F424310

General Info

Members Datasets Scaffolds Average Seq Length
367 221 734 221

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100234123|Ga0075429_1002341232
Length 272
Sequence LSAHNPAHGAAHNLPADLNPSPATSQVAFDPSLAPPGAAALHEAHGHSMVAHQFDDLAQQHEASTLGMWAFLATEVMFFGGALTAYAVYRATYPEAFAAASRLENWFVGALNTGVLLCSSLTMALAVHAAQMGSRKWIVNWLLITVVFGTAFLGVKAYEYNHLIHEHLFPRADTFDAPRHDHETGVTKPPHFPPELRRPAQLFYSLYFGMTGLHALHMVIGIGVILVVAWQAWRGRFSPEYHNPVEMTGLYWHFVDIVWIFLYPLLYLIDRT

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.27
Rhizosphere 95.64
Stem 0
Stem Tuber 0
Unclassified 7.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100234123 3300006880 Bacteria 1609
2 JGI24751J29686_10011051 3300002459 Bacteria 1861
3 Ga0065712_10068711 3300005290 Bacteria 9257
4 Ga0065712_10070160 3300005290 Bacteria 6275
5 Ga0065712_10180960 3300005290 Bacteria 1193
6 Ga0065715_10092548 3300005293 Bacteria 5063
7 Ga0065715_10264203 3300005293 Bacteria 1129
8 Ga0070676_10066571 3300005328 Bacteria 2152
9 Ga0070676_10123080 3300005328 Bacteria 1631
10 Ga0070690_100003521 3300005330 Bacteria 8573
11 Ga0070690_100041575 3300005330 Bacteria 2911
12 Ga0070690_100265729 3300005330 Bacteria 1218
13 Ga0070670_100001280 3300005331 Bacteria 20042
14 Ga0070670_100098757 3300005331 Bacteria 2512
15 Ga0070677_10038945 3300005333 Bacteria 1863
16 Ga0068869_100164534 3300005334 Bacteria 1729
17 Ga0068869_100788722 3300005334 Unclassified 816
18 Ga0070666_10009755 3300005335 Bacteria 6001
19 Ga0070680_100056287 3300005336 Bacteria 3214
20 Ga0070682_100080998 3300005337 Unclassified 2101
21 Ga0068868_100004743 3300005338 Bacteria 9548
22 Ga0068868_100358105 3300005338 Bacteria 1251
23 Ga0068868_100505585 3300005338 Unclassified 1059
24 Ga0070661_100012735 3300005344 Bacteria 5887
25 Ga0070661_100038131 3300005344 Bacteria 3498
26 Ga0070661_100254925 3300005344 Bacteria 1355
27 Ga0070668_100263804 3300005347 Unclassified 1433
28 Ga0070669_100011901 3300005353 Bacteria 6174
29 Ga0070669_100270128 3300005353 Bacteria 1359
30 Ga0070675_100068417 3300005354 Bacteria 2940
31 Ga0070675_100166011 3300005354 Bacteria 1901
32 Ga0070675_100168763 3300005354 Bacteria 1886
33 Ga0070671_100009092 3300005355 Bacteria 7974
34 Ga0070671_100030645 3300005355 Bacteria 4439
35 Ga0070674_100047627 3300005356 Bacteria 2938
36 Ga0070674_100057849 3300005356 Bacteria 2693
37 Ga0070673_100051111 3300005364 Bacteria 3235
38 Ga0070673_100199555 3300005364 Bacteria 1722
39 Ga0070659_100024406 3300005366 Bacteria 4635
40 Ga0070659_100132532 3300005366 Bacteria 2025
41 Ga0070659_100455297 3300005366 Bacteria 1086
42 Ga0070667_100191592 3300005367 Unclassified 1811
43 Ga0070709_10079350 3300005434 Bacteria 2138
44 Ga0070709_10083639 3300005434 Bacteria 2088
45 Ga0070709_10271521 3300005434 Bacteria 1229
46 Ga0070713_100007092 3300005436 Bacteria 7833
47 Ga0070711_100355920 3300005439 Bacteria 1178
48 Ga0070694_100043540 3300005444 Bacteria 3002
49 Ga0070708_100269972 3300005445 Bacteria 1600
50 Ga0070678_100019606 3300005456 Bacteria 4416
51 Ga0070662_100011219 3300005457 Bacteria 5905
52 Ga0070662_100120195 3300005457 Bacteria 2013
53 Ga0070662_100453000 3300005457 Bacteria 1065
54 Ga0070681_10013899 3300005458 Bacteria 8011
55 Ga0070681_10021342 3300005458 Bacteria 6492
56 Ga0070681_10037668 3300005458 Bacteria 4851
57 Ga0070706_100898105 3300005467 Bacteria 819
58 Ga0070698_100387378 3300005471 Bacteria 1331
59 Ga0070699_100293129 3300005518 Bacteria 1459
60 Ga0070699_100695601 3300005518 Bacteria 929
61 Ga0070679_100013022 3300005530 Bacteria 7964
62 Ga0070679_100224153 3300005530 Bacteria 1840
63 Ga0070684_100162727 3300005535 Bacteria 2025
64 Ga0070684_100263743 3300005535 Bacteria 1576
65 Ga0070684_100316156 3300005535 Bacteria 1434
66 Ga0070684_100775108 3300005535 Unclassified 896
67 Ga0070697_100015093 3300005536 Bacteria 6064
68 Ga0070672_100058930 3300005543 Bacteria 3020
69 Ga0070672_100278329 3300005543 Bacteria 1414
70 Ga0070686_100001661 3300005544 Bacteria 12427
71 Ga0070686_100216875 3300005544 Bacteria 1381
72 Ga0070695_100001059 3300005545 Bacteria 15017
73 Ga0070696_100279147 3300005546 Bacteria 1273
74 Ga0070693_100377525 3300005547 Unclassified 977
75 Ga0070665_100464031 3300005548 Unclassified 1277
76 Ga0070704_100058063 3300005549 Bacteria 2755
77 Ga0068855_100364876 3300005563 Bacteria 1589
78 Ga0070664_100000830 3300005564 Bacteria 23813
79 Ga0070664_100190100 3300005564 Bacteria 1829
80 Ga0068857_100030782 3300005577 Bacteria 4740
81 Ga0068857_100332237 3300005577 Bacteria 1405
82 Ga0068854_100185621 3300005578 Bacteria 1627
83 Ga0068852_100513936 3300005616 Unclassified 1194
84 Ga0068859_100013848 3300005617 Bacteria 8087
85 Ga0068859_100565922 3300005617 Bacteria 1231
86 Ga0068859_101144234 3300005617 Bacteria 857
87 Ga0068866_10111938 3300005718 Bacteria 1525
88 Ga0068861_100499251 3300005719 Bacteria 1100
89 Ga0068858_100017669 3300005842 Bacteria 6685
90 Ga0068860_100045562 3300005843 Bacteria 4183
91 Ga0068860_100582014 3300005843 Bacteria 1124
92 Ga0081455_10000777 3300005937 Bacteria 41065
93 Ga0070716_100512230 3300006173 Bacteria 887
94 Ga0070712_100743913 3300006175 Bacteria 839
95 Ga0075428_100045517 3300006844 Bacteria 4821
96 Ga0075428_100379520 3300006844 Bacteria 1515
97 Ga0075430_100096802 3300006846 Bacteria 2466
98 Ga0075430_100392851 3300006846 Bacteria 1145
99 Ga0075430_100527321 3300006846 Bacteria 974
100 Ga0075431_100032389 3300006847 Bacteria 5386
101 Ga0075431_100156462 3300006847 Bacteria 2345
102 Ga0075431_100219310 3300006847 Bacteria 1941
103 Ga0075431_100289553 3300006847 Bacteria 1657
104 Ga0075433_10072540 3300006852 Bacteria 3027
105 Ga0075433_10125869 3300006852 Bacteria 2276
106 Ga0075433_10389592 3300006852 Bacteria 1230
107 Ga0075434_100000743 3300006871 Bacteria 25604
108 Ga0075434_100003759 3300006871 Bacteria 13555
109 Ga0075434_100005614 3300006871 Bacteria 11434
110 Ga0075434_100038078 3300006871 Bacteria 4763
111 Ga0075434_100117571 3300006871 Bacteria 2672
112 Ga0068865_100299254 3300006881 Bacteria 1287
113 Ga0068865_100888318 3300006881 Unclassified 774
114 Ga0075436_100000744 3300006914 Bacteria 21597
115 Ga0075436_100002675 3300006914 Bacteria 12253
116 Ga0075436_100003903 3300006914 Bacteria 10220
117 Ga0075436_100099886 3300006914 Bacteria 2020
118 Ga0097620_100013848 3300006931 Bacteria 8087
119 Ga0097620_100565931 3300006931 Bacteria 1231
120 Ga0097620_101144209 3300006931 Bacteria 857
121 Ga0075435_100000039 3300007076 Bacteria 67464
122 Ga0075435_100002315 3300007076 Bacteria 12600
123 Ga0075435_100032860 3300007076 Bacteria 4099
124 Ga0075435_100041479 3300007076 Bacteria 3679
125 Ga0075435_100164821 3300007076 Bacteria 1868
126 Ga0099794_10098964 3300007265 Unclassified 1454
127 Ga0105240_10656410 3300009093 Bacteria 1149
128 Ga0105240_10800556 3300009093 Bacteria 1021
129 Ga0111539_10031025 3300009094 Bacteria 6494
130 Ga0111539_10032489 3300009094 Bacteria 6336
131 Ga0111539_10032522 3300009094 Bacteria 6333
132 Ga0111539_10121150 3300009094 Bacteria 3065
133 Ga0105245_10108585 3300009098 Bacteria 2577
134 Ga0105245_10595994 3300009098 Bacteria 1131
135 Ga0105245_11036599 3300009098 Unclassified 865
136 Ga0105247_10007829 3300009101 Bacteria 6539
137 Ga0114129_10000418 3300009147 Bacteria 50300
138 Ga0114129_10031835 3300009147 Bacteria 7456
139 Ga0114129_10475903 3300009147 Bacteria 1635
140 Ga0114129_10483969 3300009147 Bacteria 1619
141 Ga0114129_10522814 3300009147 Bacteria 1547
142 Ga0105243_10900894 3300009148 Bacteria 880
143 Ga0105241_10201074 3300009174 Unclassified 1664
144 Ga0105248_10318329 3300009177 Bacteria 1752
145 Ga0105238_10239253 3300009551 Unclassified 1793
146 Ga0105239_10187568 3300010375 Unclassified 2314
147 Ga0105246_10535207 3300011119 Bacteria 1001
148 Ga0157327_1005326 3300012512 Bacteria 1037
149 Ga0157374_10478396 3300013296 Unclassified 1248
150 Ga0157378_10007804 3300013297 Bacteria 9340
151 Ga0157378_10272278 3300013297 Bacteria 1629
152 Ga0157378_10330250 3300013297 Bacteria 1484
153 Ga0163162_10077430 3300013306 Bacteria 3389
154 Ga0163162_10149096 3300013306 Bacteria 2456
155 Ga0157372_10027505 3300013307 Bacteria 6196
156 Ga0157375_10235531 3300013308 Bacteria 1990
157 Ga0163163_10036636 3300014325 Bacteria 4767
158 Ga0163163_10048379 3300014325 Bacteria 4182
159 Ga0157379_10065603 3300014968 Bacteria 3246
160 Ga0157376_10030689 3300014969 Bacteria 4295
161 Ga0182007_10072258 3300015262 Bacteria 1130
162 Ga0163161_10720271 3300017792 Unclassified 832
163 Ga0207697_10042024 3300025315 Bacteria 1878
164 Ga0207697_10046558 3300025315 Bacteria 1787
165 Ga0207682_10009816 3300025893 Bacteria 3767
166 Ga0207710_10017461 3300025900 Bacteria 3044
167 Ga0207688_10171172 3300025901 Bacteria 1291
168 Ga0207680_10080102 3300025903 Bacteria 2050
169 Ga0207699_10069389 3300025906 Bacteria 2149
170 Ga0207699_10075865 3300025906 Bacteria 2069
171 Ga0207699_10267557 3300025906 Bacteria 1183
172 Ga0207645_10001511 3300025907 Bacteria 19014
173 Ga0207645_10041057 3300025907 Bacteria 2963
174 Ga0207645_10258268 3300025907 Bacteria 1154
175 Ga0207684_10119498 3300025910 Bacteria 2259
176 Ga0207684_10668197 3300025910 Bacteria 884
177 Ga0207654_10319224 3300025911 Unclassified 1061
178 Ga0207707_10096586 3300025912 Bacteria 2582
179 Ga0207707_10179596 3300025912 Bacteria 1848
180 Ga0207693_10527304 3300025915 Bacteria 921
181 Ga0207663_10054945 3300025916 Bacteria 2496
182 Ga0207663_10436700 3300025916 Bacteria 1007
183 Ga0207660_10041799 3300025917 Bacteria 3214
184 Ga0207657_10007180 3300025919 Bacteria 11435
185 Ga0207657_10204223 3300025919 Bacteria 1588
186 Ga0207649_10175587 3300025920 Bacteria 1496
187 Ga0207652_10003474 3300025921 Bacteria 12992
188 Ga0207652_10379097 3300025921 Unclassified 1277
189 Ga0207681_10014504 3300025923 Bacteria 4899
190 Ga0207681_10389028 3300025923 Bacteria 1124
191 Ga0207650_10001148 3300025925 Bacteria 19458
192 Ga0207650_10354301 3300025925 Bacteria 1208
193 Ga0207659_10181094 3300025926 Bacteria 1669
194 Ga0207659_10429937 3300025926 Unclassified 1109
195 Ga0207687_10784412 3300025927 Unclassified 812
196 Ga0207700_10488742 3300025928 Bacteria 1088
197 Ga0207644_10092615 3300025931 Bacteria 2255
198 Ga0207690_10009340 3300025932 Bacteria 5826
199 Ga0207690_10056144 3300025932 Bacteria 2655
200 Ga0207706_10024322 3300025933 Bacteria 5430
201 Ga0207706_10078919 3300025933 Bacteria 2895
202 Ga0207706_10154241 3300025933 Bacteria 2020
203 Ga0207706_10273124 3300025933 Unclassified 1475
204 Ga0207706_10332995 3300025933 Bacteria 1321
205 Ga0207706_10662711 3300025933 Bacteria 893
206 Ga0207706_10774468 3300025933 Bacteria 816
207 Ga0207669_10111187 3300025937 Bacteria 1836
208 Ga0207704_10568531 3300025938 Bacteria 924
209 Ga0207691_10022008 3300025940 Bacteria 6016
210 Ga0207691_10061375 3300025940 Bacteria 3415
211 Ga0207711_10106277 3300025941 Bacteria 2490
212 Ga0207711_10203636 3300025941 Bacteria 1807
213 Ga0207711_11013366 3300025941 Bacteria 770
214 Ga0207661_10270890 3300025944 Bacteria 1515
215 Ga0207679_10000457 3300025945 Bacteria 28830
216 Ga0207679_10251137 3300025945 Unclassified 1504
217 Ga0207667_10087272 3300025949 Bacteria 3228
218 Ga0207651_10201490 3300025960 Bacteria 1595
219 Ga0207651_10388741 3300025960 Bacteria 1184
220 Ga0207668_10733043 3300025972 Bacteria 871
221 Ga0207640_10009165 3300025981 Bacteria 5529
222 Ga0207640_10133652 3300025981 Bacteria 1797
223 Ga0207658_10420780 3300025986 Bacteria 1178
224 Ga0207677_10000054 3300026023 Bacteria 99124
225 Ga0207703_10517711 3300026035 Bacteria 1122
226 Ga0207703_10794047 3300026035 Bacteria 903
227 Ga0207678_10129111 3300026067 Bacteria 2155
228 Ga0207708_10396787 3300026075 Bacteria 1140
229 Ga0207702_10972076 3300026078 Unclassified 842
230 Ga0207641_10323144 3300026088 Bacteria 1464
231 Ga0207648_10079649 3300026089 Bacteria 2858
232 Ga0207648_10120995 3300026089 Bacteria 2302
233 Ga0207676_10317834 3300026095 Bacteria 1428
234 Ga0207676_10557228 3300026095 Bacteria 1096
235 Ga0207674_10031725 3300026116 Bacteria 5547
236 Ga0207674_10113318 3300026116 Bacteria 2685
237 Ga0207675_100112425 3300026118 Bacteria 2570
238 Ga0207683_10012336 3300026121 Bacteria 7291
239 Ga0207698_10277278 3300026142 Bacteria 1549
240 Ga0209974_10014748 3300027876 Bacteria 2596
241 Ga0207428_10043164 3300027907 Bacteria 3643
242 Ga0268266_10476638 3300028379 Unclassified 1189
243 Ga0268266_10704776 3300028379 Bacteria 973
244 Ga0268264_10051017 3300028381 Bacteria 3446
245 Ga0307407_10402620 3300031903 Bacteria 982
246 Ga0307416_100041817 3300032002 Bacteria 3573
247 Ga0373958_0004092 3300034819 Bacteria 2141
248 Ga0373959_0000801 3300034820 Bacteria 5368
249 Ga0373928_0001035 3300035084 Bacteria 5479
250 Ga0373929_0068481 3300035085 Bacteria 844
251 Ga0373940_0000272 3300035088 Bacteria 7441
252 Ga0373949_0001618 3300035090 Bacteria 6307
253 Ga0373923_0099305 3300035111 Bacteria 1282
254 Ga0373939_0000915 3300035114 Bacteria 7329
255 Ga0373941_0002944 3300035115 Bacteria 3805
256 Ga0373945_0038631 3300035116 Bacteria 1718
257 Ga0373960_0000771 3300035121 Bacteria 6710
258 Ga0373943_0067961 3300035170 Bacteria 1798
259 Ga0373946_0025329 3300035171 Bacteria 2333
260 Ga0373946_0069759 3300035171 Bacteria 1515
261 Ga0373942_0000027 3300035207 Bacteria 27511
262 Ga0373961_0004065 3300035241 Bacteria 3561
263 Ga0373962_0005396 3300035242 Bacteria 3094
264 Ga0373924_0061151 3300035410 Bacteria 1576
265 Ga0373931_0002138 3300035691 Bacteria 8706
266 Ga0373931_0179649 3300035691 Bacteria 1252
267 Ga0373935_0288671 3300035692 Bacteria 1156
268 Ga0373935_0464500 3300035692 Bacteria 916
269 Ga0373947_0029298 3300035725 Bacteria 3230
270 Ga0373937_0202576 3300036401 Bacteria 1866
271 Ga0373937_0582755 3300036401 Bacteria 1062
272 Ga0373925_0024619 3300037068 Bacteria 4396
273 Ga0436364_0697773 3300037853 Unclassified 1165
274 Ga0436365_0809609 3300039437 Bacteria 919
275 Ga0436365_0998676 3300039437 Bacteria 1062
276 Ga0436365_1623554 3300039437 Bacteria 22762
277 Ga0466957_0104098 3300044842 Bacteria 1793
278 Ga0451576_0144529 3300045051 Bacteria 2480
279 Ga0451576_0221165 3300045051 Bacteria 1977
280 Ga0451576_0521460 3300045051 Bacteria 1248
281 Ga0451576_0588507 3300045051 Bacteria 1169
282 Ga0451576_1125399 3300045051 Unclassified 821
283 Ga0495592_0263190 3300046454 Bacteria 1135
284 Ga0495582_0340612 3300046473 Bacteria 863
285 Ga0495618_0219467 3300046514 Bacteria 1200
286 Ga0495652_0361114 3300046529 Bacteria 1038
287 Ga0495665_0245582 3300046531 Bacteria 922
288 Ga0495586_0206809 3300046535 Bacteria 1113
289 Ga0495645_0022599 3300046543 Bacteria 4551
290 Ga0495633_0177408 3300046558 Bacteria 981
291 Ga0495634_0054777 3300046642 Bacteria 2668
292 Ga0495634_0366266 3300046642 Bacteria 861
293 Ga0495635_0294421 3300046663 Bacteria 1089
294 Ga0495657_0137486 3300046675 Bacteria 1526
295 Ga0495599_0146101 3300046678 Bacteria 1466
296 Ga0495647_0177608 3300046681 Bacteria 925
297 Ga0495613_0005920 3300046689 Bacteria 9153
298 Ga0495600_0056301 3300046809 Bacteria 2569
299 Ga0495604_0033554 3300047317 Bacteria 4063
300 Ga0495674_0315709 3300047319 Bacteria 1274
301 Ga0495675_0140134 3300047444 Bacteria 1500
302 Ga0495684_0001402 3300047471 Bacteria 19304
303 Ga0496104_0023284 3300048907 Bacteria 5694
304 Ga0496106_0245178 3300048909 Bacteria 1432
305 Ga0496106_0307093 3300048909 Bacteria 1273
306 Ga0496109_1016021 3300048912 Bacteria 767
307 Ga0496110_0045705 3300048913 Bacteria 3829
308 Ga0496111_0097821 3300048914 Bacteria 2155
309 Ga0496112_0033385 3300048915 Bacteria 5003
310 Ga0496112_0044931 3300048915 Bacteria 4329
311 Ga0496112_0338495 3300048915 Unclassified 1448
312 Ga0496113_0234461 3300048916 Bacteria 1464
313 Ga0496114_0219125 3300048917 Bacteria 1670
314 Ga0496114_0440738 3300048917 Bacteria 1154
315 Ga0501036_0061531 3300049572 Bacteria 3180
316 Ga0501038_0406233 3300049574 Bacteria 1053
317 Ga0501039_0043295 3300049575 Bacteria 3478
318 Ga0501040_0029889 3300049576 Bacteria 3678
319 Ga0501040_0364249 3300049576 Bacteria 1036
320 Ga0501041_0016453 3300049577 Bacteria 4397
321 Ga0501043_0054047 3300049579 Bacteria 3154
322 Ga0501046_0043915 3300049580 Bacteria 3556
323 Ga0501072_0027533 3300049588 Bacteria 4434
324 Ga0501077_0083946 3300049593 Bacteria 2019
325 Ga0501079_0035542 3300049741 Bacteria 3836
326 Ga0501081_0064413 3300049743 Bacteria 2546
327 Ga0501045_0006047 3300049824 Bacteria 8382
328 nmdc:mga05p37_138988_c1 3300050507 Bacteria 2977
329 nmdc:mga05p37_354757_c1 3300050507 Bacteria 1726
330 nmdc:mga09592_21674_c1 3300050508 Bacteria 5297
331 nmdc:mga0qj67_144535_c1 3300050509 Bacteria 1929
332 nmdc:mga06r32_115576_c1 3300050510 Bacteria 2643
333 nmdc:mga06r32_126219_c1 3300050510 Bacteria 2527
334 nmdc:mga06r32_16183_c1 3300050510 Bacteria 6794
335 nmdc:mga06r32_177625_c1 3300050510 Bacteria 2114
336 nmdc:mga06r32_779903_c1 3300050510 Bacteria 917
337 nmdc:mga08y16_24966_c1 3300050511 Bacteria 6305
338 nmdc:mga08y16_397049_c1 3300050511 Bacteria 1412
339 nmdc:mga08y16_74198_c1 3300050511 Bacteria 3544
340 nmdc:mga0n895_179472_c1 3300050512 Bacteria 2149
341 nmdc:mga0n895_296667_c1 3300050512 Bacteria 1639
342 nmdc:mga0n895_36604_c1 3300050512 Bacteria 4740
343 nmdc:mga0n895_530_c1 3300050512 Bacteria 25989
344 nmdc:mga0n895_550_c1 3300050512 Bacteria 25645
345 nmdc:mga0n895_672677_c1 3300050512 Bacteria 1033
346 nmdc:mga0n895_882904_c1 3300050512 Bacteria 880
347 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
348 nmdc:mga0rr50_34737_c1 3300050513 Bacteria 3613
349 nmdc:mga0rr50_52833_c1 3300050513 Bacteria 3021
350 nmdc:mga0rr50_6364_c1 3300050513 Bacteria 7178
351 nmdc:mga08x19_181648_c1 3300050514 Bacteria 1436
352 nmdc:mga08x19_240921_c1 3300050514 Bacteria 1247
353 nmdc:mga08x19_2951_c1 3300050514 Bacteria 10221
354 nmdc:mga08x19_40041_c1 3300050514 Bacteria 2982
355 nmdc:mga08x19_695_c1 3300050514 Bacteria 21618
356 nmdc:mga0a205_280288_c1 3300050515 Bacteria 1542
357 nmdc:mga0a205_40393_c1 3300050515 Bacteria 4491
358 nmdc:mga0a205_43485_c1 3300050515 Bacteria 4331
359 Ga0495601_0035433 3300053077 Bacteria 3115
360 Ga0495601_0084043 3300053077 Bacteria 2045
361 Ga0495612_0153244 3300053078 Bacteria 1004
362 Ga0495595_0148240 3300053084 Bacteria 1154
363 Ga0495619_0008267 3300053085 Bacteria 6581
364 Ga0495619_0044031 3300053085 Bacteria 2928
365 Ga0495619_0194447 3300053085 Bacteria 1404
366 Ga0501084_0034834 3300054114 Bacteria 4210
367 Ga0530510_0067146 3300061734 Bacteria 2601
368 Ga0075429_100234123
369 JGI24751J29686_10011051
370 Ga0065712_10068711
371 Ga0065712_10070160
372 Ga0065712_10180960
373 Ga0065715_10092548
374 Ga0065715_10264203
375 Ga0070676_10066571
376 Ga0070676_10123080
377 Ga0070690_100003521
378 Ga0070690_100041575
379 Ga0070690_100265729
380 Ga0070670_100001280
381 Ga0070670_100098757
382 Ga0070677_10038945
383 Ga0068869_100164534
384 Ga0068869_100788722
385 Ga0070666_10009755
386 Ga0070680_100056287
387 Ga0070682_100080998
388 Ga0068868_100004743
389 Ga0068868_100358105
390 Ga0068868_100505585
391 Ga0070661_100012735
392 Ga0070661_100038131
393 Ga0070661_100254925
394 Ga0070668_100263804
395 Ga0070669_100011901
396 Ga0070669_100270128
397 Ga0070675_100068417
398 Ga0070675_100166011
399 Ga0070675_100168763
400 Ga0070671_100009092
401 Ga0070671_100030645
402 Ga0070674_100047627
403 Ga0070674_100057849
404 Ga0070673_100051111
405 Ga0070673_100199555
406 Ga0070659_100024406
407 Ga0070659_100132532
408 Ga0070659_100455297
409 Ga0070667_100191592
410 Ga0070709_10079350
411 Ga0070709_10083639
412 Ga0070709_10271521
413 Ga0070713_100007092
414 Ga0070711_100355920
415 Ga0070694_100043540
416 Ga0070708_100269972
417 Ga0070678_100019606
418 Ga0070662_100011219
419 Ga0070662_100120195
420 Ga0070662_100453000
421 Ga0070681_10013899
422 Ga0070681_10021342
423 Ga0070681_10037668
424 Ga0070706_100898105
425 Ga0070698_100387378
426 Ga0070699_100293129
427 Ga0070699_100695601
428 Ga0070679_100013022
429 Ga0070679_100224153
430 Ga0070684_100162727
431 Ga0070684_100263743
432 Ga0070684_100316156
433 Ga0070684_100775108
434 Ga0070697_100015093
435 Ga0070672_100058930
436 Ga0070672_100278329
437 Ga0070686_100001661
438 Ga0070686_100216875
439 Ga0070695_100001059
440 Ga0070696_100279147
441 Ga0070693_100377525
442 Ga0070665_100464031
443 Ga0070704_100058063
444 Ga0068855_100364876
445 Ga0070664_100000830
446 Ga0070664_100190100
447 Ga0068857_100030782
448 Ga0068857_100332237
449 Ga0068854_100185621
450 Ga0068852_100513936
451 Ga0068859_100013848
452 Ga0068859_100565922
453 Ga0068859_101144234
454 Ga0068866_10111938
455 Ga0068861_100499251
456 Ga0068858_100017669
457 Ga0068860_100045562
458 Ga0068860_100582014
459 Ga0081455_10000777
460 Ga0070716_100512230
461 Ga0070712_100743913
462 Ga0075428_100045517
463 Ga0075428_100379520
464 Ga0075430_100096802
465 Ga0075430_100392851
466 Ga0075430_100527321
467 Ga0075431_100032389
468 Ga0075431_100156462
469 Ga0075431_100219310
470 Ga0075431_100289553
471 Ga0075433_10072540
472 Ga0075433_10125869
473 Ga0075433_10389592
474 Ga0075434_100000743
475 Ga0075434_100003759
476 Ga0075434_100005614
477 Ga0075434_100038078
478 Ga0075434_100117571
479 Ga0068865_100299254
480 Ga0068865_100888318
481 Ga0075436_100000744
482 Ga0075436_100002675
483 Ga0075436_100003903
484 Ga0075436_100099886
485 Ga0097620_100013848
486 Ga0097620_100565931
487 Ga0097620_101144209
488 Ga0075435_100000039
489 Ga0075435_100002315
490 Ga0075435_100032860
491 Ga0075435_100041479
492 Ga0075435_100164821
493 Ga0099794_10098964
494 Ga0105240_10656410
495 Ga0105240_10800556
496 Ga0111539_10031025
497 Ga0111539_10032489
498 Ga0111539_10032522
499 Ga0111539_10121150
500 Ga0105245_10108585
501 Ga0105245_10595994
502 Ga0105245_11036599
503 Ga0105247_10007829
504 Ga0114129_10000418
505 Ga0114129_10031835
506 Ga0114129_10475903
507 Ga0114129_10483969
508 Ga0114129_10522814
509 Ga0105243_10900894
510 Ga0105241_10201074
511 Ga0105248_10318329
512 Ga0105238_10239253
513 Ga0105239_10187568
514 Ga0105246_10535207
515 Ga0157327_1005326
516 Ga0157374_10478396
517 Ga0157378_10007804
518 Ga0157378_10272278
519 Ga0157378_10330250
520 Ga0163162_10077430
521 Ga0163162_10149096
522 Ga0157372_10027505
523 Ga0157375_10235531
524 Ga0163163_10036636
525 Ga0163163_10048379
526 Ga0157379_10065603
527 Ga0157376_10030689
528 Ga0182007_10072258
529 Ga0163161_10720271
530 Ga0207697_10042024
531 Ga0207697_10046558
532 Ga0207682_10009816
533 Ga0207710_10017461
534 Ga0207688_10171172
535 Ga0207680_10080102
536 Ga0207699_10069389
537 Ga0207699_10075865
538 Ga0207699_10267557
539 Ga0207645_10001511
540 Ga0207645_10041057
541 Ga0207645_10258268
542 Ga0207684_10119498
543 Ga0207684_10668197
544 Ga0207654_10319224
545 Ga0207707_10096586
546 Ga0207707_10179596
547 Ga0207693_10527304
548 Ga0207663_10054945
549 Ga0207663_10436700
550 Ga0207660_10041799
551 Ga0207657_10007180
552 Ga0207657_10204223
553 Ga0207649_10175587
554 Ga0207652_10003474
555 Ga0207652_10379097
556 Ga0207681_10014504
557 Ga0207681_10389028
558 Ga0207650_10001148
559 Ga0207650_10354301
560 Ga0207659_10181094
561 Ga0207659_10429937
562 Ga0207687_10784412
563 Ga0207700_10488742
564 Ga0207644_10092615
565 Ga0207690_10009340
566 Ga0207690_10056144
567 Ga0207706_10024322
568 Ga0207706_10078919
569 Ga0207706_10154241
570 Ga0207706_10273124
571 Ga0207706_10332995
572 Ga0207706_10662711
573 Ga0207706_10774468
574 Ga0207669_10111187
575 Ga0207704_10568531
576 Ga0207691_10022008
577 Ga0207691_10061375
578 Ga0207711_10106277
579 Ga0207711_10203636
580 Ga0207711_11013366
581 Ga0207661_10270890
582 Ga0207679_10000457
583 Ga0207679_10251137
584 Ga0207667_10087272
585 Ga0207651_10201490
586 Ga0207651_10388741
587 Ga0207668_10733043
588 Ga0207640_10009165
589 Ga0207640_10133652
590 Ga0207658_10420780
591 Ga0207677_10000054
592 Ga0207703_10517711
593 Ga0207703_10794047
594 Ga0207678_10129111
595 Ga0207708_10396787
596 Ga0207702_10972076
597 Ga0207641_10323144
598 Ga0207648_10079649
599 Ga0207648_10120995
600 Ga0207676_10317834
601 Ga0207676_10557228
602 Ga0207674_10031725
603 Ga0207674_10113318
604 Ga0207675_100112425
605 Ga0207683_10012336
606 Ga0207698_10277278
607 Ga0209974_10014748
608 Ga0207428_10043164
609 Ga0268266_10476638
610 Ga0268266_10704776
611 Ga0268264_10051017
612 Ga0307407_10402620
613 Ga0307416_100041817
614 Ga0373958_0004092
615 Ga0373959_0000801
616 Ga0373928_0001035
617 Ga0373929_0068481
618 Ga0373940_0000272
619 Ga0373949_0001618
620 Ga0373923_0099305
621 Ga0373939_0000915
622 Ga0373941_0002944
623 Ga0373945_0038631
624 Ga0373960_0000771
625 Ga0373943_0067961
626 Ga0373946_0025329
627 Ga0373946_0069759
628 Ga0373942_0000027
629 Ga0373961_0004065
630 Ga0373962_0005396
631 Ga0373924_0061151
632 Ga0373931_0002138
633 Ga0373931_0179649
634 Ga0373935_0288671
635 Ga0373935_0464500
636 Ga0373947_0029298
637 Ga0373937_0202576
638 Ga0373937_0582755
639 Ga0373925_0024619
640 Ga0436364_0697773
641 Ga0436365_0809609
642 Ga0436365_0998676
643 Ga0436365_1623554
644 Ga0466957_0104098
645 Ga0451576_0144529
646 Ga0451576_0221165
647 Ga0451576_0521460
648 Ga0451576_0588507
649 Ga0451576_1125399
650 Ga0495592_0263190
651 Ga0495582_0340612
652 Ga0495618_0219467
653 Ga0495652_0361114
654 Ga0495665_0245582
655 Ga0495586_0206809
656 Ga0495645_0022599
657 Ga0495633_0177408
658 Ga0495634_0054777
659 Ga0495634_0366266
660 Ga0495635_0294421
661 Ga0495657_0137486
662 Ga0495599_0146101
663 Ga0495647_0177608
664 Ga0495613_0005920
665 Ga0495600_0056301
666 Ga0495604_0033554
667 Ga0495674_0315709
668 Ga0495675_0140134
669 Ga0495684_0001402
670 Ga0496104_0023284
671 Ga0496106_0245178
672 Ga0496106_0307093
673 Ga0496109_1016021
674 Ga0496110_0045705
675 Ga0496111_0097821
676 Ga0496112_0033385
677 Ga0496112_0044931
678 Ga0496112_0338495
679 Ga0496113_0234461
680 Ga0496114_0219125
681 Ga0496114_0440738
682 Ga0501036_0061531
683 Ga0501038_0406233
684 Ga0501039_0043295
685 Ga0501040_0029889
686 Ga0501040_0364249
687 Ga0501041_0016453
688 Ga0501043_0054047
689 Ga0501046_0043915
690 Ga0501072_0027533
691 Ga0501077_0083946
692 Ga0501079_0035542
693 Ga0501081_0064413
694 Ga0501045_0006047
695 nmdc:mga05p37_138988_c1
696 nmdc:mga05p37_354757_c1
697 nmdc:mga09592_21674_c1
698 nmdc:mga0qj67_144535_c1
699 nmdc:mga06r32_115576_c1
700 nmdc:mga06r32_126219_c1
701 nmdc:mga06r32_16183_c1
702 nmdc:mga06r32_177625_c1
703 nmdc:mga06r32_779903_c1
704 nmdc:mga08y16_24966_c1
705 nmdc:mga08y16_397049_c1
706 nmdc:mga08y16_74198_c1
707 nmdc:mga0n895_179472_c1
708 nmdc:mga0n895_296667_c1
709 nmdc:mga0n895_36604_c1
710 nmdc:mga0n895_530_c1
711 nmdc:mga0n895_550_c1
712 nmdc:mga0n895_672677_c1
713 nmdc:mga0n895_882904_c1
714 nmdc:mga0rr50_1_c1
715 nmdc:mga0rr50_34737_c1
716 nmdc:mga0rr50_52833_c1
717 nmdc:mga0rr50_6364_c1
718 nmdc:mga08x19_181648_c1
719 nmdc:mga08x19_240921_c1
720 nmdc:mga08x19_2951_c1
721 nmdc:mga08x19_40041_c1
722 nmdc:mga08x19_695_c1
723 nmdc:mga0a205_280288_c1
724 nmdc:mga0a205_40393_c1
725 nmdc:mga0a205_43485_c1
726 Ga0495601_0035433
727 Ga0495601_0084043
728 Ga0495612_0153244
729 Ga0495595_0148240
730 Ga0495619_0008267
731 Ga0495619_0044031
732 Ga0495619_0194447
733 Ga0501084_0034834
734 Ga0530510_0067146

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

199

270

0.95

PF00510

COX3

Cytochrome c oxidase subunit III

52

169

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.8711 29 217
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8502 27 220
7e1v-assembly1.cif.gz_G cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.8464 29 218
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.8354 31 216
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.8332 27 220
ID Description Score Start End Superfamily
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8517 29 218 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8459 25 219 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8292 25 219 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8231 29 218 1.20.120.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8074 19 218 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A7C2R622-F1-model_v4 Cytochrome c oxidase subunit 3 family protein 0.9649 34 222 GO:0004129
GO:0005886
GO:0019646
AF-A0A2V7VQZ1-F1-model_v4 Cytochrome oxidase subunit III 0.9567 34 222 GO:0004129
GO:0005886
GO:0019646
AF-A0A7C2R622-F1-model_v4 Cytochrome c oxidase subunit 3 family protein 0.955 34 222 GO:0004129
GO:0005886
GO:0019646
AF-B9XE49-F1-model_v4 Cytochrome c oxidase subunit III 0.9501 16 221 GO:0004129
GO:0005886
GO:0019646
AF-A0A534Q201-F1-model_v4 Cytochrome c oxidase subunit 3 family protein 0.9487 48 223 GO:0004129
GO:0005886
GO:0019646

Map