F424044

General Info

Members Datasets Scaffolds Average Seq Length
366 200 732 258

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10052030|Ga0207665_100520302
Length 302
Sequence MQDRSVGRNLTQGYTRNYLIDLTIVSPYGGHHNETMKGLNMKKLIFSTLALTGLLAASVKAGPAVEYKQVAPXXXXLYGVGFYGAIDAGANVYQNRGGSRTFTVDNPDSEFFGSNLEVNPKNDVGFFGGVKLGYVFGTGWLRPTVEGDFFYNGFRGGADFTLNEAFTPCPGCPTFLSTHQRNVTTWINTGAFMFNFILRIAPESWRFQPYAGAGVGVYYAESAGVEVTDPVTGRTPINTGGGASHADLAWQVVAGSDYFFNPQWSAFIEYHYLDYTSTQINTNQSRDLGQHLVGAGVRYFFH

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.84
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 30.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10052030 3300025939 Bacteria 2759
2 JGI24737J22298_10030665 3300001990 Bacteria 1681
3 JGI24035J26624_1001010 3300002126 Unclassified 2661
4 JGI24035J26624_1002383 3300002126 Unclassified 1754
5 JGI24035J26624_1004043 3300002126 Bacteria 1390
6 JGI24035J26624_1007863 3300002126 Unclassified 1039
7 JGI25405J52794_10000777 3300003911 Bacteria 4923
8 JGI25405J52794_10000969 3300003911 Bacteria 4518
9 JGI25405J52794_10002868 3300003911 Bacteria 2995
10 Ga0058860_12206814 3300004801 Bacteria 851
11 Ga0065704_10006870 3300005289 Bacteria 3242
12 Ga0065704_10215968 3300005289 Bacteria 1091
13 Ga0065712_10008021 3300005290 Bacteria 2299
14 Ga0065712_10010851 3300005290 Unclassified 2833
15 Ga0065712_10016320 3300005290 Bacteria 2041
16 Ga0065712_10072075 3300005290 Bacteria 4917
17 Ga0065715_10011417 3300005293 Bacteria 2084
18 Ga0065715_10094518 3300005293 Unclassified 4245
19 Ga0065715_10098096 3300005293 Bacteria 3597
20 Ga0065715_10251965 3300005293 Unclassified 1164
21 Ga0065707_10013726 3300005295 Bacteria 2048
22 Ga0070676_10025094 3300005328 Unclassified 3366
23 Ga0070683_100058198 3300005329 Unclassified 3591
24 Ga0070683_100060147 3300005329 Bacteria 3530
25 Ga0070683_100200487 3300005329 Unclassified 1895
26 Ga0070690_100004510 3300005330 Bacteria 7742
27 Ga0070690_100030653 3300005330 Bacteria 3344
28 Ga0070690_100133327 3300005330 Bacteria 1680
29 Ga0070670_100081747 3300005331 Bacteria 2775
30 Ga0070666_10092893 3300005335 Unclassified 2075
31 Ga0070666_10359410 3300005335 Bacteria 1043
32 Ga0070682_100157321 3300005337 Bacteria 1566
33 Ga0068868_100127435 3300005338 Bacteria 2081
34 Ga0068868_100725997 3300005338 Unclassified 891
35 Ga0070660_100141327 3300005339 Bacteria 1931
36 Ga0070689_100065134 3300005340 Bacteria 2837
37 Ga0070689_100115696 3300005340 Unclassified 2138
38 Ga0070689_100360708 3300005340 Unclassified 1221
39 Ga0070687_100062834 3300005343 Bacteria 1967
40 Ga0070661_100013393 3300005344 Bacteria 5756
41 Ga0070668_100180974 3300005347 Bacteria 1722
42 Ga0070668_100202592 3300005347 Unclassified 1629
43 Ga0070669_100025228 3300005353 Bacteria 4269
44 Ga0070669_100176149 3300005353 Unclassified 1670
45 Ga0070675_100008769 3300005354 Bacteria 7854
46 Ga0070675_100241818 3300005354 Bacteria 1577
47 Ga0070675_100296984 3300005354 Bacteria 1422
48 Ga0070675_100400808 3300005354 Unclassified 1224
49 Ga0070671_100056020 3300005355 Bacteria 3280
50 Ga0070671_100262807 3300005355 Unclassified 1467
51 Ga0070671_100333851 3300005355 Bacteria 1292
52 Ga0070674_100006792 3300005356 Bacteria 6703
53 Ga0070673_100087217 3300005364 Unclassified 2543
54 Ga0070673_100483907 3300005364 Bacteria 1117
55 Ga0070688_100005081 3300005365 Bacteria 6897
56 Ga0070688_100014312 3300005365 Unclassified 4491
57 Ga0070688_100017405 3300005365 Bacteria 4125
58 Ga0070659_100007358 3300005366 Bacteria 7998
59 Ga0070659_100046483 3300005366 Bacteria 3402
60 Ga0070667_100253928 3300005367 Unclassified 1572
61 Ga0070667_100363014 3300005367 Bacteria 1313
62 Ga0070709_10047688 3300005434 Bacteria 2669
63 Ga0070714_100478191 3300005435 Unclassified 1186
64 Ga0070713_100084896 3300005436 Bacteria 2710
65 Ga0070710_10287010 3300005437 Unclassified 1070
66 Ga0070701_10041109 3300005438 Bacteria 2354
67 Ga0070711_100155880 3300005439 Unclassified 1727
68 Ga0070705_100282386 3300005440 Bacteria 1181
69 Ga0070694_100024242 3300005444 Bacteria 3915
70 Ga0070678_100050532 3300005456 Bacteria 3008
71 Ga0070678_100077047 3300005456 Unclassified 2514
72 Ga0070662_100031535 3300005457 Bacteria 3720
73 Ga0070662_100198560 3300005457 Unclassified 1590
74 Ga0070662_100360753 3300005457 Bacteria 1192
75 Ga0070681_10015513 3300005458 Bacteria 7587
76 Ga0070706_100435890 3300005467 Bacteria 1220
77 Ga0070706_100476586 3300005467 Bacteria 1161
78 Ga0070707_100093532 3300005468 Unclassified 2910
79 Ga0070707_100330250 3300005468 Bacteria 1482
80 Ga0070698_100026898 3300005471 Bacteria 5982
81 Ga0070698_100218254 3300005471 Bacteria 1841
82 Ga0070679_100148292 3300005530 Bacteria 2323
83 Ga0070684_100000767 3300005535 Bacteria 22255
84 Ga0070684_100009825 3300005535 Bacteria 7556
85 Ga0070684_100047285 3300005535 Unclassified 3729
86 Ga0070684_100103343 3300005535 Unclassified 2548
87 Ga0070697_100016552 3300005536 Bacteria 5801
88 Ga0070697_100316996 3300005536 Bacteria 1342
89 Ga0070672_100435234 3300005543 Unclassified 1128
90 Ga0070672_100509565 3300005543 Unclassified 1042
91 Ga0070686_100044943 3300005544 Unclassified 2780
92 Ga0070696_100337620 3300005546 Bacteria 1164
93 Ga0070665_100030911 3300005548 Bacteria 5389
94 Ga0070665_100048550 3300005548 Bacteria 4261
95 Ga0070665_100114548 3300005548 Unclassified 2699
96 Ga0070704_100058189 3300005549 Plasmid 2752
97 Ga0070704_100073121 3300005549 Bacteria 2496
98 Ga0070664_100178866 3300005564 Unclassified 1885
99 Ga0068856_100090460 3300005614 Bacteria 3044
100 Ga0070702_100024218 3300005615 Unclassified 3236
101 Ga0068859_100086392 3300005617 Bacteria 3183
102 Ga0068864_100148828 3300005618 Bacteria 2119
103 Ga0068864_100472783 3300005618 Unclassified 1202
104 Ga0068861_100362654 3300005719 Bacteria 1275
105 Ga0068863_100099694 3300005841 Bacteria 2760
106 Ga0068863_100199498 3300005841 Unclassified 1924
107 Ga0068858_100002330 3300005842 Bacteria 19198
108 Ga0068858_100057762 3300005842 Plasmid 3586
109 Ga0068860_100031572 3300005843 Bacteria 5092
110 Ga0068860_100047811 3300005843 Bacteria 4077
111 Ga0068862_100497912 3300005844 Unclassified 1156
112 Ga0068862_100556632 3300005844 Unclassified 1096
113 Ga0081455_10000697 3300005937 Bacteria 43576
114 Ga0081455_10003777 3300005937 Bacteria 17290
115 Ga0081455_10010175 3300005937 Bacteria 9574
116 Ga0081455_10010414 3300005937 Bacteria 9442
117 Ga0081455_10012795 3300005937 Bacteria 8339
118 Ga0081455_10018356 3300005937 Bacteria 6667
119 Ga0081455_10018691 3300005937 Bacteria 6582
120 Ga0081540_1001066 3300005983 Bacteria 24391
121 Ga0081540_1008618 3300005983 Bacteria 7106
122 Ga0081539_10049401 3300005985 Bacteria 2387
123 Ga0081539_10121895 3300005985 Unclassified 1293
124 Ga0070717_10012733 3300006028 Bacteria 6419
125 Ga0070717_10107178 3300006028 Bacteria 2379
126 Ga0070715_10308323 3300006163 Unclassified 849
127 Ga0070712_100174680 3300006175 Bacteria 1670
128 Ga0070712_100242749 3300006175 Bacteria 1435
129 Ga0070712_100292357 3300006175 Bacteria 1316
130 Ga0070712_100582010 3300006175 Unclassified 946
131 Ga0097621_100312742 3300006237 Unclassified 1390
132 Ga0068871_100061398 3300006358 Unclassified 3069
133 Ga0068871_100097592 3300006358 Unclassified 2456
134 Ga0075433_10195855 3300006852 Bacteria 1797
135 Ga0075434_100549283 3300006871 Bacteria 1175
136 Ga0097620_100086388 3300006931 Bacteria 3183
137 Ga0111539_10764661 3300009094 Bacteria 1124
138 Ga0105245_10159138 3300009098 Unclassified 2142
139 Ga0105247_10121364 3300009101 Unclassified 1693
140 Ga0114129_10117417 3300009147 Bacteria 3666
141 Ga0114129_10659375 3300009147 Bacteria 1350
142 Ga0105243_10233574 3300009148 Bacteria 1633
143 Ga0105241_10138559 3300009174 Bacteria 1978
144 Ga0105242_10362370 3300009176 Bacteria 1342
145 Ga0105248_10050325 3300009177 Unclassified 4672
146 Ga0105248_10110892 3300009177 Bacteria 3094
147 Ga0105237_10018878 3300009545 Bacteria 7129
148 Ga0105237_10482899 3300009545 Bacteria 1245
149 Ga0105249_10033802 3300009553 Bacteria 4631
150 Ga0105249_10308736 3300009553 Bacteria 1589
151 Ga0105249_10473678 3300009553 Unclassified 1294
152 Ga0099796_10024086 3300010159 Bacteria 1908
153 Ga0105239_10043894 3300010375 Unclassified 4902
154 Ga0105239_10234402 3300010375 Bacteria 2060
155 Ga0105239_10308136 3300010375 Bacteria 1784
156 Ga0157369_10012950 3300013105 Bacteria 9450
157 Ga0157374_10006214 3300013296 Bacteria 10126
158 Ga0157374_10100016 3300013296 Bacteria 2779
159 Ga0157374_10118816 3300013296 Unclassified 2549
160 Ga0157374_10164776 3300013296 Unclassified 2160
161 Ga0157374_10299720 3300013296 Bacteria 1590
162 Ga0157374_10309987 3300013296 Bacteria 1562
163 Ga0157374_10344646 3300013296 Unclassified 1479
164 Ga0157374_11006732 3300013296 Unclassified 852
165 Ga0157378_10029528 3300013297 Bacteria 4842
166 Ga0163162_10017652 3300013306 Bacteria 6981
167 Ga0163162_10041691 3300013306 Bacteria 4593
168 Ga0163162_10043061 3300013306 Unclassified 4520
169 Ga0163162_10217903 3300013306 Bacteria 2039
170 Ga0157372_10108045 3300013307 Bacteria 3184
171 Ga0157372_10708445 3300013307 Bacteria 1171
172 Ga0157375_10013479 3300013308 Bacteria 7278
173 Ga0157375_10021083 3300013308 Bacteria 5968
174 Ga0157375_10124176 3300013308 Bacteria 2694
175 Ga0157375_10214303 3300013308 Unclassified 2083
176 Ga0163163_10035495 3300014325 Unclassified 4837
177 Ga0163163_10241599 3300014325 Unclassified 1856
178 Ga0182008_10043194 3300014497 Bacteria 2245
179 Ga0157379_10074821 3300014968 Bacteria 3032
180 Ga0157376_10375394 3300014969 Bacteria 1368
181 Ga0182005_1018526 3300015265 Bacteria 1924
182 Ga0163161_10515183 3300017792 Unclassified 976
183 Ga0207666_1000287 3300025271 Bacteria 7197
184 Ga0207666_1001714 3300025271 Bacteria 2609
185 Ga0207673_1000899 3300025290 Bacteria 3197
186 Ga0207673_1006245 3300025290 Bacteria 1471
187 Ga0207697_10000548 3300025315 Bacteria 21265
188 Ga0207697_10001829 3300025315 Bacteria 11413
189 Ga0207697_10004640 3300025315 Bacteria 6521
190 Ga0207697_10005265 3300025315 Bacteria 6029
191 Ga0207697_10005750 3300025315 Bacteria 5715
192 Ga0207697_10041972 3300025315 Unclassified 1879
193 Ga0207697_10059782 3300025315 Unclassified 1584
194 Ga0207697_10071446 3300025315 Bacteria 1454
195 Ga0207692_10234363 3300025898 Bacteria 1093
196 Ga0207688_10011783 3300025901 Unclassified 4756
197 Ga0207688_10260461 3300025901 Bacteria 1052
198 Ga0207680_10199535 3300025903 Unclassified 1363
199 Ga0207680_10378579 3300025903 Bacteria 997
200 Ga0207647_10003932 3300025904 Bacteria 11094
201 Ga0207647_10004636 3300025904 Bacteria 10185
202 Ga0207645_10010930 3300025907 Bacteria 6213
203 Ga0207684_10119949 3300025910 Bacteria 2255
204 Ga0207684_10167549 3300025910 Bacteria 1893
205 Ga0207671_10039610 3300025914 Plasmid 3489
206 Ga0207693_10074202 3300025915 Bacteria 2664
207 Ga0207693_10329980 3300025915 Bacteria 1194
208 Ga0207663_10024567 3300025916 Unclassified 3471
209 Ga0207663_10233758 3300025916 Unclassified 1344
210 Ga0207657_10191790 3300025919 Bacteria 1648
211 Ga0207657_10221365 3300025919 Unclassified 1516
212 Ga0207649_10276991 3300025920 Bacteria 1218
213 Ga0207652_10154052 3300025921 Bacteria 2059
214 Ga0207646_10365497 3300025922 Bacteria 1303
215 Ga0207646_10427981 3300025922 Bacteria 1195
216 Ga0207681_10169381 3300025923 Unclassified 1654
217 Ga0207650_10003606 3300025925 Bacteria 10620
218 Ga0207650_10410379 3300025925 Bacteria 1122
219 Ga0207659_10089728 3300025926 Bacteria 2293
220 Ga0207659_10225605 3300025926 Bacteria 1508
221 Ga0207659_10302804 3300025926 Unclassified 1313
222 Ga0207659_10448152 3300025926 Bacteria 1087
223 Ga0207659_10502295 3300025926 Bacteria 1027
224 Ga0207687_10261972 3300025927 Unclassified 1378
225 Ga0207687_10397284 3300025927 Bacteria 1133
226 Ga0207690_10028124 3300025932 Unclassified 3561
227 Ga0207706_10004066 3300025933 Bacteria 13827
228 Ga0207706_10040150 3300025933 Bacteria 4147
229 Ga0207706_10132047 3300025933 Bacteria 2196
230 Ga0207670_10014212 3300025936 Bacteria 4719
231 Ga0207670_10091699 3300025936 Unclassified 2149
232 Ga0207670_10614309 3300025936 Unclassified 894
233 Ga0207665_10024772 3300025939 Bacteria 3958
234 Ga0207691_10358800 3300025940 Unclassified 1246
235 Ga0207711_10058676 3300025941 Unclassified 3313
236 Ga0207689_10565059 3300025942 Unclassified 956
237 Ga0207661_10049673 3300025944 Unclassified 3339
238 Ga0207661_10100360 3300025944 Bacteria 2429
239 Ga0207661_10228023 3300025944 Bacteria 1649
240 Ga0207679_10029924 3300025945 Bacteria 3796
241 Ga0207651_10056946 3300025960 Unclassified 2693
242 Ga0207651_10062381 3300025960 Unclassified 2597
243 Ga0207651_10174140 3300025960 Bacteria 1700
244 Ga0207712_10016497 3300025961 Bacteria 4785
245 Ga0207712_10158732 3300025961 Bacteria 1755
246 Ga0207668_10383885 3300025972 Bacteria 1183
247 Ga0207658_10221371 3300025986 Unclassified 1592
248 Ga0207658_10401861 3300025986 Bacteria 1204
249 Ga0207677_10025872 3300026023 Bacteria 3669
250 Ga0207677_10090977 3300026023 Unclassified 2218
251 Ga0207678_10003161 3300026067 Bacteria 14887
252 Ga0207708_10007382 3300026075 Bacteria 8126
253 Ga0207641_10247571 3300026088 Unclassified 1663
254 Ga0207676_10084100 3300026095 Bacteria 2593
255 Ga0207683_10114238 3300026121 Bacteria 2419
256 Ga0268266_10025448 3300028379 Bacteria 5035
257 Ga0268266_10078125 3300028379 Bacteria 2879
258 Ga0268266_10180413 3300028379 Unclassified 1922
259 Ga0268266_10307397 3300028379 Unclassified 1481
260 Ga0268264_10044358 3300028381 Bacteria 3688
261 Ga0268264_10314119 3300028381 Bacteria 1479
262 Ga0373936_0068082 3300035113 Bacteria 1464
263 Ga0373941_0240901 3300035115 Unclassified 703
264 Ga0373953_0013915 3300035117 Bacteria 2884
265 Ga0373956_0264654 3300035119 Bacteria 818
266 Ga0373957_0032027 3300035120 Bacteria 1935
267 Ga0373943_0141640 3300035170 Bacteria 1296
268 Ga0373955_0034864 3300035172 Unclassified 2662
269 Ga0373933_0377370 3300035724 Bacteria 923
270 Ga0373933_0590414 3300035724 Unclassified 729
271 Ga0373947_0017750 3300035725 Bacteria 4094
272 Ga0373947_0073793 3300035725 Bacteria 2098
273 Ga0373947_0091945 3300035725 Bacteria 1894
274 Ga0373937_0007119 3300036401 Bacteria 9662
275 Ga0373925_0048200 3300037068 Bacteria 3174
276 Ga0395899_0090931 3300037312 Unclassified 2212
277 Ga0395900_0002142 3300037418 Bacteria 22091
278 Ga0395898_0005573 3300037466 Bacteria 13572
279 Ga0395905_0002466 3300037471 Bacteria 20489
280 Ga0395901_0001408 3300038443 Bacteria 25100
281 Ga0395901_0096994 3300038443 Unclassified 3090
282 Ga0439455_0017663 3300042012 Unclassified 1665
283 Ga0495592_0061304 3300046454 Bacteria 2764
284 Ga0495592_0170165 3300046454 Unclassified 1493
285 Ga0495651_0002559 3300046462 Bacteria 14060
286 Ga0495664_0110769 3300046477 Unclassified 1657
287 Ga0495628_0050003 3300046516 Bacteria 3307
288 Ga0495628_0064720 3300046516 Bacteria 2862
289 Ga0495666_0146258 3300046526 Bacteria 1100
290 Ga0495652_0017518 3300046529 Bacteria 6391
291 Ga0495665_0170615 3300046531 Unclassified 1133
292 Ga0495640_0227088 3300046533 Bacteria 1175
293 Ga0495586_0006767 3300046535 Bacteria 6120
294 Ga0495586_0034842 3300046535 Bacteria 2704
295 Ga0495645_0008144 3300046543 Bacteria 7310
296 Ga0495634_0015548 3300046642 Bacteria 5463
297 Ga0495634_0052773 3300046642 Bacteria 2725
298 Ga0495634_0074679 3300046642 Unclassified 2228
299 Ga0495634_0126840 3300046642 Bacteria 1630
300 Ga0495635_0259559 3300046663 Unclassified 1170
301 Ga0495599_0004147 3300046678 Bacteria 8560
302 Ga0495599_0097314 3300046678 Unclassified 1835
303 Ga0495623_0027827 3300046679 Bacteria 3639
304 Ga0495623_0245543 3300046679 Unclassified 1009
305 Ga0495646_0081278 3300046680 Bacteria 1888
306 Ga0495646_0151791 3300046680 Unclassified 1288
307 Ga0495658_0264704 3300046683 Bacteria 1083
308 Ga0495658_0412356 3300046683 Bacteria 862
309 Ga0495613_0052457 3300046689 Bacteria 3004
310 Ga0495613_0088064 3300046689 Unclassified 2250
311 Ga0495624_0267772 3300046690 Bacteria 1032
312 Ga0495600_0299955 3300046809 Unclassified 1014
313 Ga0495674_0051519 3300047319 Bacteria 3629
314 Ga0495674_0066802 3300047319 Bacteria 3118
315 Ga0495674_0095883 3300047319 Bacteria 2529
316 Ga0495680_0092010 3300047322 Bacteria 2273
317 Ga0495684_0013415 3300047471 Bacteria 6307
318 Ga0495684_0020371 3300047471 Bacteria 5110
319 Ga0495602_0074282 3300048088 Bacteria 2890
320 Ga0496100_0028272 3300048903 Unclassified 3457
321 Ga0496100_0041294 3300048903 Bacteria 2940
322 Ga0496101_0056781 3300048904 Unclassified 2830
323 Ga0496101_0383248 3300048904 Bacteria 1106
324 Ga0496102_0136836 3300048905 Unclassified 2296
325 Ga0496102_0137009 3300048905 Bacteria 2294
326 Ga0496102_0139546 3300048905 Unclassified 2272
327 Ga0496103_0008563 3300048906 Bacteria 6079
328 Ga0496104_0035193 3300048907 Bacteria 4676
329 Ga0496104_0240894 3300048907 Bacteria 1721
330 Ga0496105_0373410 3300048908 Bacteria 1136
331 Ga0496106_0004446 3300048909 Bacteria 10393
332 Ga0496106_0195007 3300048909 Bacteria 1611
333 Ga0496107_0043619 3300048910 Unclassified 3222
334 Ga0496107_0088557 3300048910 Bacteria 2260
335 Ga0496107_0103920 3300048910 Unclassified 2085
336 Ga0496108_0051000 3300048911 Unclassified 3466
337 Ga0496108_0293261 3300048911 Unclassified 1416
338 Ga0496109_0104298 3300048912 Unclassified 2632
339 Ga0496109_0325827 3300048912 Bacteria 1450
340 Ga0496109_0533465 3300048912 Unclassified 1107
341 Ga0496109_0632009 3300048912 Bacteria 1007
342 Ga0496110_0096505 3300048913 Bacteria 2649
343 Ga0496110_0144170 3300048913 Bacteria 2154
344 Ga0496111_0091297 3300048914 Bacteria 2232
345 Ga0496112_0058332 3300048915 Bacteria 3801
346 Ga0496112_0100502 3300048915 Bacteria 2862
347 Ga0496112_0137817 3300048915 Bacteria 2410
348 Ga0496112_0207957 3300048915 Bacteria 1915
349 Ga0496113_0009378 3300048916 Bacteria 6417
350 Ga0496114_0010878 3300048917 Bacteria 7249
351 Ga0496114_0016508 3300048917 Bacteria 5951
352 Ga0496115_0011048 3300048918 Bacteria 6764
353 Ga0496115_0017516 3300048918 Bacteria 5480
354 Ga0496115_0051985 3300048918 Unclassified 3286
355 Ga0496115_0494996 3300048918 Unclassified 983
356 nmdc:mga05p37_30284_c1 3300050507 Bacteria 6602
357 nmdc:mga05p37_605209_c1 3300050507 Unclassified 1236
358 nmdc:mga05p37_737660_c1 3300050507 Unclassified 1088
359 nmdc:mga08y16_573955_c1 3300050511 Bacteria 1139
360 nmdc:mga08y16_587031_c1 3300050511 Bacteria 1124
361 nmdc:mga0n895_309006_c1 3300050512 Bacteria 1602
362 nmdc:mga0a205_338565_c1 3300050515 Bacteria 1373
363 Ga0495601_0008286 3300053077 Bacteria 6135
364 Ga0495612_0035002 3300053078 Bacteria 2034
365 Ga0495655_0137460 3300053083 Unclassified 758
366 Ga0495619_0166008 3300053085 Bacteria 1526
367 Ga0207665_10052030
368 JGI24737J22298_10030665
369 JGI24035J26624_1001010
370 JGI24035J26624_1002383
371 JGI24035J26624_1004043
372 JGI24035J26624_1007863
373 JGI25405J52794_10000777
374 JGI25405J52794_10000969
375 JGI25405J52794_10002868
376 Ga0058860_12206814
377 Ga0065704_10006870
378 Ga0065704_10215968
379 Ga0065712_10008021
380 Ga0065712_10010851
381 Ga0065712_10016320
382 Ga0065712_10072075
383 Ga0065715_10011417
384 Ga0065715_10094518
385 Ga0065715_10098096
386 Ga0065715_10251965
387 Ga0065707_10013726
388 Ga0070676_10025094
389 Ga0070683_100058198
390 Ga0070683_100060147
391 Ga0070683_100200487
392 Ga0070690_100004510
393 Ga0070690_100030653
394 Ga0070690_100133327
395 Ga0070670_100081747
396 Ga0070666_10092893
397 Ga0070666_10359410
398 Ga0070682_100157321
399 Ga0068868_100127435
400 Ga0068868_100725997
401 Ga0070660_100141327
402 Ga0070689_100065134
403 Ga0070689_100115696
404 Ga0070689_100360708
405 Ga0070687_100062834
406 Ga0070661_100013393
407 Ga0070668_100180974
408 Ga0070668_100202592
409 Ga0070669_100025228
410 Ga0070669_100176149
411 Ga0070675_100008769
412 Ga0070675_100241818
413 Ga0070675_100296984
414 Ga0070675_100400808
415 Ga0070671_100056020
416 Ga0070671_100262807
417 Ga0070671_100333851
418 Ga0070674_100006792
419 Ga0070673_100087217
420 Ga0070673_100483907
421 Ga0070688_100005081
422 Ga0070688_100014312
423 Ga0070688_100017405
424 Ga0070659_100007358
425 Ga0070659_100046483
426 Ga0070667_100253928
427 Ga0070667_100363014
428 Ga0070709_10047688
429 Ga0070714_100478191
430 Ga0070713_100084896
431 Ga0070710_10287010
432 Ga0070701_10041109
433 Ga0070711_100155880
434 Ga0070705_100282386
435 Ga0070694_100024242
436 Ga0070678_100050532
437 Ga0070678_100077047
438 Ga0070662_100031535
439 Ga0070662_100198560
440 Ga0070662_100360753
441 Ga0070681_10015513
442 Ga0070706_100435890
443 Ga0070706_100476586
444 Ga0070707_100093532
445 Ga0070707_100330250
446 Ga0070698_100026898
447 Ga0070698_100218254
448 Ga0070679_100148292
449 Ga0070684_100000767
450 Ga0070684_100009825
451 Ga0070684_100047285
452 Ga0070684_100103343
453 Ga0070697_100016552
454 Ga0070697_100316996
455 Ga0070672_100435234
456 Ga0070672_100509565
457 Ga0070686_100044943
458 Ga0070696_100337620
459 Ga0070665_100030911
460 Ga0070665_100048550
461 Ga0070665_100114548
462 Ga0070704_100058189
463 Ga0070704_100073121
464 Ga0070664_100178866
465 Ga0068856_100090460
466 Ga0070702_100024218
467 Ga0068859_100086392
468 Ga0068864_100148828
469 Ga0068864_100472783
470 Ga0068861_100362654
471 Ga0068863_100099694
472 Ga0068863_100199498
473 Ga0068858_100002330
474 Ga0068858_100057762
475 Ga0068860_100031572
476 Ga0068860_100047811
477 Ga0068862_100497912
478 Ga0068862_100556632
479 Ga0081455_10000697
480 Ga0081455_10003777
481 Ga0081455_10010175
482 Ga0081455_10010414
483 Ga0081455_10012795
484 Ga0081455_10018356
485 Ga0081455_10018691
486 Ga0081540_1001066
487 Ga0081540_1008618
488 Ga0081539_10049401
489 Ga0081539_10121895
490 Ga0070717_10012733
491 Ga0070717_10107178
492 Ga0070715_10308323
493 Ga0070712_100174680
494 Ga0070712_100242749
495 Ga0070712_100292357
496 Ga0070712_100582010
497 Ga0097621_100312742
498 Ga0068871_100061398
499 Ga0068871_100097592
500 Ga0075433_10195855
501 Ga0075434_100549283
502 Ga0097620_100086388
503 Ga0111539_10764661
504 Ga0105245_10159138
505 Ga0105247_10121364
506 Ga0114129_10117417
507 Ga0114129_10659375
508 Ga0105243_10233574
509 Ga0105241_10138559
510 Ga0105242_10362370
511 Ga0105248_10050325
512 Ga0105248_10110892
513 Ga0105237_10018878
514 Ga0105237_10482899
515 Ga0105249_10033802
516 Ga0105249_10308736
517 Ga0105249_10473678
518 Ga0099796_10024086
519 Ga0105239_10043894
520 Ga0105239_10234402
521 Ga0105239_10308136
522 Ga0157369_10012950
523 Ga0157374_10006214
524 Ga0157374_10100016
525 Ga0157374_10118816
526 Ga0157374_10164776
527 Ga0157374_10299720
528 Ga0157374_10309987
529 Ga0157374_10344646
530 Ga0157374_11006732
531 Ga0157378_10029528
532 Ga0163162_10017652
533 Ga0163162_10041691
534 Ga0163162_10043061
535 Ga0163162_10217903
536 Ga0157372_10108045
537 Ga0157372_10708445
538 Ga0157375_10013479
539 Ga0157375_10021083
540 Ga0157375_10124176
541 Ga0157375_10214303
542 Ga0163163_10035495
543 Ga0163163_10241599
544 Ga0182008_10043194
545 Ga0157379_10074821
546 Ga0157376_10375394
547 Ga0182005_1018526
548 Ga0163161_10515183
549 Ga0207666_1000287
550 Ga0207666_1001714
551 Ga0207673_1000899
552 Ga0207673_1006245
553 Ga0207697_10000548
554 Ga0207697_10001829
555 Ga0207697_10004640
556 Ga0207697_10005265
557 Ga0207697_10005750
558 Ga0207697_10041972
559 Ga0207697_10059782
560 Ga0207697_10071446
561 Ga0207692_10234363
562 Ga0207688_10011783
563 Ga0207688_10260461
564 Ga0207680_10199535
565 Ga0207680_10378579
566 Ga0207647_10003932
567 Ga0207647_10004636
568 Ga0207645_10010930
569 Ga0207684_10119949
570 Ga0207684_10167549
571 Ga0207671_10039610
572 Ga0207693_10074202
573 Ga0207693_10329980
574 Ga0207663_10024567
575 Ga0207663_10233758
576 Ga0207657_10191790
577 Ga0207657_10221365
578 Ga0207649_10276991
579 Ga0207652_10154052
580 Ga0207646_10365497
581 Ga0207646_10427981
582 Ga0207681_10169381
583 Ga0207650_10003606
584 Ga0207650_10410379
585 Ga0207659_10089728
586 Ga0207659_10225605
587 Ga0207659_10302804
588 Ga0207659_10448152
589 Ga0207659_10502295
590 Ga0207687_10261972
591 Ga0207687_10397284
592 Ga0207690_10028124
593 Ga0207706_10004066
594 Ga0207706_10040150
595 Ga0207706_10132047
596 Ga0207670_10014212
597 Ga0207670_10091699
598 Ga0207670_10614309
599 Ga0207665_10024772
600 Ga0207691_10358800
601 Ga0207711_10058676
602 Ga0207689_10565059
603 Ga0207661_10049673
604 Ga0207661_10100360
605 Ga0207661_10228023
606 Ga0207679_10029924
607 Ga0207651_10056946
608 Ga0207651_10062381
609 Ga0207651_10174140
610 Ga0207712_10016497
611 Ga0207712_10158732
612 Ga0207668_10383885
613 Ga0207658_10221371
614 Ga0207658_10401861
615 Ga0207677_10025872
616 Ga0207677_10090977
617 Ga0207678_10003161
618 Ga0207708_10007382
619 Ga0207641_10247571
620 Ga0207676_10084100
621 Ga0207683_10114238
622 Ga0268266_10025448
623 Ga0268266_10078125
624 Ga0268266_10180413
625 Ga0268266_10307397
626 Ga0268264_10044358
627 Ga0268264_10314119
628 Ga0373936_0068082
629 Ga0373941_0240901
630 Ga0373953_0013915
631 Ga0373956_0264654
632 Ga0373957_0032027
633 Ga0373943_0141640
634 Ga0373955_0034864
635 Ga0373933_0377370
636 Ga0373933_0590414
637 Ga0373947_0017750
638 Ga0373947_0073793
639 Ga0373947_0091945
640 Ga0373937_0007119
641 Ga0373925_0048200
642 Ga0395899_0090931
643 Ga0395900_0002142
644 Ga0395898_0005573
645 Ga0395905_0002466
646 Ga0395901_0001408
647 Ga0395901_0096994
648 Ga0439455_0017663
649 Ga0495592_0061304
650 Ga0495592_0170165
651 Ga0495651_0002559
652 Ga0495664_0110769
653 Ga0495628_0050003
654 Ga0495628_0064720
655 Ga0495666_0146258
656 Ga0495652_0017518
657 Ga0495665_0170615
658 Ga0495640_0227088
659 Ga0495586_0006767
660 Ga0495586_0034842
661 Ga0495645_0008144
662 Ga0495634_0015548
663 Ga0495634_0052773
664 Ga0495634_0074679
665 Ga0495634_0126840
666 Ga0495635_0259559
667 Ga0495599_0004147
668 Ga0495599_0097314
669 Ga0495623_0027827
670 Ga0495623_0245543
671 Ga0495646_0081278
672 Ga0495646_0151791
673 Ga0495658_0264704
674 Ga0495658_0412356
675 Ga0495613_0052457
676 Ga0495613_0088064
677 Ga0495624_0267772
678 Ga0495600_0299955
679 Ga0495674_0051519
680 Ga0495674_0066802
681 Ga0495674_0095883
682 Ga0495680_0092010
683 Ga0495684_0013415
684 Ga0495684_0020371
685 Ga0495602_0074282
686 Ga0496100_0028272
687 Ga0496100_0041294
688 Ga0496101_0056781
689 Ga0496101_0383248
690 Ga0496102_0136836
691 Ga0496102_0137009
692 Ga0496102_0139546
693 Ga0496103_0008563
694 Ga0496104_0035193
695 Ga0496104_0240894
696 Ga0496105_0373410
697 Ga0496106_0004446
698 Ga0496106_0195007
699 Ga0496107_0043619
700 Ga0496107_0088557
701 Ga0496107_0103920
702 Ga0496108_0051000
703 Ga0496108_0293261
704 Ga0496109_0104298
705 Ga0496109_0325827
706 Ga0496109_0533465
707 Ga0496109_0632009
708 Ga0496110_0096505
709 Ga0496110_0144170
710 Ga0496111_0091297
711 Ga0496112_0058332
712 Ga0496112_0100502
713 Ga0496112_0137817
714 Ga0496112_0207957
715 Ga0496113_0009378
716 Ga0496114_0010878
717 Ga0496114_0016508
718 Ga0496115_0011048
719 Ga0496115_0017516
720 Ga0496115_0051985
721 Ga0496115_0494996
722 nmdc:mga05p37_30284_c1
723 nmdc:mga05p37_605209_c1
724 nmdc:mga05p37_737660_c1
725 nmdc:mga08y16_573955_c1
726 nmdc:mga08y16_587031_c1
727 nmdc:mga0n895_309006_c1
728 nmdc:mga0a205_338565_c1
729 Ga0495601_0008286
730 Ga0495612_0035002
731 Ga0495655_0137460
732 Ga0495619_0166008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

47

301

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.7596 36 281
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.7415 36 281
3nb3-assembly1.cif.gz_A the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components 0.663 32 281
3nb3-assembly1.cif.gz_A the host outer membrane proteins ompa and ompc are packed at specific sites in the shigella phage sf6 virion as structural components 0.6543 32 281
1bxw-assembly1.cif.gz_A outer membrane protein a (ompa) transmembrane domain 0.6119 31 279
ID Description Score Start End Superfamily
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.7596 36 281 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.7415 36 281 2.40.160.20
af_Q5XJ22_33_145_3.30.110.20 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Alba-like domain 0.6931 231 273 3.30.110.20
af_Q54HY6_42_152_3.30.110.20 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Alba-like domain 0.6681 231 273 3.30.110.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.663 32 281 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A2V5QDT7-F1-model_v4 Uncharacterized protein 0.7675 1 281
AF-A0A1V5KZ13-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.6805 30 281
AF-A0A364LLQ9-F1-model_v4 Uncharacterized protein 0.6702 34 279
AF-A0A2H0VP94-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.6572 9 281
AF-A0A4V0HWJ7-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.6474 9 281

Map