F424372

General Info

Members Datasets Scaffolds Average Seq Length
367 198 734 92

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_11259583|Ga0207646_112595832
Length 113
Sequence MCSVHLGWAHGLRHPAPCTFVMTSHSVTVVNQLGIHARAAAKFVHLATRFAAHVRVAREGREMDGKSIMGILLLAAARGSKITISADGTDERDAVTALVALVQSGFGEDVCGA

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.18
Rhizosphere 97.28
Stem 0
Stem Tuber 0
Unclassified 10.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_11259583 3300025922 Unclassified 647
2 JGI25406J46586_10003387 3300003203 Bacteria 7502
3 Ga0070690_100022217 3300005330 Bacteria 3880
4 Ga0070690_100367312 3300005330 Bacteria 1049
5 Ga0070677_10125748 3300005333 Bacteria 1164
6 Ga0068869_101108049 3300005334 Bacteria 693
7 Ga0068868_100671943 3300005338 Bacteria 924
8 Ga0068868_101036614 3300005338 Unclassified 752
9 Ga0070689_100197004 3300005340 Bacteria 1643
10 Ga0070689_100247189 3300005340 Bacteria 1471
11 Ga0070689_101237220 3300005340 Bacteria 671
12 Ga0070691_10013474 3300005341 Bacteria 3745
13 Ga0070692_10054625 3300005345 Bacteria 2086
14 Ga0070668_100017430 3300005347 Bacteria 5381
15 Ga0070668_100262507 3300005347 Bacteria 1437
16 Ga0070668_100292825 3300005347 Bacteria 1363
17 Ga0070669_100052508 3300005353 Bacteria 2983
18 Ga0070669_100216892 3300005353 Bacteria 1512
19 Ga0070669_100516461 3300005353 Bacteria 992
20 Ga0070675_100019786 3300005354 Bacteria 5368
21 Ga0070671_100105782 3300005355 Bacteria 2362
22 Ga0070674_100002227 3300005356 Bacteria 10668
23 Ga0070674_100493988 3300005356 Bacteria 1018
24 Ga0070674_100720078 3300005356 Bacteria 855
25 Ga0070673_100045444 3300005364 Bacteria 3405
26 Ga0070673_100564693 3300005364 Bacteria 1035
27 Ga0070673_101047451 3300005364 Bacteria 761
28 Ga0070673_101064753 3300005364 Bacteria 755
29 Ga0070673_101480682 3300005364 Bacteria 640
30 Ga0070688_100373323 3300005365 Bacteria 1050
31 Ga0070659_101696565 3300005366 Bacteria 565
32 Ga0070667_100277238 3300005367 Bacteria 1505
33 Ga0070667_102121335 3300005367 Bacteria 529
34 Ga0070713_100386045 3300005436 Bacteria 1305
35 Ga0070701_10297571 3300005438 Bacteria 991
36 Ga0070701_10906691 3300005438 Unclassified 609
37 Ga0070701_11266413 3300005438 Bacteria 526
38 Ga0070705_100305011 3300005440 Bacteria 1143
39 Ga0070705_101131149 3300005440 Unclassified 642
40 Ga0070700_100709572 3300005441 Bacteria 801
41 Ga0070708_100480694 3300005445 Bacteria 1172
42 Ga0070708_101429498 3300005445 Unclassified 645
43 Ga0070678_101034869 3300005456 Bacteria 756
44 Ga0070662_100135393 3300005457 Bacteria 1904
45 Ga0070662_100508214 3300005457 Bacteria 1006
46 Ga0068867_100025403 3300005459 Bacteria 4250
47 Ga0070685_10847250 3300005466 Bacteria 677
48 Ga0070706_100158523 3300005467 Bacteria 2113
49 Ga0070706_100977432 3300005467 Bacteria 781
50 Ga0070707_100047218 3300005468 Bacteria 4122
51 Ga0070707_100383239 3300005468 Bacteria 1366
52 Ga0070707_100442229 3300005468 Bacteria 1261
53 Ga0070707_102238820 3300005468 Unclassified 514
54 Ga0070698_101295202 3300005471 Bacteria 679
55 Ga0070698_101791920 3300005471 Bacteria 567
56 Ga0070699_100116891 3300005518 Bacteria 2344
57 Ga0070699_100147665 3300005518 Bacteria 2078
58 Ga0070699_100411269 3300005518 Bacteria 1224
59 Ga0070699_101050841 3300005518 Unclassified 747
60 Ga0070699_101212794 3300005518 Bacteria 692
61 Ga0070679_102177865 3300005530 Unclassified 504
62 Ga0070684_100883367 3300005535 Bacteria 837
63 Ga0070697_100015405 3300005536 Bacteria 6002
64 Ga0070697_100348465 3300005536 Bacteria 1279
65 Ga0068853_100784717 3300005539 Bacteria 912
66 Ga0070672_100597956 3300005543 Bacteria 960
67 Ga0070672_100688484 3300005543 Bacteria 895
68 Ga0070672_101608806 3300005543 Bacteria 583
69 Ga0070686_100421441 3300005544 Bacteria 1020
70 Ga0070686_100660159 3300005544 Bacteria 830
71 Ga0070695_100007288 3300005545 Bacteria 6556
72 Ga0070695_100009001 3300005545 Bacteria 5934
73 Ga0070695_101346073 3300005545 Unclassified 591
74 Ga0070695_101500251 3300005545 Bacteria 561
75 Ga0070696_100016045 3300005546 Bacteria 5038
76 Ga0070696_100971879 3300005546 Bacteria 708
77 Ga0070696_101714689 3300005546 Unclassified 542
78 Ga0070665_100284958 3300005548 Bacteria 1654
79 Ga0070665_102654741 3300005548 Bacteria 501
80 Ga0070704_100011292 3300005549 Bacteria 5471
81 Ga0070704_100032592 3300005549 Bacteria 3516
82 Ga0070704_100061851 3300005549 Bacteria 2682
83 Ga0070704_100433517 3300005549 Bacteria 1128
84 Ga0068855_100662550 3300005563 Bacteria 1120
85 Ga0068855_101777559 3300005563 Bacteria 627
86 Ga0070664_101787447 3300005564 Unclassified 583
87 Ga0070664_101828561 3300005564 Bacteria 576
88 Ga0068854_100962602 3300005578 Bacteria 754
89 Ga0070702_100003607 3300005615 Bacteria 6956
90 Ga0068859_100117264 3300005617 Bacteria 2727
91 Ga0068859_100181414 3300005617 Unclassified 2188
92 Ga0068859_100414706 3300005617 Bacteria 1443
93 Ga0068859_101117949 3300005617 Bacteria 867
94 Ga0068864_100729055 3300005618 Bacteria 970
95 Ga0068864_101076255 3300005618 Bacteria 799
96 Ga0068864_101288492 3300005618 Bacteria 731
97 Ga0068861_100016144 3300005719 Bacteria 5276
98 Ga0068861_100384012 3300005719 Bacteria 1242
99 Ga0068861_100785060 3300005719 Bacteria 893
100 Ga0068863_100023151 3300005841 Bacteria 5936
101 Ga0068863_101758985 3300005841 Bacteria 630
102 Ga0068858_100437117 3300005842 Bacteria 1260
103 Ga0068858_100438441 3300005842 Bacteria 1258
104 Ga0068858_100462825 3300005842 Unclassified 1223
105 Ga0068860_100193136 3300005843 Bacteria 1971
106 Ga0068860_101130612 3300005843 Unclassified 803
107 Ga0068860_102676544 3300005843 Bacteria 517
108 Ga0068862_100374221 3300005844 Bacteria 1327
109 Ga0068862_102373503 3300005844 Unclassified 542
110 Ga0081455_10029065 3300005937 Bacteria 5044
111 Ga0081455_10135547 3300005937 Bacteria 1919
112 Ga0081539_10000056 3300005985 Bacteria 256522
113 Ga0070717_10812166 3300006028 Bacteria 851
114 Ga0070712_101096094 3300006175 Bacteria 691
115 Ga0068871_100221021 3300006358 Bacteria 1641
116 Ga0068871_100755478 3300006358 Bacteria 894
117 Ga0068871_101919721 3300006358 Bacteria 563
118 Ga0075428_100160717 3300006844 Bacteria 2438
119 Ga0075428_100626321 3300006844 Bacteria 1148
120 Ga0075428_101042245 3300006844 Bacteria 865
121 Ga0075433_10017535 3300006852 Bacteria 5935
122 Ga0075433_10149522 3300006852 Bacteria 2077
123 Ga0075433_10492808 3300006852 Bacteria 1079
124 Ga0075434_100019758 3300006871 Bacteria 6523
125 Ga0075434_100059097 3300006871 Bacteria 3811
126 Ga0075434_101047360 3300006871 Bacteria 830
127 Ga0075434_101056672 3300006871 Bacteria 826
128 Ga0075434_101068942 3300006871 Bacteria 820
129 Ga0075434_101909442 3300006871 Bacteria 600
130 Ga0075429_100369445 3300006880 Bacteria 1256
131 Ga0068865_100739271 3300006881 Bacteria 844
132 Ga0075436_100013077 3300006914 Bacteria 5689
133 Ga0097620_100117265 3300006931 Bacteria 2727
134 Ga0097620_100181426 3300006931 Unclassified 2188
135 Ga0097620_100414690 3300006931 Bacteria 1443
136 Ga0097620_101118027 3300006931 Bacteria 867
137 Ga0097620_102124889 3300006931 Unclassified 620
138 Ga0075435_100009617 3300007076 Bacteria 7017
139 Ga0075435_100175864 3300007076 Bacteria 1808
140 Ga0075435_101337023 3300007076 Bacteria 628
141 Ga0099795_10352310 3300007788 Bacteria 659
142 Ga0105240_11841432 3300009093 Bacteria 630
143 Ga0105240_11844748 3300009093 Bacteria 630
144 Ga0105240_11972793 3300009093 Bacteria 607
145 Ga0111539_10120933 3300009094 Bacteria 3068
146 Ga0111539_10143891 3300009094 Bacteria 2791
147 Ga0111539_13082236 3300009094 Bacteria 538
148 Ga0105245_10010963 3300009098 Bacteria 7887
149 Ga0105245_11221429 3300009098 Bacteria 800
150 Ga0105247_10761908 3300009101 Unclassified 735
151 Ga0114129_10015787 3300009147 Bacteria 10738
152 Ga0114129_10035148 3300009147 Bacteria 7080
153 Ga0114129_10035666 3300009147 Bacteria 7026
154 Ga0114129_10041791 3300009147 Bacteria 6456
155 Ga0114129_10580152 3300009147 Bacteria 1455
156 Ga0105243_10023088 3300009148 Bacteria 4732
157 Ga0105243_10558056 3300009148 Bacteria 1095
158 Ga0105242_10002076 3300009176 Bacteria 15787
159 Ga0105248_10061692 3300009177 Bacteria 4210
160 Ga0105248_10237173 3300009177 Bacteria 2053
161 Ga0105248_10356797 3300009177 Bacteria 1646
162 Ga0105248_11611732 3300009177 Bacteria 735
163 Ga0105248_11798661 3300009177 Bacteria 695
164 Ga0105237_10519478 3300009545 Bacteria 1197
165 Ga0105249_10251441 3300009553 Bacteria 1752
166 Ga0105249_10332646 3300009553 Bacteria 1533
167 Ga0105239_10848976 3300010375 Bacteria 1047
168 Ga0105246_11178044 3300011119 Unclassified 704
169 Ga0157371_11384204 3300013102 Bacteria 546
170 Ga0157374_10002657 3300013296 Bacteria 15054
171 Ga0163162_10109771 3300013306 Bacteria 2856
172 Ga0163162_12444727 3300013306 Bacteria 601
173 Ga0157375_10097267 3300013308 Bacteria 3018
174 Ga0157375_10370318 3300013308 Bacteria 1599
175 Ga0163163_10395290 3300014325 Bacteria 1440
176 Ga0157380_10287571 3300014326 Bacteria 1508
177 Ga0157380_12117710 3300014326 Bacteria 625
178 Ga0157377_10139154 3300014745 Bacteria 1490
179 Ga0157379_10135296 3300014968 Bacteria 2220
180 Ga0157376_10011761 3300014969 Bacteria 6464
181 Ga0157376_10047501 3300014969 Bacteria 3544
182 Ga0157376_10115617 3300014969 Bacteria 2369
183 Ga0157376_10551548 3300014969 Bacteria 1141
184 Ga0163161_10588538 3300017792 Bacteria 916
185 Ga0163161_11005139 3300017792 Bacteria 712
186 Ga0207688_10083596 3300025901 Bacteria 1826
187 Ga0207680_10278205 3300025903 Bacteria 1162
188 Ga0207680_11130207 3300025903 Bacteria 560
189 Ga0207645_10001664 3300025907 Bacteria 18110
190 Ga0207645_10186204 3300025907 Bacteria 1363
191 Ga0207645_11192900 3300025907 Bacteria 511
192 Ga0207684_10315049 3300025910 Bacteria 1349
193 Ga0207684_10893323 3300025910 Bacteria 747
194 Ga0207684_11067111 3300025910 Bacteria 673
195 Ga0207654_10406572 3300025911 Bacteria 947
196 Ga0207707_10208756 3300025912 Bacteria 1702
197 Ga0207707_10665896 3300025912 Unclassified 876
198 Ga0207693_11038603 3300025915 Bacteria 624
199 Ga0207662_10381471 3300025918 Bacteria 952
200 Ga0207646_10042888 3300025922 Bacteria 4065
201 Ga0207646_10438459 3300025922 Bacteria 1179
202 Ga0207646_11493974 3300025922 Unclassified 585
203 Ga0207681_10037333 3300025923 Bacteria 3210
204 Ga0207681_10056796 3300025923 Bacteria 2671
205 Ga0207681_10582098 3300025923 Bacteria 923
206 Ga0207659_10367223 3300025926 Bacteria 1197
207 Ga0207659_11916327 3300025926 Bacteria 502
208 Ga0207687_11069127 3300025927 Bacteria 693
209 Ga0207700_10260569 3300025928 Bacteria 1485
210 Ga0207664_10035595 3300025929 Bacteria 3843
211 Ga0207644_10144594 3300025931 Bacteria 1834
212 Ga0207644_10340597 3300025931 Bacteria 1216
213 Ga0207690_10993775 3300025932 Bacteria 698
214 Ga0207706_10063090 3300025933 Bacteria 3263
215 Ga0207706_11412651 3300025933 Bacteria 571
216 Ga0207686_10670418 3300025934 Bacteria 822
217 Ga0207709_10025374 3300025935 Bacteria 3393
218 Ga0207709_10782334 3300025935 Unclassified 769
219 Ga0207709_11289618 3300025935 Bacteria 603
220 Ga0207670_10206014 3300025936 Bacteria 1497
221 Ga0207669_10541527 3300025937 Bacteria 938
222 Ga0207704_10660965 3300025938 Bacteria 862
223 Ga0207665_10398717 3300025939 Bacteria 1047
224 Ga0207665_10533815 3300025939 Bacteria 910
225 Ga0207665_11307821 3300025939 Unclassified 578
226 Ga0207691_10139745 3300025940 Bacteria 2135
227 Ga0207691_10605161 3300025940 Bacteria 928
228 Ga0207691_11067803 3300025940 Bacteria 672
229 Ga0207711_10108567 3300025941 Bacteria 2465
230 Ga0207711_10273194 3300025941 Bacteria 1555
231 Ga0207689_10792715 3300025942 Bacteria 800
232 Ga0207689_11017741 3300025942 Bacteria 699
233 Ga0207679_11032905 3300025945 Unclassified 754
234 Ga0207667_10400237 3300025949 Bacteria 1398
235 Ga0207667_11336979 3300025949 Bacteria 692
236 Ga0207651_10061757 3300025960 Bacteria 2608
237 Ga0207651_10283038 3300025960 Bacteria 1371
238 Ga0207651_10592504 3300025960 Bacteria 968
239 Ga0207651_10893802 3300025960 Bacteria 791
240 Ga0207712_10224064 3300025961 Bacteria 1505
241 Ga0207712_10424495 3300025961 Bacteria 1122
242 Ga0207668_10670295 3300025972 Bacteria 909
243 Ga0207668_11458507 3300025972 Unclassified 617
244 Ga0207640_11585136 3300025981 Bacteria 590
245 Ga0207658_10090968 3300025986 Bacteria 2366
246 Ga0207658_11132722 3300025986 Bacteria 715
247 Ga0207658_11550882 3300025986 Bacteria 606
248 Ga0207677_11016344 3300026023 Unclassified 752
249 Ga0207677_11032199 3300026023 Bacteria 747
250 Ga0207677_11720573 3300026023 Unclassified 582
251 Ga0207703_10469044 3300026035 Bacteria 1178
252 Ga0207703_10813387 3300026035 Bacteria 892
253 Ga0207639_10728403 3300026041 Bacteria 921
254 Ga0207708_10002261 3300026075 Bacteria 14190
255 Ga0207641_10005481 3300026088 Bacteria 10822
256 Ga0207641_10863530 3300026088 Bacteria 897
257 Ga0207641_11851400 3300026088 Bacteria 605
258 Ga0207648_10037255 3300026089 Bacteria 4283
259 Ga0207648_10068757 3300026089 Bacteria 3086
260 Ga0207676_10596800 3300026095 Bacteria 1060
261 Ga0207676_11008536 3300026095 Bacteria 820
262 Ga0207676_11321259 3300026095 Bacteria 716
263 Ga0207675_100006704 3300026118 Bacteria 10888
264 Ga0207675_100051856 3300026118 Bacteria 3828
265 Ga0207675_100054271 3300026118 Bacteria 3738
266 Ga0207675_100380032 3300026118 Bacteria 1389
267 Ga0207683_10607833 3300026121 Bacteria 1012
268 Ga0207428_10056638 3300027907 Bacteria 3114
269 Ga0207428_10089289 3300027907 Bacteria 2395
270 Ga0207428_10943479 3300027907 Bacteria 608
271 Ga0268266_10328477 3300028379 Bacteria 1433
272 Ga0268266_10580665 3300028379 Bacteria 1076
273 Ga0268266_11701156 3300028379 Bacteria 606
274 Ga0268265_10555515 3300028380 Unclassified 1090
275 Ga0268265_10661866 3300028380 Bacteria 1005
276 Ga0268265_12150852 3300028380 Unclassified 565
277 Ga0268264_10107997 3300028381 Bacteria 2432
278 Ga0268264_10161513 3300028381 Bacteria 2019
279 Ga0268264_10496433 3300028381 Bacteria 1190
280 Ga0307511_10234315 3300030521 Bacteria 904
281 Ga0307408_100678258 3300031548 Bacteria 924
282 Ga0307416_101381296 3300032002 Unclassified 810
283 Ga0307411_12232925 3300032005 Bacteria 513
284 Ga0373932_0220314 3300035112 Bacteria 682
285 Ga0373939_0023974 3300035114 Bacteria 1695
286 Ga0373941_0032497 3300035115 Bacteria 1562
287 Ga0373945_0129226 3300035116 Bacteria 1011
288 Ga0373957_0076413 3300035120 Bacteria 1317
289 Ga0373943_0705553 3300035170 Bacteria 598
290 Ga0373946_0313708 3300035171 Bacteria 778
291 Ga0373955_0185726 3300035172 Bacteria 1235
292 Ga0373924_0571469 3300035410 Bacteria 509
293 Ga0373931_1294849 3300035691 Bacteria 501
294 Ga0373933_0275366 3300035724 Bacteria 1087
295 Ga0373947_0063267 3300035725 Bacteria 2254
296 Ga0373937_0205469 3300036401 Bacteria 1852
297 Ga0373937_0780350 3300036401 Bacteria 903
298 Ga0373937_1171800 3300036401 Bacteria 717
299 Ga0373925_0581074 3300037068 Bacteria 922
300 Ga0395900_0994978 3300037418 Unclassified 759
301 Ga0436364_0326762 3300037853 Bacteria 1002
302 Ga0242420_106454 3300038996 Bacteria 601
303 Ga0466964_0750513 3300044706 Bacteria 548
304 Ga0466958_0513881 3300045836 Bacteria 777
305 Ga0466967_0352302 3300045976 Bacteria 1425
306 Ga0466967_2317635 3300045976 Unclassified 532
307 Ga0495629_0388918 3300046459 Bacteria 949
308 Ga0495580_0220748 3300046472 Bacteria 1303
309 Ga0495582_0382971 3300046473 Bacteria 811
310 Ga0495664_0100284 3300046477 Bacteria 1744
311 Ga0495642_0192187 3300046528 Bacteria 889
312 Ga0495640_0177138 3300046533 Bacteria 1361
313 Ga0495587_0807330 3300046536 Bacteria 512
314 Ga0495645_0023750 3300046543 Bacteria 4443
315 Ga0495656_0307564 3300046615 Bacteria 814
316 Ga0495668_0201153 3300046616 Bacteria 1091
317 Ga0495625_0742660 3300046660 Bacteria 576
318 Ga0495635_0345600 3300046663 Bacteria 993
319 Ga0495635_0722664 3300046663 Bacteria 645
320 Ga0495659_0104366 3300046664 Unclassified 1101
321 Ga0495658_0019146 3300046683 Bacteria 3570
322 Ga0495658_0024459 3300046683 Bacteria 3218
323 Ga0495613_0340727 3300046689 Bacteria 1031
324 Ga0495613_0540383 3300046689 Bacteria 781
325 Ga0495600_0876757 3300046809 Unclassified 531
326 Ga0495581_0141839 3300047315 Bacteria 1402
327 Ga0495675_0752017 3300047444 Bacteria 543
328 Ga0495684_0034530 3300047471 Bacteria 3880
329 Ga0496101_0477235 3300048904 Bacteria 985
330 Ga0496102_0959996 3300048905 Bacteria 776
331 Ga0496104_0635731 3300048907 Bacteria 976
332 Ga0496104_0983504 3300048907 Bacteria 748
333 Ga0496109_0077155 3300048912 Bacteria 3066
334 Ga0496110_0658704 3300048913 Bacteria 947
335 Ga0496114_0170004 3300048917 Bacteria 1899
336 Ga0496114_0729817 3300048917 Bacteria 867
337 Ga0501046_0506867 3300049580 Unclassified 864
338 Ga0501074_1323904 3300049590 Unclassified 505
339 Ga0501080_1640120 3300049742 Unclassified 544
340 Ga0501083_0516057 3300049744 Unclassified 778
341 nmdc:mga05p37_1315077_c1 3300050507 Bacteria 736
342 nmdc:mga05p37_14672_c1 3300050507 Bacteria 9412
343 nmdc:mga05p37_18442_c1 3300050507 Bacteria 8430
344 nmdc:mga05p37_89562_c1 3300050507 Bacteria 3792
345 nmdc:mga0qj67_1413020_c1 3300050509 Unclassified 537
346 nmdc:mga08y16_119049_c1 3300050511 Bacteria 2749
347 nmdc:mga08y16_1944312_c1 3300050511 Bacteria 538
348 nmdc:mga08y16_66035_c1 3300050511 Bacteria 3776
349 nmdc:mga0n895_1410507_c1 3300050512 Unclassified 665
350 nmdc:mga0n895_650_c1 3300050512 Bacteria 24250
351 nmdc:mga0rr50_1000124_c1 3300050513 Bacteria 712
352 nmdc:mga0rr50_152977_c1 3300050513 Bacteria 1866
353 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
354 nmdc:mga08x19_1017982_c1 3300050514 Bacteria 588
355 nmdc:mga08x19_140144_c1 3300050514 Bacteria 1633
356 nmdc:mga08x19_25238_c1 3300050514 Bacteria 3701
357 nmdc:mga08x19_757269_c1 3300050514 Bacteria 690
358 nmdc:mga08x19_906_c1 3300050514 Bacteria 18743
359 nmdc:mga0a205_108226_c1 3300050515 Bacteria 2678
360 nmdc:mga0a205_1319924_c1 3300050515 Bacteria 569
361 nmdc:mga0a205_362071_c1 3300050515 Bacteria 1317
362 Ga0495601_0017299 3300053077 Bacteria 4375
363 Ga0495612_0074194 3300053078 Bacteria 1422
364 Ga0495595_0196120 3300053084 Bacteria 1004
365 Ga0495619_0004150 3300053085 Bacteria 9258
366 Ga0495619_0864408 3300053085 Bacteria 610
367 Ga0501084_0585625 3300054114 Bacteria 943
368 Ga0207646_11259583
369 JGI25406J46586_10003387
370 Ga0070690_100022217
371 Ga0070690_100367312
372 Ga0070677_10125748
373 Ga0068869_101108049
374 Ga0068868_100671943
375 Ga0068868_101036614
376 Ga0070689_100197004
377 Ga0070689_100247189
378 Ga0070689_101237220
379 Ga0070691_10013474
380 Ga0070692_10054625
381 Ga0070668_100017430
382 Ga0070668_100262507
383 Ga0070668_100292825
384 Ga0070669_100052508
385 Ga0070669_100216892
386 Ga0070669_100516461
387 Ga0070675_100019786
388 Ga0070671_100105782
389 Ga0070674_100002227
390 Ga0070674_100493988
391 Ga0070674_100720078
392 Ga0070673_100045444
393 Ga0070673_100564693
394 Ga0070673_101047451
395 Ga0070673_101064753
396 Ga0070673_101480682
397 Ga0070688_100373323
398 Ga0070659_101696565
399 Ga0070667_100277238
400 Ga0070667_102121335
401 Ga0070713_100386045
402 Ga0070701_10297571
403 Ga0070701_10906691
404 Ga0070701_11266413
405 Ga0070705_100305011
406 Ga0070705_101131149
407 Ga0070700_100709572
408 Ga0070708_100480694
409 Ga0070708_101429498
410 Ga0070678_101034869
411 Ga0070662_100135393
412 Ga0070662_100508214
413 Ga0068867_100025403
414 Ga0070685_10847250
415 Ga0070706_100158523
416 Ga0070706_100977432
417 Ga0070707_100047218
418 Ga0070707_100383239
419 Ga0070707_100442229
420 Ga0070707_102238820
421 Ga0070698_101295202
422 Ga0070698_101791920
423 Ga0070699_100116891
424 Ga0070699_100147665
425 Ga0070699_100411269
426 Ga0070699_101050841
427 Ga0070699_101212794
428 Ga0070679_102177865
429 Ga0070684_100883367
430 Ga0070697_100015405
431 Ga0070697_100348465
432 Ga0068853_100784717
433 Ga0070672_100597956
434 Ga0070672_100688484
435 Ga0070672_101608806
436 Ga0070686_100421441
437 Ga0070686_100660159
438 Ga0070695_100007288
439 Ga0070695_100009001
440 Ga0070695_101346073
441 Ga0070695_101500251
442 Ga0070696_100016045
443 Ga0070696_100971879
444 Ga0070696_101714689
445 Ga0070665_100284958
446 Ga0070665_102654741
447 Ga0070704_100011292
448 Ga0070704_100032592
449 Ga0070704_100061851
450 Ga0070704_100433517
451 Ga0068855_100662550
452 Ga0068855_101777559
453 Ga0070664_101787447
454 Ga0070664_101828561
455 Ga0068854_100962602
456 Ga0070702_100003607
457 Ga0068859_100117264
458 Ga0068859_100181414
459 Ga0068859_100414706
460 Ga0068859_101117949
461 Ga0068864_100729055
462 Ga0068864_101076255
463 Ga0068864_101288492
464 Ga0068861_100016144
465 Ga0068861_100384012
466 Ga0068861_100785060
467 Ga0068863_100023151
468 Ga0068863_101758985
469 Ga0068858_100437117
470 Ga0068858_100438441
471 Ga0068858_100462825
472 Ga0068860_100193136
473 Ga0068860_101130612
474 Ga0068860_102676544
475 Ga0068862_100374221
476 Ga0068862_102373503
477 Ga0081455_10029065
478 Ga0081455_10135547
479 Ga0081539_10000056
480 Ga0070717_10812166
481 Ga0070712_101096094
482 Ga0068871_100221021
483 Ga0068871_100755478
484 Ga0068871_101919721
485 Ga0075428_100160717
486 Ga0075428_100626321
487 Ga0075428_101042245
488 Ga0075433_10017535
489 Ga0075433_10149522
490 Ga0075433_10492808
491 Ga0075434_100019758
492 Ga0075434_100059097
493 Ga0075434_101047360
494 Ga0075434_101056672
495 Ga0075434_101068942
496 Ga0075434_101909442
497 Ga0075429_100369445
498 Ga0068865_100739271
499 Ga0075436_100013077
500 Ga0097620_100117265
501 Ga0097620_100181426
502 Ga0097620_100414690
503 Ga0097620_101118027
504 Ga0097620_102124889
505 Ga0075435_100009617
506 Ga0075435_100175864
507 Ga0075435_101337023
508 Ga0099795_10352310
509 Ga0105240_11841432
510 Ga0105240_11844748
511 Ga0105240_11972793
512 Ga0111539_10120933
513 Ga0111539_10143891
514 Ga0111539_13082236
515 Ga0105245_10010963
516 Ga0105245_11221429
517 Ga0105247_10761908
518 Ga0114129_10015787
519 Ga0114129_10035148
520 Ga0114129_10035666
521 Ga0114129_10041791
522 Ga0114129_10580152
523 Ga0105243_10023088
524 Ga0105243_10558056
525 Ga0105242_10002076
526 Ga0105248_10061692
527 Ga0105248_10237173
528 Ga0105248_10356797
529 Ga0105248_11611732
530 Ga0105248_11798661
531 Ga0105237_10519478
532 Ga0105249_10251441
533 Ga0105249_10332646
534 Ga0105239_10848976
535 Ga0105246_11178044
536 Ga0157371_11384204
537 Ga0157374_10002657
538 Ga0163162_10109771
539 Ga0163162_12444727
540 Ga0157375_10097267
541 Ga0157375_10370318
542 Ga0163163_10395290
543 Ga0157380_10287571
544 Ga0157380_12117710
545 Ga0157377_10139154
546 Ga0157379_10135296
547 Ga0157376_10011761
548 Ga0157376_10047501
549 Ga0157376_10115617
550 Ga0157376_10551548
551 Ga0163161_10588538
552 Ga0163161_11005139
553 Ga0207688_10083596
554 Ga0207680_10278205
555 Ga0207680_11130207
556 Ga0207645_10001664
557 Ga0207645_10186204
558 Ga0207645_11192900
559 Ga0207684_10315049
560 Ga0207684_10893323
561 Ga0207684_11067111
562 Ga0207654_10406572
563 Ga0207707_10208756
564 Ga0207707_10665896
565 Ga0207693_11038603
566 Ga0207662_10381471
567 Ga0207646_10042888
568 Ga0207646_10438459
569 Ga0207646_11493974
570 Ga0207681_10037333
571 Ga0207681_10056796
572 Ga0207681_10582098
573 Ga0207659_10367223
574 Ga0207659_11916327
575 Ga0207687_11069127
576 Ga0207700_10260569
577 Ga0207664_10035595
578 Ga0207644_10144594
579 Ga0207644_10340597
580 Ga0207690_10993775
581 Ga0207706_10063090
582 Ga0207706_11412651
583 Ga0207686_10670418
584 Ga0207709_10025374
585 Ga0207709_10782334
586 Ga0207709_11289618
587 Ga0207670_10206014
588 Ga0207669_10541527
589 Ga0207704_10660965
590 Ga0207665_10398717
591 Ga0207665_10533815
592 Ga0207665_11307821
593 Ga0207691_10139745
594 Ga0207691_10605161
595 Ga0207691_11067803
596 Ga0207711_10108567
597 Ga0207711_10273194
598 Ga0207689_10792715
599 Ga0207689_11017741
600 Ga0207679_11032905
601 Ga0207667_10400237
602 Ga0207667_11336979
603 Ga0207651_10061757
604 Ga0207651_10283038
605 Ga0207651_10592504
606 Ga0207651_10893802
607 Ga0207712_10224064
608 Ga0207712_10424495
609 Ga0207668_10670295
610 Ga0207668_11458507
611 Ga0207640_11585136
612 Ga0207658_10090968
613 Ga0207658_11132722
614 Ga0207658_11550882
615 Ga0207677_11016344
616 Ga0207677_11032199
617 Ga0207677_11720573
618 Ga0207703_10469044
619 Ga0207703_10813387
620 Ga0207639_10728403
621 Ga0207708_10002261
622 Ga0207641_10005481
623 Ga0207641_10863530
624 Ga0207641_11851400
625 Ga0207648_10037255
626 Ga0207648_10068757
627 Ga0207676_10596800
628 Ga0207676_11008536
629 Ga0207676_11321259
630 Ga0207675_100006704
631 Ga0207675_100051856
632 Ga0207675_100054271
633 Ga0207675_100380032
634 Ga0207683_10607833
635 Ga0207428_10056638
636 Ga0207428_10089289
637 Ga0207428_10943479
638 Ga0268266_10328477
639 Ga0268266_10580665
640 Ga0268266_11701156
641 Ga0268265_10555515
642 Ga0268265_10661866
643 Ga0268265_12150852
644 Ga0268264_10107997
645 Ga0268264_10161513
646 Ga0268264_10496433
647 Ga0307511_10234315
648 Ga0307408_100678258
649 Ga0307416_101381296
650 Ga0307411_12232925
651 Ga0373932_0220314
652 Ga0373939_0023974
653 Ga0373941_0032497
654 Ga0373945_0129226
655 Ga0373957_0076413
656 Ga0373943_0705553
657 Ga0373946_0313708
658 Ga0373955_0185726
659 Ga0373924_0571469
660 Ga0373931_1294849
661 Ga0373933_0275366
662 Ga0373947_0063267
663 Ga0373937_0205469
664 Ga0373937_0780350
665 Ga0373937_1171800
666 Ga0373925_0581074
667 Ga0395900_0994978
668 Ga0436364_0326762
669 Ga0242420_106454
670 Ga0466964_0750513
671 Ga0466958_0513881
672 Ga0466967_0352302
673 Ga0466967_2317635
674 Ga0495629_0388918
675 Ga0495580_0220748
676 Ga0495582_0382971
677 Ga0495664_0100284
678 Ga0495642_0192187
679 Ga0495640_0177138
680 Ga0495587_0807330
681 Ga0495645_0023750
682 Ga0495656_0307564
683 Ga0495668_0201153
684 Ga0495625_0742660
685 Ga0495635_0345600
686 Ga0495635_0722664
687 Ga0495659_0104366
688 Ga0495658_0019146
689 Ga0495658_0024459
690 Ga0495613_0340727
691 Ga0495613_0540383
692 Ga0495600_0876757
693 Ga0495581_0141839
694 Ga0495675_0752017
695 Ga0495684_0034530
696 Ga0496101_0477235
697 Ga0496102_0959996
698 Ga0496104_0635731
699 Ga0496104_0983504
700 Ga0496109_0077155
701 Ga0496110_0658704
702 Ga0496114_0170004
703 Ga0496114_0729817
704 Ga0501046_0506867
705 Ga0501074_1323904
706 Ga0501080_1640120
707 Ga0501083_0516057
708 nmdc:mga05p37_1315077_c1
709 nmdc:mga05p37_14672_c1
710 nmdc:mga05p37_18442_c1
711 nmdc:mga05p37_89562_c1
712 nmdc:mga0qj67_1413020_c1
713 nmdc:mga08y16_119049_c1
714 nmdc:mga08y16_1944312_c1
715 nmdc:mga08y16_66035_c1
716 nmdc:mga0n895_1410507_c1
717 nmdc:mga0n895_650_c1
718 nmdc:mga0rr50_1000124_c1
719 nmdc:mga0rr50_152977_c1
720 nmdc:mga0rr50_8_c1
721 nmdc:mga08x19_1017982_c1
722 nmdc:mga08x19_140144_c1
723 nmdc:mga08x19_25238_c1
724 nmdc:mga08x19_757269_c1
725 nmdc:mga08x19_906_c1
726 nmdc:mga0a205_108226_c1
727 nmdc:mga0a205_1319924_c1
728 nmdc:mga0a205_362071_c1
729 Ga0495601_0017299
730 Ga0495612_0074194
731 Ga0495595_0196120
732 Ga0495619_0004150
733 Ga0495619_0864408
734 Ga0501084_0585625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

23

104

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cm3-assembly1.cif.gz_A his15asp hpr from e. coli 0.9272 1 81
3lfg-assembly2.cif.gz_B crystal structure of hpr-c-his from thermoanaerobacter tengcongensis 0.9225 1 86
5ya0-assembly1.cif.gz_C crystal structure of lsrk and hpr complex 0.9221 1 83
1opd-assembly1.cif.gz_A histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d) 0.9217 1 81
1cm2-assembly1.cif.gz_A structure of his15asp hpr after hydrolysis of ringed species. 0.9196 1 81
ID Description Score Start End Superfamily
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9182 1 83 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9144 2 81 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9137 2 86 3.30.1340.10
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8878 1 83 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8844 2 86 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A506U208-F1-model_v4 HPr family phosphocarrier protein 0.945 2 86 GO:0005737
GO:0009401
AF-A0A537UUL4-F1-model_v4 HPr family phosphocarrier protein 0.9449 2 85 GO:0005737
GO:0009401
AF-A0A6L7KDZ2-F1-model_v4 deleted 0.9439 1 86
AF-A0A1Q7HAQ8-F1-model_v4 HPr domain-containing protein 0.9437 1 86 GO:0005737
GO:0009401
AF-A0A538TIW8-F1-model_v4 HPr family phosphocarrier protein 0.9431 1 86 GO:0005737
GO:0009401

Map