F423989

General Info

Members Datasets Scaffolds Average Seq Length
366 179 732 268

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10005473|Ga0111539_100054732
Length 285
Sequence VARRALAGARLMARKTSFYYSFLVLPPEQRRAIVAVWDFCRAVDDAVDEAPAVTPGGDALPAGRAAVAFWREELARAFDGRAPSTPQGRRLQPFVRQFDLPRQAFEDVIDGVAMDLDTTRYQTFDDLFEYCRRVASAVGMICLRIFGSRGEGARDYALNLGVALQLTNILRDVKPDLERGRVYLPLEDLRAHGCTVDDLAAGVVTEPVRRLIAFECRRAREFYQRAKDALPPADRRRLVAAEIMRAVYFETLRRIERNGHDVFTARARVPRPRQAIIALRQWLLT

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
135 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
136 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 5.74
Rhizosphere 93.72
Stem 0
Stem Tuber 0
Unclassified 9.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10005473 3300009094 Bacteria 16428
2 LJQas_1007678 3300000549 Bacteria 1324
3 JGI24751J29686_10002767 3300002459 Bacteria 3528
4 Ga0068869_100140830 3300005334 Bacteria 1862
5 Ga0070666_10029301 3300005335 Bacteria 3618
6 Ga0070666_10029938 3300005335 Bacteria 3583
7 Ga0070680_100122698 3300005336 Unclassified 2169
8 Ga0070680_100237464 3300005336 Bacteria 1540
9 Ga0068868_100011616 3300005338 Bacteria 6414
10 Ga0068868_100067071 3300005338 Unclassified 2855
11 Ga0070660_100004015 3300005339 Bacteria 10158
12 Ga0070691_10000473 3300005341 Bacteria 15007
13 Ga0070687_100076287 3300005343 Bacteria 1815
14 Ga0070687_100081219 3300005343 Bacteria 1769
15 Ga0070668_100164286 3300005347 Bacteria 1803
16 Ga0070669_100025526 3300005353 Bacteria 4244
17 Ga0070669_100071591 3300005353 Bacteria 2565
18 Ga0070669_100226178 3300005353 Bacteria 1481
19 Ga0070675_100001310 3300005354 Bacteria 18174
20 Ga0070675_100076657 3300005354 Bacteria 2781
21 Ga0070675_100082884 3300005354 Unclassified 2676
22 Ga0070675_100099719 3300005354 Bacteria 2445
23 Ga0070675_100205388 3300005354 Bacteria 1711
24 Ga0070671_100083321 3300005355 Bacteria 2674
25 Ga0070674_100010058 3300005356 Bacteria 5696
26 Ga0070674_100057895 3300005356 Bacteria 2692
27 Ga0070674_100158938 3300005356 Bacteria 1713
28 Ga0070674_100454470 3300005356 Bacteria 1058
29 Ga0070673_100205442 3300005364 Bacteria 1698
30 Ga0070659_100054722 3300005366 Unclassified 3144
31 Ga0070667_100032642 3300005367 Bacteria 4343
32 Ga0070701_10007641 3300005438 Bacteria 4634
33 Ga0070701_10028577 3300005438 Unclassified 2742
34 Ga0070705_100004983 3300005440 Bacteria 6467
35 Ga0070705_100031402 3300005440 Bacteria 2941
36 Ga0070700_100049302 3300005441 Bacteria 2613
37 Ga0070700_100062771 3300005441 Bacteria 2348
38 Ga0070694_100057305 3300005444 Bacteria 2648
39 Ga0070708_100364574 3300005445 Archaea 1362
40 Ga0070678_100117764 3300005456 Bacteria 2089
41 Ga0070678_100746179 3300005456 Bacteria 885
42 Ga0070662_100154516 3300005457 Bacteria 1790
43 Ga0068867_100009353 3300005459 Bacteria 6917
44 Ga0068867_100025953 3300005459 Bacteria 4203
45 Ga0068867_100064811 3300005459 Bacteria 2717
46 Ga0070706_100056996 3300005467 Bacteria 3605
47 Ga0070706_100297898 3300005467 Bacteria 1505
48 Ga0070706_100464348 3300005467 Bacteria 1178
49 Ga0070707_100060504 3300005468 Bacteria 3632
50 Ga0070698_100227459 3300005471 Bacteria 1799
51 Ga0070699_100124552 3300005518 Bacteria 2268
52 Ga0070679_100022638 3300005530 Bacteria 6144
53 Ga0070697_100025292 3300005536 Bacteria 4736
54 Ga0070697_100523815 3300005536 Bacteria 1038
55 Ga0070672_100093168 3300005543 Bacteria 2433
56 Ga0070686_100014771 3300005544 Bacteria 4505
57 Ga0070686_100060239 3300005544 Bacteria 2449
58 Ga0070695_100000785 3300005545 Bacteria 17066
59 Ga0070695_100013998 3300005545 Bacteria 4830
60 Ga0070695_100171464 3300005545 Bacteria 1531
61 Ga0070695_100227334 3300005545 Bacteria 1347
62 Ga0070696_100025724 3300005546 Bacteria 4003
63 Ga0070696_100080319 3300005546 Bacteria 2308
64 Ga0070665_100301550 3300005548 Bacteria 1605
65 Ga0070704_100001151 3300005549 Bacteria 13820
66 Ga0070704_100009239 3300005549 Bacteria 5949
67 Ga0070704_100105042 3300005549 Unclassified 2137
68 Ga0068855_100104794 3300005563 Bacteria 3253
69 Ga0068857_100035149 3300005577 Bacteria 4435
70 Ga0068857_100289775 3300005577 Bacteria 1507
71 Ga0070702_100001302 3300005615 Bacteria 10114
72 Ga0068859_100026449 3300005617 Bacteria 5819
73 Ga0068859_100135230 3300005617 Bacteria 2538
74 Ga0068859_100142646 3300005617 Bacteria 2469
75 Ga0068859_100188474 3300005617 Bacteria 2147
76 Ga0068859_100253547 3300005617 Bacteria 1850
77 Ga0068859_100305979 3300005617 Bacteria 1683
78 Ga0068864_100006553 3300005618 Bacteria 9539
79 Ga0068864_100032415 3300005618 Bacteria 4440
80 Ga0068864_100284198 3300005618 Bacteria 1545
81 Ga0068866_10056698 3300005718 Bacteria 2016
82 Ga0068861_100003622 3300005719 Bacteria 10288
83 Ga0068861_100075701 3300005719 Bacteria 2621
84 Ga0068861_100103749 3300005719 Unclassified 2267
85 Ga0068861_100500577 3300005719 Bacteria 1098
86 Ga0068870_10319467 3300005840 Bacteria 986
87 Ga0068863_100061467 3300005841 Bacteria 3551
88 Ga0068858_100005453 3300005842 Bacteria 12454
89 Ga0068858_100013146 3300005842 Bacteria 7805
90 Ga0068858_100033845 3300005842 Bacteria 4740
91 Ga0068860_100205716 3300005843 Bacteria 1909
92 Ga0068860_100298027 3300005843 Bacteria 1579
93 Ga0068860_100339393 3300005843 Bacteria 1477
94 Ga0068860_100387322 3300005843 Bacteria 1381
95 Ga0068860_100391052 3300005843 Bacteria 1374
96 Ga0068860_100432455 3300005843 Bacteria 1306
97 Ga0068860_100587669 3300005843 Bacteria 1118
98 Ga0068862_100073032 3300005844 Bacteria 2965
99 Ga0081455_10022798 3300005937 Bacteria 5841
100 Ga0097621_100073739 3300006237 Bacteria 2826
101 Ga0068871_100014948 3300006358 Bacteria 5802
102 Ga0068871_100158498 3300006358 Bacteria 1934
103 Ga0075433_10245138 3300006852 Bacteria 1590
104 Ga0075433_10377339 3300006852 Bacteria 1252
105 Ga0075434_100004294 3300006871 Bacteria 12804
106 Ga0075434_100005549 3300006871 Bacteria 11495
107 Ga0075434_100200973 3300006871 Bacteria 2013
108 Ga0075434_100366060 3300006871 Bacteria 1462
109 Ga0075434_100445802 3300006871 Bacteria 1315
110 Ga0075434_100582716 3300006871 Bacteria 1138
111 Ga0075429_100014178 3300006880 Bacteria 6909
112 Ga0075436_100000295 3300006914 Bacteria 31676
113 Ga0075436_100033438 3300006914 Bacteria 3544
114 Ga0097620_100024547 3300006931 Bacteria 6048
115 Ga0097620_100026449 3300006931 Bacteria 5819
116 Ga0097620_100135231 3300006931 Bacteria 2538
117 Ga0097620_100142640 3300006931 Bacteria 2469
118 Ga0097620_100188469 3300006931 Bacteria 2147
119 Ga0097620_100253552 3300006931 Bacteria 1850
120 Ga0097620_100305986 3300006931 Bacteria 1683
121 Ga0075435_100000147 3300007076 Bacteria 39845
122 Ga0075435_100002656 3300007076 Bacteria 11922
123 Ga0075435_100251586 3300007076 Bacteria 1504
124 Ga0075435_100418373 3300007076 Unclassified 1154
125 Ga0105240_10244360 3300009093 Bacteria 2079
126 Ga0105240_10461971 3300009093 Bacteria 1418
127 Ga0111539_10000574 3300009094 Bacteria 47151
128 Ga0111539_10002429 3300009094 Bacteria 24773
129 Ga0111539_10353488 3300009094 Bacteria 1710
130 Ga0105245_10177347 3300009098 Bacteria 2033
131 Ga0105245_10375328 3300009098 Bacteria 1415
132 Ga0105245_10543181 3300009098 Bacteria 1183
133 Ga0105247_10036077 3300009101 Bacteria 3015
134 Ga0114129_10000772 3300009147 Bacteria 40849
135 Ga0114129_10001820 3300009147 Bacteria 29050
136 Ga0114129_10019642 3300009147 Bacteria 9617
137 Ga0114129_10056418 3300009147 Bacteria 5501
138 Ga0114129_10104992 3300009147 Bacteria 3904
139 Ga0114129_10208018 3300009147 Bacteria 2647
140 Ga0105243_10411003 3300009148 Bacteria 1259
141 Ga0105242_10032119 3300009176 Bacteria 4197
142 Ga0105242_10173080 3300009176 Bacteria 1899
143 Ga0105242_10224471 3300009176 Unclassified 1680
144 Ga0105242_10651165 3300009176 Bacteria 1024
145 Ga0105248_10004014 3300009177 Bacteria 16266
146 Ga0105248_10018395 3300009177 Bacteria 7720
147 Ga0105248_10041545 3300009177 Bacteria 5155
148 Ga0105248_10071222 3300009177 Bacteria 3905
149 Ga0105248_10197446 3300009177 Bacteria 2267
150 Ga0105248_10282609 3300009177 Unclassified 1868
151 Ga0105248_10284644 3300009177 Bacteria 1861
152 Ga0105248_10689626 3300009177 Bacteria 1152
153 Ga0105248_10832545 3300009177 Bacteria 1041
154 Ga0105249_10284857 3300009553 Bacteria 1652
155 Ga0157374_10144272 3300013296 Bacteria 2312
156 Ga0157378_10090441 3300013297 Bacteria 2781
157 Ga0163162_10115996 3300013306 Bacteria 2778
158 Ga0163162_10528966 3300013306 Bacteria 1308
159 Ga0163163_10010892 3300014325 Bacteria 8216
160 Ga0163163_10044612 3300014325 Bacteria 4350
161 Ga0163163_10503934 3300014325 Unclassified 1272
162 Ga0157380_10009061 3300014326 Bacteria 7111
163 Ga0157380_10066364 3300014326 Unclassified 2902
164 Ga0157380_10223928 3300014326 Bacteria 1685
165 Ga0157379_10090726 3300014968 Bacteria 2741
166 Ga0157379_10096439 3300014968 Bacteria 2654
167 Ga0157379_10293271 3300014968 Bacteria 1481
168 Ga0157376_10044878 3300014969 Bacteria 3636
169 Ga0163161_10436148 3300017792 Unclassified 1057
170 Ga0207697_10142630 3300025315 Bacteria 1040
171 Ga0207682_10096184 3300025893 Bacteria 1290
172 Ga0207680_10019777 3300025903 Bacteria 3609
173 Ga0207680_10331329 3300025903 Unclassified 1066
174 Ga0207685_10008594 3300025905 Bacteria 2919
175 Ga0207645_10016247 3300025907 Bacteria 4929
176 Ga0207643_10083640 3300025908 Bacteria 1852
177 Ga0207705_10265176 3300025909 Bacteria 1312
178 Ga0207660_10097516 3300025917 Unclassified 2191
179 Ga0207662_10092859 3300025918 Bacteria 1859
180 Ga0207662_10138190 3300025918 Bacteria 1541
181 Ga0207657_10231898 3300025919 Bacteria 1476
182 Ga0207652_10030640 3300025921 Bacteria 4506
183 Ga0207646_10020802 3300025922 Bacteria 6075
184 Ga0207646_10400244 3300025922 Bacteria 1240
185 Ga0207681_10029793 3300025923 Bacteria 3550
186 Ga0207681_10090466 3300025923 Bacteria 2184
187 Ga0207681_10584942 3300025923 Bacteria 921
188 Ga0207650_10425909 3300025925 Bacteria 1102
189 Ga0207659_10000076 3300025926 Bacteria 62373
190 Ga0207659_10010079 3300025926 Bacteria 5922
191 Ga0207659_10054614 3300025926 Unclassified 2853
192 Ga0207659_10106880 3300025926 Bacteria 2120
193 Ga0207659_10160901 3300025926 Bacteria 1762
194 Ga0207687_10008541 3300025927 Bacteria 6698
195 Ga0207687_10118623 3300025927 Bacteria 1975
196 Ga0207664_10135389 3300025929 Bacteria 2078
197 Ga0207690_10198874 3300025932 Bacteria 1521
198 Ga0207706_10095830 3300025933 Bacteria 2609
199 Ga0207706_10193783 3300025933 Bacteria 1783
200 Ga0207686_10013528 3300025934 Bacteria 4517
201 Ga0207686_10062320 3300025934 Bacteria 2368
202 Ga0207709_10039396 3300025935 Bacteria 2822
203 Ga0207669_10064223 3300025937 Bacteria 2271
204 Ga0207669_10122276 3300025937 Bacteria 1770
205 Ga0207669_10186744 3300025937 Bacteria 1491
206 Ga0207669_10192914 3300025937 Unclassified 1471
207 Ga0207669_10379464 3300025937 Bacteria 1101
208 Ga0207704_10074351 3300025938 Bacteria 2168
209 Ga0207691_10034581 3300025940 Bacteria 4698
210 Ga0207711_10065054 3300025941 Bacteria 3151
211 Ga0207711_10074953 3300025941 Bacteria 2944
212 Ga0207711_10096158 3300025941 Bacteria 2613
213 Ga0207711_10178439 3300025941 Bacteria 1930
214 Ga0207711_10267034 3300025941 Bacteria 1574
215 Ga0207711_10275633 3300025941 Bacteria 1548
216 Ga0207689_10419833 3300025942 Bacteria 1116
217 Ga0207667_10073574 3300025949 Bacteria 3550
218 Ga0207667_10233603 3300025949 Bacteria 1882
219 Ga0207651_10254656 3300025960 Bacteria 1438
220 Ga0207651_10326041 3300025960 Bacteria 1285
221 Ga0207651_10402358 3300025960 Bacteria 1165
222 Ga0207668_10070125 3300025972 Bacteria 2498
223 Ga0207658_10023620 3300025986 Bacteria 4294
224 Ga0207677_10452962 3300026023 Bacteria 1100
225 Ga0207703_10021562 3300026035 Bacteria 5044
226 Ga0207703_10066527 3300026035 Bacteria 2964
227 Ga0207703_10139374 3300026035 Unclassified 2103
228 Ga0207639_10050297 3300026041 Bacteria 3165
229 Ga0207708_10009515 3300026075 Bacteria 7203
230 Ga0207708_10035891 3300026075 Bacteria 3772
231 Ga0207708_10042700 3300026075 Bacteria 3455
232 Ga0207708_10182227 3300026075 Bacteria 1668
233 Ga0207708_10353255 3300026075 Bacteria 1206
234 Ga0207641_10002636 3300026088 Bacteria 16427
235 Ga0207641_10587507 3300026088 Bacteria 1089
236 Ga0207648_10017181 3300026089 Bacteria 6592
237 Ga0207648_10017648 3300026089 Bacteria 6482
238 Ga0207648_10024699 3300026089 Bacteria 5360
239 Ga0207648_10203687 3300026089 Unclassified 1756
240 Ga0207648_10352742 3300026089 Bacteria 1326
241 Ga0207676_10020045 3300026095 Bacteria 4888
242 Ga0207676_10039889 3300026095 Bacteria 3595
243 Ga0207676_10226920 3300026095 Bacteria 1667
244 Ga0207676_10388784 3300026095 Unclassified 1300
245 Ga0207676_10467725 3300026095 Bacteria 1192
246 Ga0207674_10106148 3300026116 Unclassified 2786
247 Ga0207674_10108909 3300026116 Bacteria 2747
248 Ga0207675_100009497 3300026118 Bacteria 9103
249 Ga0207675_100164168 3300026118 Bacteria 2120
250 Ga0207675_100182653 3300026118 Unclassified 2009
251 Ga0207675_100198091 3300026118 Bacteria 1928
252 Ga0207675_100354679 3300026118 Bacteria 1438
253 Ga0207675_100365269 3300026118 Bacteria 1417
254 Ga0207675_100514469 3300026118 Bacteria 1193
255 Ga0207683_10032292 3300026121 Bacteria 4548
256 Ga0207683_10274082 3300026121 Bacteria 1541
257 Ga0207683_10291344 3300026121 Bacteria 1493
258 Ga0207683_10305453 3300026121 Bacteria 1456
259 Ga0207698_10609609 3300026142 Bacteria 1077
260 Ga0207428_10000135 3300027907 Bacteria 99170
261 Ga0207428_10016925 3300027907 Bacteria 6265
262 Ga0207428_10283779 3300027907 Bacteria 1228
263 Ga0268266_10278378 3300028379 Bacteria 1555
264 Ga0268265_10069264 3300028380 Bacteria 2738
265 Ga0268264_10086462 3300028381 Bacteria 2694
266 Ga0268264_10116016 3300028381 Unclassified 2353
267 Ga0268264_10210473 3300028381 Bacteria 1785
268 Ga0268264_10281610 3300028381 Bacteria 1558
269 Ga0307408_100164454 3300031548 Bacteria 1766
270 Ga0265314_10026438 3300031711 Bacteria 4360
271 Ga0307413_10009633 3300031824 Bacteria 4635
272 Ga0307406_10246138 3300031901 Bacteria 1344
273 Ga0307407_10021658 3300031903 Bacteria 3321
274 Ga0307409_100033212 3300031995 Bacteria 3752
275 Ga0307409_100090582 3300031995 Bacteria 2504
276 Ga0307416_100150841 3300032002 Bacteria 2131
277 Ga0307414_10340931 3300032004 Bacteria 1283
278 Ga0307411_10011719 3300032005 Bacteria 4748
279 Ga0373939_0025474 3300035114 Unclassified 1659
280 Ga0373935_0067859 3300035692 Bacteria 2294
281 Ga0373927_0049365 3300035695 Bacteria 2721
282 Ga0373925_0305865 3300037068 Bacteria 1284
283 Ga0373925_0526578 3300037068 Unclassified 971
284 Ga0450923_023403 3300042125 Bacteria 1219
285 Ga0439435_0007115 3300042436 Bacteria 2545
286 Ga0450918_013458 3300042531 Bacteria 1424
287 Ga0451577_0318700 3300042876 Bacteria 1410
288 Ga0466963_0116452 3300044694 Bacteria 1837
289 Ga0451576_0211949 3300045051 Bacteria 2023
290 Ga0451576_0711844 3300045051 Bacteria 1055
291 Ga0495580_0229439 3300046472 Bacteria 1275
292 Ga0495639_0085552 3300046475 Unclassified 1474
293 Ga0495583_0118058 3300046506 Bacteria 1119
294 Ga0495621_0023169 3300046539 Bacteria 2064
295 Ga0495658_0025932 3300046683 Bacteria 3137
296 Ga0495658_0098943 3300046683 Bacteria 1738
297 Ga0495658_0102246 3300046683 Bacteria 1712
298 Ga0495613_0112704 3300046689 Bacteria 1959
299 Ga0495613_0198157 3300046689 Bacteria 1417
300 Ga0495670_0032021 3300046691 Unclassified 2614
301 Ga0495604_0072932 3300047317 Bacteria 2593
302 Ga0495676_0197654 3300047321 Bacteria 1399
303 Ga0496100_0213497 3300048903 Bacteria 1413
304 Ga0496101_0000348 3300048904 Bacteria 31198
305 Ga0496102_0051122 3300048905 Bacteria 3765
306 Ga0496102_0226921 3300048905 Bacteria 1761
307 Ga0496104_0208511 3300048907 Bacteria 1866
308 Ga0496104_0383762 3300048907 Unclassified 1317
309 Ga0496104_0515033 3300048907 Bacteria 1107
310 Ga0496106_0121393 3300048909 Bacteria 2043
311 Ga0496107_0032552 3300048910 Bacteria 3727
312 Ga0496109_0272887 3300048912 Unclassified 1594
313 Ga0496109_0458189 3300048912 Bacteria 1204
314 Ga0496110_0309323 3300048913 Bacteria 1439
315 Ga0496110_0380166 3300048913 Bacteria 1287
316 Ga0496112_0008251 3300048915 Bacteria 9319
317 Ga0496112_0035830 3300048915 Bacteria 4836
318 Ga0496112_0281506 3300048915 Bacteria 1610
319 Ga0496113_0027528 3300048916 Bacteria 4077
320 Ga0496113_0031664 3300048916 Bacteria 3840
321 Ga0496114_0002236 3300048917 Bacteria 14743
322 Ga0496114_0465206 3300048917 Unclassified 1119
323 Ga0496115_0249645 3300048918 Unclassified 1461
324 Ga0501046_0118723 3300049580 Bacteria 2014
325 Ga0501071_0074098 3300049587 Bacteria 2484
326 Ga0501072_0028762 3300049588 Bacteria 4339
327 Ga0501074_0078191 3300049590 Unclassified 2374
328 Ga0501074_0164165 3300049590 Bacteria 1586
329 Ga0501076_0051800 3300049592 Bacteria 3250
330 Ga0501077_0073817 3300049593 Bacteria 2161
331 Ga0501077_0117577 3300049593 Bacteria 1685
332 Ga0501081_0093246 3300049743 Bacteria 2120
333 Ga0501045_0043793 3300049824 Bacteria 3260
334 Ga0501045_0380518 3300049824 Bacteria 1051
335 nmdc:mga05p37_164716_c1 3300050507 Bacteria 2706
336 nmdc:mga05p37_2105_c1 3300050507 Bacteria 23247
337 nmdc:mga05p37_2819_c1 3300050507 Bacteria 20214
338 nmdc:mga05p37_2944_c1 3300050507 Bacteria 19766
339 nmdc:mga05p37_358383_c1 3300050507 Bacteria 1715
340 nmdc:mga05p37_46860_c1 3300050507 Bacteria 5315
341 nmdc:mga09592_310619_c1 3300050508 Bacteria 1366
342 nmdc:mga08y16_1673_c1 3300050511 Bacteria 22480
343 nmdc:mga08y16_17395_c1 3300050511 Bacteria 7570
344 nmdc:mga08y16_25632_c1 3300050511 Bacteria 6221
345 nmdc:mga08y16_301661_c1 3300050511 Bacteria 1651
346 nmdc:mga08y16_466324_c1 3300050511 Bacteria 1286
347 nmdc:mga08y16_95373_c1 3300050511 Bacteria 3099
348 nmdc:mga0n895_105079_c1 3300050512 Bacteria 2836
349 nmdc:mga0n895_31871_c1 3300050512 Bacteria 5053
350 nmdc:mga0n895_328273_c1 3300050512 Bacteria 1550
351 nmdc:mga0n895_3356_c1 3300050512 Bacteria 12873
352 nmdc:mga0n895_48189_c1 3300050512 Bacteria 4169
353 nmdc:mga0n895_586506_c1 3300050512 Unclassified 1118
354 nmdc:mga0n895_97_c2 3300050512 Bacteria 37428
355 nmdc:mga0rr50_125625_c1 3300050513 Bacteria 2048
356 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
357 nmdc:mga0rr50_257385_c1 3300050513 Bacteria 1451
358 nmdc:mga0rr50_7259_c1 3300050513 Bacteria 6817
359 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
360 nmdc:mga08x19_216748_c1 3300050514 Bacteria 1315
361 nmdc:mga0a205_3446_c1 3300050515 Bacteria 14116
362 nmdc:mga0a205_69161_c1 3300050515 Bacteria 3410
363 Ga0495619_0285781 3300053085 Bacteria 1143
364 Ga0500646_0086681 3300053090 Bacteria 963
365 Ga0500555_025572 3300053103 Bacteria 1690
366 Ga0501084_0348856 3300054114 Bacteria 1250
367 Ga0111539_10005473
368 LJQas_1007678
369 JGI24751J29686_10002767
370 Ga0068869_100140830
371 Ga0070666_10029301
372 Ga0070666_10029938
373 Ga0070680_100122698
374 Ga0070680_100237464
375 Ga0068868_100011616
376 Ga0068868_100067071
377 Ga0070660_100004015
378 Ga0070691_10000473
379 Ga0070687_100076287
380 Ga0070687_100081219
381 Ga0070668_100164286
382 Ga0070669_100025526
383 Ga0070669_100071591
384 Ga0070669_100226178
385 Ga0070675_100001310
386 Ga0070675_100076657
387 Ga0070675_100082884
388 Ga0070675_100099719
389 Ga0070675_100205388
390 Ga0070671_100083321
391 Ga0070674_100010058
392 Ga0070674_100057895
393 Ga0070674_100158938
394 Ga0070674_100454470
395 Ga0070673_100205442
396 Ga0070659_100054722
397 Ga0070667_100032642
398 Ga0070701_10007641
399 Ga0070701_10028577
400 Ga0070705_100004983
401 Ga0070705_100031402
402 Ga0070700_100049302
403 Ga0070700_100062771
404 Ga0070694_100057305
405 Ga0070708_100364574
406 Ga0070678_100117764
407 Ga0070678_100746179
408 Ga0070662_100154516
409 Ga0068867_100009353
410 Ga0068867_100025953
411 Ga0068867_100064811
412 Ga0070706_100056996
413 Ga0070706_100297898
414 Ga0070706_100464348
415 Ga0070707_100060504
416 Ga0070698_100227459
417 Ga0070699_100124552
418 Ga0070679_100022638
419 Ga0070697_100025292
420 Ga0070697_100523815
421 Ga0070672_100093168
422 Ga0070686_100014771
423 Ga0070686_100060239
424 Ga0070695_100000785
425 Ga0070695_100013998
426 Ga0070695_100171464
427 Ga0070695_100227334
428 Ga0070696_100025724
429 Ga0070696_100080319
430 Ga0070665_100301550
431 Ga0070704_100001151
432 Ga0070704_100009239
433 Ga0070704_100105042
434 Ga0068855_100104794
435 Ga0068857_100035149
436 Ga0068857_100289775
437 Ga0070702_100001302
438 Ga0068859_100026449
439 Ga0068859_100135230
440 Ga0068859_100142646
441 Ga0068859_100188474
442 Ga0068859_100253547
443 Ga0068859_100305979
444 Ga0068864_100006553
445 Ga0068864_100032415
446 Ga0068864_100284198
447 Ga0068866_10056698
448 Ga0068861_100003622
449 Ga0068861_100075701
450 Ga0068861_100103749
451 Ga0068861_100500577
452 Ga0068870_10319467
453 Ga0068863_100061467
454 Ga0068858_100005453
455 Ga0068858_100013146
456 Ga0068858_100033845
457 Ga0068860_100205716
458 Ga0068860_100298027
459 Ga0068860_100339393
460 Ga0068860_100387322
461 Ga0068860_100391052
462 Ga0068860_100432455
463 Ga0068860_100587669
464 Ga0068862_100073032
465 Ga0081455_10022798
466 Ga0097621_100073739
467 Ga0068871_100014948
468 Ga0068871_100158498
469 Ga0075433_10245138
470 Ga0075433_10377339
471 Ga0075434_100004294
472 Ga0075434_100005549
473 Ga0075434_100200973
474 Ga0075434_100366060
475 Ga0075434_100445802
476 Ga0075434_100582716
477 Ga0075429_100014178
478 Ga0075436_100000295
479 Ga0075436_100033438
480 Ga0097620_100024547
481 Ga0097620_100026449
482 Ga0097620_100135231
483 Ga0097620_100142640
484 Ga0097620_100188469
485 Ga0097620_100253552
486 Ga0097620_100305986
487 Ga0075435_100000147
488 Ga0075435_100002656
489 Ga0075435_100251586
490 Ga0075435_100418373
491 Ga0105240_10244360
492 Ga0105240_10461971
493 Ga0111539_10000574
494 Ga0111539_10002429
495 Ga0111539_10353488
496 Ga0105245_10177347
497 Ga0105245_10375328
498 Ga0105245_10543181
499 Ga0105247_10036077
500 Ga0114129_10000772
501 Ga0114129_10001820
502 Ga0114129_10019642
503 Ga0114129_10056418
504 Ga0114129_10104992
505 Ga0114129_10208018
506 Ga0105243_10411003
507 Ga0105242_10032119
508 Ga0105242_10173080
509 Ga0105242_10224471
510 Ga0105242_10651165
511 Ga0105248_10004014
512 Ga0105248_10018395
513 Ga0105248_10041545
514 Ga0105248_10071222
515 Ga0105248_10197446
516 Ga0105248_10282609
517 Ga0105248_10284644
518 Ga0105248_10689626
519 Ga0105248_10832545
520 Ga0105249_10284857
521 Ga0157374_10144272
522 Ga0157378_10090441
523 Ga0163162_10115996
524 Ga0163162_10528966
525 Ga0163163_10010892
526 Ga0163163_10044612
527 Ga0163163_10503934
528 Ga0157380_10009061
529 Ga0157380_10066364
530 Ga0157380_10223928
531 Ga0157379_10090726
532 Ga0157379_10096439
533 Ga0157379_10293271
534 Ga0157376_10044878
535 Ga0163161_10436148
536 Ga0207697_10142630
537 Ga0207682_10096184
538 Ga0207680_10019777
539 Ga0207680_10331329
540 Ga0207685_10008594
541 Ga0207645_10016247
542 Ga0207643_10083640
543 Ga0207705_10265176
544 Ga0207660_10097516
545 Ga0207662_10092859
546 Ga0207662_10138190
547 Ga0207657_10231898
548 Ga0207652_10030640
549 Ga0207646_10020802
550 Ga0207646_10400244
551 Ga0207681_10029793
552 Ga0207681_10090466
553 Ga0207681_10584942
554 Ga0207650_10425909
555 Ga0207659_10000076
556 Ga0207659_10010079
557 Ga0207659_10054614
558 Ga0207659_10106880
559 Ga0207659_10160901
560 Ga0207687_10008541
561 Ga0207687_10118623
562 Ga0207664_10135389
563 Ga0207690_10198874
564 Ga0207706_10095830
565 Ga0207706_10193783
566 Ga0207686_10013528
567 Ga0207686_10062320
568 Ga0207709_10039396
569 Ga0207669_10064223
570 Ga0207669_10122276
571 Ga0207669_10186744
572 Ga0207669_10192914
573 Ga0207669_10379464
574 Ga0207704_10074351
575 Ga0207691_10034581
576 Ga0207711_10065054
577 Ga0207711_10074953
578 Ga0207711_10096158
579 Ga0207711_10178439
580 Ga0207711_10267034
581 Ga0207711_10275633
582 Ga0207689_10419833
583 Ga0207667_10073574
584 Ga0207667_10233603
585 Ga0207651_10254656
586 Ga0207651_10326041
587 Ga0207651_10402358
588 Ga0207668_10070125
589 Ga0207658_10023620
590 Ga0207677_10452962
591 Ga0207703_10021562
592 Ga0207703_10066527
593 Ga0207703_10139374
594 Ga0207639_10050297
595 Ga0207708_10009515
596 Ga0207708_10035891
597 Ga0207708_10042700
598 Ga0207708_10182227
599 Ga0207708_10353255
600 Ga0207641_10002636
601 Ga0207641_10587507
602 Ga0207648_10017181
603 Ga0207648_10017648
604 Ga0207648_10024699
605 Ga0207648_10203687
606 Ga0207648_10352742
607 Ga0207676_10020045
608 Ga0207676_10039889
609 Ga0207676_10226920
610 Ga0207676_10388784
611 Ga0207676_10467725
612 Ga0207674_10106148
613 Ga0207674_10108909
614 Ga0207675_100009497
615 Ga0207675_100164168
616 Ga0207675_100182653
617 Ga0207675_100198091
618 Ga0207675_100354679
619 Ga0207675_100365269
620 Ga0207675_100514469
621 Ga0207683_10032292
622 Ga0207683_10274082
623 Ga0207683_10291344
624 Ga0207683_10305453
625 Ga0207698_10609609
626 Ga0207428_10000135
627 Ga0207428_10016925
628 Ga0207428_10283779
629 Ga0268266_10278378
630 Ga0268265_10069264
631 Ga0268264_10086462
632 Ga0268264_10116016
633 Ga0268264_10210473
634 Ga0268264_10281610
635 Ga0307408_100164454
636 Ga0265314_10026438
637 Ga0307413_10009633
638 Ga0307406_10246138
639 Ga0307407_10021658
640 Ga0307409_100033212
641 Ga0307409_100090582
642 Ga0307416_100150841
643 Ga0307414_10340931
644 Ga0307411_10011719
645 Ga0373939_0025474
646 Ga0373935_0067859
647 Ga0373927_0049365
648 Ga0373925_0305865
649 Ga0373925_0526578
650 Ga0450923_023403
651 Ga0439435_0007115
652 Ga0450918_013458
653 Ga0451577_0318700
654 Ga0466963_0116452
655 Ga0451576_0211949
656 Ga0451576_0711844
657 Ga0495580_0229439
658 Ga0495639_0085552
659 Ga0495583_0118058
660 Ga0495621_0023169
661 Ga0495658_0025932
662 Ga0495658_0098943
663 Ga0495658_0102246
664 Ga0495613_0112704
665 Ga0495613_0198157
666 Ga0495670_0032021
667 Ga0495604_0072932
668 Ga0495676_0197654
669 Ga0496100_0213497
670 Ga0496101_0000348
671 Ga0496102_0051122
672 Ga0496102_0226921
673 Ga0496104_0208511
674 Ga0496104_0383762
675 Ga0496104_0515033
676 Ga0496106_0121393
677 Ga0496107_0032552
678 Ga0496109_0272887
679 Ga0496109_0458189
680 Ga0496110_0309323
681 Ga0496110_0380166
682 Ga0496112_0008251
683 Ga0496112_0035830
684 Ga0496112_0281506
685 Ga0496113_0027528
686 Ga0496113_0031664
687 Ga0496114_0002236
688 Ga0496114_0465206
689 Ga0496115_0249645
690 Ga0501046_0118723
691 Ga0501071_0074098
692 Ga0501072_0028762
693 Ga0501074_0078191
694 Ga0501074_0164165
695 Ga0501076_0051800
696 Ga0501077_0073817
697 Ga0501077_0117577
698 Ga0501081_0093246
699 Ga0501045_0043793
700 Ga0501045_0380518
701 nmdc:mga05p37_164716_c1
702 nmdc:mga05p37_2105_c1
703 nmdc:mga05p37_2819_c1
704 nmdc:mga05p37_2944_c1
705 nmdc:mga05p37_358383_c1
706 nmdc:mga05p37_46860_c1
707 nmdc:mga09592_310619_c1
708 nmdc:mga08y16_1673_c1
709 nmdc:mga08y16_17395_c1
710 nmdc:mga08y16_25632_c1
711 nmdc:mga08y16_301661_c1
712 nmdc:mga08y16_466324_c1
713 nmdc:mga08y16_95373_c1
714 nmdc:mga0n895_105079_c1
715 nmdc:mga0n895_31871_c1
716 nmdc:mga0n895_328273_c1
717 nmdc:mga0n895_3356_c1
718 nmdc:mga0n895_48189_c1
719 nmdc:mga0n895_586506_c1
720 nmdc:mga0n895_97_c2
721 nmdc:mga0rr50_125625_c1
722 nmdc:mga0rr50_20_c1
723 nmdc:mga0rr50_257385_c1
724 nmdc:mga0rr50_7259_c1
725 nmdc:mga08x19_178_c1
726 nmdc:mga08x19_216748_c1
727 nmdc:mga0a205_3446_c1
728 nmdc:mga0a205_69161_c1
729 Ga0495619_0285781
730 Ga0500646_0086681
731 Ga0500555_025572
732 Ga0501084_0348856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00494

SQS_PSY

Squalene/phytoene synthase

11

273

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hd1-assembly1.cif.gz_A crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius 0.9051 7 233
5iys-assembly1.cif.gz_A crystal structure of a dehydrosqualene synthase in complex with ligand 0.8879 3 258
4ea1-assembly1.cif.gz_A co-crystal structure of dehydrosqualene synthase (crtm) from s. aureus with sq-109 0.8836 3 256
3lgz-assembly1.cif.gz_B crystal structure of dehydrosqualene synthase y129a from s. aureus complexed with presqualene pyrophosphate 0.8807 3 256
3acx-assembly1.cif.gz_A crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bph-673 0.8787 6 256
ID Description Score Start End Superfamily
4hd1A00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8958 7 235 1.10.600.10
af_P9WHP3_1_280_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8847 3 254 1.10.600.10
af_Q330K2_57_309_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8798 3 235 1.10.600.10
af_Q9VYS5_51_308_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.874 4 232 1.10.600.10
af_Q17477_122_396_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.871 4 235 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A7V9CIH4-F1-model_v4 Squalene/phytoene synthase family protein 0.9948 92 258 GO:0008299
GO:0016765
AF-A0A354F1Z8-F1-model_v4 Squalene synthase HpnD 0.9841 92 259 GO:0008299
GO:0016765
AF-A0A2V8PXD3-F1-model_v4 Squalene synthase HpnD 0.9841 95 256 GO:0008299
GO:0016765
AF-A0A538NUG7-F1-model_v4 Squalene synthase HpnD 0.9794 60 260 GO:0016117
GO:0051996
AF-A0A3D1CLC2-F1-model_v4 Squalene synthase HpnD 0.9772 56 258 GO:0016117
GO:0051996

Map