3300048917 Ga0496114_0025131 Ga0496114_0025131_2542_3858 409
203 iso_pu_bacteria 2643221589 2643957425 409
204 iso_pu_bacteria 2643221602 2644021018 409
205 iso_pu_bacteria 2738543020 2739286000 409
206 iso_pu_bacteria 2738543021 2739291313 409
207 iso_pu_bacteria 2739367700 2739733064 410
208 iso_pu_bacteria 2808606379 2808942766 410
209 3300046524 Ga0495648_0061165 Ga0495648_0061165_317_1702 411
210 iso_pu_bacteria 2744054900 2746084802 411
211 iso_pu_bacteria 2858688981 2858698197 411
212 3300046507 Ga0495606_0001973 Ga0495606_0001973_5382_6707 412
213 3300046616 Ga0495668_0000990 Ga0495668_0000990_183_1544 412
214 3300046678 Ga0495599_0005938 Ga0495599_0005938_3407_4777 412
215 3300046694 Ga0495649_0011792 Ga0495649_0011792_2838_4163 412
216 3300047323 Ga0495683_0020588 Ga0495683_0020588_992_2317 412
217 iso_pu_bacteria 2511231024 2511375932 412
218 iso_pu_bacteria 2599185239 2599741559 413
219 iso_pu_bacteria 8020945358 8020949387 413
220 iso_pu_bacteria 2513237166 2514050769 414
221 iso_pu_bacteria 2599185240 2599746707 414
222 iso_pu_bacteria 2599185355 2600208613 414
223 iso_pu_bacteria 2675903129 2676744269 414
224 iso_pu_bacteria 2818991452 2819630764 414
225 iso_pu_bacteria 2870068957 2870071464 414
226 iso_pu_bacteria 2928157003 2928160400 414
227 iso_pu_bacteria 2928163908 2928170645 414
228 iso_pu_bacteria 2928170801 2928172579 414
229 iso_pu_bacteria 2981990288 2981996293 414
230 iso_pu_bacteria 641736154 642420550 414
231 iso_pu_bacteria 642555112 642598823 414
232 iso_pu_bacteria 8018845410 8018846738 414
233 iso_pu_bacteria 8021120328 8021127992 414
234 3300009036 Ga0105244_10002710 Ga0105244_100027101 415
235 3300009092 Ga0105250_10002550 Ga0105250_100025508 415
236 3300015262 Ga0182007_10001353 Ga0182007_1000135310 415
237 3300025711 Ga0207696_1005855 Ga0207696_10058553 415
238 3300025728 Ga0207655_1000302 Ga0207655_100030249 415
239 3300025735 Ga0207713_1003013 Ga0207713_10030138 415
240 3300046522 Ga0495643_0000297 Ga0495643_0000297_47956_49290 415
241 3300048917 Ga0496114_0191297 Ga0496114_0191297_82_1419 415
242 3300048920 Ga0496117_0001813 Ga0496117_0001813_7345_8679 415
243 3300048921 Ga0496118_0002545 Ga0496118_0002545_20270_21604 415
244 3300048925 Ga0496122_0002159 Ga0496122_0002159_7110_8444 415
245 3300048926 Ga0496123_0000240 Ga0496123_0000240_20385_21719 415
246 3300048927 Ga0496124_0016038 Ga0496124_0016038_770_2104 415
247 3300048928 Ga0496125_0088140 Ga0496125_0088140_210_1544 415
248 3300038443 Ga0395901_0000087 Ga0395901_0000087_92016_93338 416
249 3300046455 Ga0495603_0016296 Ga0495603_0016296_2012_3367 416
250 3300046475 Ga0495639_0006749 Ga0495639_0006749_3137_4492 416
251 iso_pu_bacteria 2928142448 2928145179 416
252 3300046455 Ga0495603_0000235 Ga0495603_0000235_343_1665 417
253 3300046459 Ga0495629_0140202 Ga0495629_0140202_18_1340 417
254 3300046462 Ga0495651_0109644 Ga0495651_0109644_410_1732 417
255 3300046463 Ga0495653_0081932 Ga0495653_0081932_822_2144 417
256 3300046471 Ga0495650_0000768 Ga0495650_0000768_4853_6175 417
257 3300046472 Ga0495580_0007102 Ga0495580_0007102_7663_8985 417
258 3300046473 Ga0495582_0067475 Ga0495582_0067475_362_1684 417
259 3300046475 Ga0495639_0035193 Ga0495639_0035193_309_1631 417
260 3300046476 Ga0495662_0007626 Ga0495662_0007626_3907_5229 417
261 3300046500 Ga0495596_0033831 Ga0495596_0033831_470_1792 417
262 3300046516 Ga0495628_0181239 Ga0495628_0181239_237_1559 417
263 3300046517 Ga0495630_0025397 Ga0495630_0025397_1834_3156 417
264 3300046523 Ga0495644_0020402 Ga0495644_0020402_881_2203 417
265 3300046528 Ga0495642_0001551 Ga0495642_0001551_2240_3562 417
266 3300046529 Ga0495652_0152386 Ga0495652_0152386_339_1661 417
267 3300046531 Ga0495665_0008161 Ga0495665_0008161_4022_5344 417
268 3300046535 Ga0495586_0006765 Ga0495586_0006765_653_1975 417
269 3300046543 Ga0495645_0026044 Ga0495645_0026044_2905_4227 417
270 3300046559 Ga0495667_0011865 Ga0495667_0011865_4163_5485 417
271 3300046642 Ga0495634_0116309 Ga0495634_0116309_233_1555 417
272 3300046665 Ga0495661_0026521 Ga0495661_0026521_986_2308 417
273 3300046674 Ga0495588_0010856 Ga0495588_0010856_751_2073 417
274 3300046675 Ga0495657_0054500 Ga0495657_0054500_261_1583 417
275 3300046679 Ga0495623_0093553 Ga0495623_0093553_44_1366 417
276 3300046680 Ga0495646_0010786 Ga0495646_0010786_3713_5035 417
277 3300046684 Ga0495669_0007200 Ga0495669_0007200_1665_2987 417
278 3300046689 Ga0495613_0104529 Ga0495613_0104529_328_1650 417
279 3300046691 Ga0495670_0057085 Ga0495670_0057085_121_1443 417
280 3300046794 Ga0495589_0011714 Ga0495589_0011714_2888_4210 417
281 3300046809 Ga0495600_0096744 Ga0495600_0096744_416_1738 417
282 3300046810 Ga0495660_0068062 Ga0495660_0068062_103_1425 417
283 3300047315 Ga0495581_0009011 Ga0495581_0009011_4435_5757 417
284 3300047317 Ga0495604_0117754 Ga0495604_0117754_469_1809 417
285 3300047319 Ga0495674_0038814 Ga0495674_0038814_128_1450 417
286 3300047323 Ga0495683_0039920 Ga0495683_0039920_392_1714 417
287 3300047443 Ga0495687_008096 Ga0495687_008096_4364_5686 417
288 3300047444 Ga0495675_0073136 Ga0495675_0073136_508_1830 417
289 3300047470 Ga0495681_0025682 Ga0495681_0025682_390_1712 417
290 3300047673 Ga0495593_0007698 Ga0495593_0007698_3731_5053 417
291 3300048089 Ga0495614_0005428 Ga0495614_0005428_4104_5426 417
292 3300048903 Ga0496100_0010280 Ga0496100_0010280_274_1596 417
293 3300048904 Ga0496101_0048826 Ga0496101_0048826_622_1944 417
294 3300048907 Ga0496104_0083844 Ga0496104_0083844_1392_2714 417
295 3300048908 Ga0496105_0013851 Ga0496105_0013851_4085_5407 417
296 3300048909 Ga0496106_0094732 Ga0496106_0094732_557_1879 417
297 3300048910 Ga0496107_0012609 Ga0496107_0012609_3713_5035 417
298 3300048911 Ga0496108_0044491 Ga0496108_0044491_405_1727 417
299 3300048913 Ga0496110_0033987 Ga0496110_0033987_510_1832 417
300 3300048914 Ga0496111_0115566 Ga0496111_0115566_246_1568 417
301 3300048917 Ga0496114_0017359 Ga0496114_0017359_4095_5417 417
302 3300048918 Ga0496115_0003920 Ga0496115_0003920_9273_10595 417
303 3300048929 Ga0496126_0216158 Ga0496126_0216158_24_1346 417
304 3300005327 Ga0070658_10049755 Ga0070658_100497552 418
305 3300005455 Ga0070663_100048934 Ga0070663_1000489343 418
306 3300009177 Ga0105248_10095863 Ga0105248_100958632 418
307 3300013104 Ga0157370_10003724 Ga0157370_1000372413 418
308 3300013306 Ga0163162_10014744 Ga0163162_100147445 418
309 3300013308 Ga0157375_10203598 Ga0157375_102035982 418
310 3300025909 Ga0207705_10001444 Ga0207705_100014449 418
311 3300025941 Ga0207711_10048724 Ga0207711_100487242 418
312 3300025949 Ga0207667_10003912 Ga0207667_1000391214 418
313 3300026067 Ga0207678_10033471 Ga0207678_100334714 418
314 3300037471 Ga0395905_0000029 Ga0395905_0000029_10358_11686 418
315 3300046460 Ga0495638_0027244 Ga0495638_0027244_313_1638 418
316 3300046474 Ga0495605_0008626 Ga0495605_0008626_2641_3966 418
317 3300046477 Ga0495664_0050646 Ga0495664_0050646_641_2071 418
318 3300046492 Ga0495585_0029199 Ga0495585_0029199_1240_2565 418
319 3300046512 Ga0495610_0035479 Ga0495610_0035479_1019_2344 418
320 3300046674 Ga0495588_0016513 Ga0495588_0016513_1995_3320 418
321 3300046794 Ga0495589_0017027 Ga0495589_0017027_360_1685 418
322 3300047443 Ga0495687_000020 Ga0495687_000020_56952_58277 418
323 3300048903 Ga0496100_0012529 Ga0496100_0012529_3209_4534 418
324 3300048905 Ga0496102_0095649 Ga0496102_0095649_579_1904 418
325 3300048908 Ga0496105_0172409 Ga0496105_0172409_12_1337 418
326 3300048910 Ga0496107_0050654 Ga0496107_0050654_1624_2949 418
327 3300047673 Ga0495593_0060675 Ga0495593_0060675_426_1772 423
328 3300047673 Ga0495593_0025232 Ga0495593_0025232_1291_2643 424
329 3300048088 Ga0495602_0109581 Ga0495602_0109581_303_1655 424
330 3300002067 JGI24735J21928_10000062 JGI24735J21928_1000006233 426
331 3300009011 Ga0105251_10011811 Ga0105251_100118114 426
332 3300009093 Ga0105240_10211515 Ga0105240_102115153 426
333 3300009551 Ga0105238_10240183 Ga0105238_102401832 426
334 3300025302 Ga0207426_1001635 Ga0207426_10016357 426
335 3300025735 Ga0207713_1003019 Ga0207713_10030198 426
336 3300046463 Ga0495653_0004373 Ga0495653_0004373_9455_10804 426
337 3300046474 Ga0495605_0049907 Ga0495605_0049907_437_1786 426
338 3300046491 Ga0495584_0052518 Ga0495584_0052518_262_1611 426
339 3300046515 Ga0495620_0019005 Ga0495620_0019005_1438_2787 426
340 3300046516 Ga0495628_0104453 Ga0495628_0104453_298_1647 426
341 3300046531 Ga0495665_0013625 Ga0495665_0013625_2852_4201 426
342 3300046543 Ga0495645_0026272 Ga0495645_0026272_633_1982 426
343 3300046663 Ga0495635_0098474 Ga0495635_0098474_236_1585 426
344 3300046679 Ga0495623_0007115 Ga0495623_0007115_880_2229 426
345 3300046680 Ga0495646_0016453 Ga0495646_0016453_446_1795 426
346 3300046690 Ga0495624_0022396 Ga0495624_0022396_434_1783 426
347 3300046794 Ga0495589_0058570 Ga0495589_0058570_439_1788 426
348 3300047317 Ga0495604_0022633 Ga0495604_0022633_859_2208 426
349 3300047322 Ga0495680_0003611 Ga0495680_0003611_10289_11638 426
350 3300047323 Ga0495683_0034194 Ga0495683_0034194_534_1883 426
351 3300047444 Ga0495675_0077829 Ga0495675_0077829_393_1742 426
352 3300047673 Ga0495593_0039270 Ga0495593_0039270_243_1592 426
353 3300048088 Ga0495602_0017134 Ga0495602_0017134_853_2202 426
354 3300048903 Ga0496100_0006590 Ga0496100_0006590_162_1511 426
355 3300048903 Ga0496100_0046178 Ga0496100_0046178_1083_2432 426
356 3300048904 Ga0496101_0071151 Ga0496101_0071151_191_1540 426
357 3300048905 Ga0496102_0009547 Ga0496102_0009547_5147_6496 426
358 3300048908 Ga0496105_0003027 Ga0496105_0003027_1660_3009 426
359 3300048908 Ga0496105_0068631 Ga0496105_0068631_330_1679 426
360 3300048910 Ga0496107_0082217 Ga0496107_0082217_504_1853 426
361 3300048911 Ga0496108_0241063 Ga0496108_0241063_82_1431 426
362 3300048914 Ga0496111_0129853 Ga0496111_0129853_46_1395 426
363 3300048915 Ga0496112_0008097 Ga0496112_0008097_7411_8760 426
364 3300048920 Ga0496117_0015719 Ga0496117_0015719_4154_5503 426
365 3300048921 Ga0496118_0117244 Ga0496118_0117244_333_1682 426
366 3300048925 Ga0496122_0044813 Ga0496122_0044813_161_1510 426
367 3300048928 Ga0496125_0018270 Ga0496125_0018270_491_1840 426

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

66

417

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.8568 24 413
7yub-assembly1.cif.gz_R s1p-bound human spns2 0.8565 24 415
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.8523 21 411
8g92-assembly1.cif.gz_A structure of inhibitor 16d-bound spns2 0.8483 21 411
7yuf-assembly1.cif.gz_R apo human spns2 0.836 21 415
ID Description Score Start End Superfamily
af_Q7XKJ7_269_452_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9173 259 398 1.20.1250.20
af_P41036_15_224_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9 22 180 1.20.1250.20
af_O96156_55_269_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8983 24 180 1.20.1250.20
af_P9WJW7_210_393_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8968 214 394 1.20.1250.20
af_A0A1D6E9C8_1_113_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8963 62 144 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A133L909-F1-model_v4 deleted 0.8633 22 395
AF-A0A748UXM7-F1-model_v4 MFS transporter 0.8609 197 395 GO:0005886
GO:0022857
AF-K2RRF1-F1-model_v4 Major facilitator superfamily 0.8579 201 400 GO:0016020
GO:0022857
AF-B3S5X6-F1-model_v4 Solute carrier organic anion transporter family member 0.8569 24 399 GO:0005886
GO:0006811
GO:0022857
AF-A0A3D5J5P7-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8512 27 180 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
70.87 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map