F423970

General Info

Members Datasets Scaffolds Average Seq Length
366 253 732 284

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10060147|Ga0075369_100601471
Length 302
Sequence MGRPPSRCSLVGPTKSSGAAPSPRVSLSGSLAQSSAVRDLAGCAPSDQKSPTASGTCDKGALATLKSGVLTFGTDQPAYPPWFVDDDPANAKGFESAVAYAVADKLGYDTKKVNWVRVPFNAAIAPGPKTFDANLNEFSITDERKQAVDFSSPYYDVTQAVVTVKSSPAAKVTTVAGLRDLRLGAQVGTTSYDAAKAVGAKAPVSVYNNNDDAKAALTNGQIDALVLDLPTAFQVQSELADGDIVGQLPSGTGKPEQFGIVLDKGSALTSCVSGAVDALRSDGTLARLQQQWLTEAGAPVLT

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
219 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
227 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
235 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
236 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
237 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
238 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
239 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
240 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
241 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
242 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
243 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
244 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
245 2919069694 Microbacterium sp. 1154 Isolate Unclassified
246 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
247 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
248 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
249 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
250 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
251 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
252 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
253 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.54
Metatranscriptomes 0
Isolates 5.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 7.65
Nodule 0
Rhizoplane 6.83
Rhizosphere 74.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10060147 3300006186 Bacteria 1656
2 JGI24735J21928_10073857 3300002067 Bacteria 977
3 JGI24738J21930_10026453 3300002075 Bacteria 1190
4 JGI24744J21845_10020568 3300002077 Bacteria 1301
5 JGI24742J22300_10005783 3300002244 Bacteria 2035
6 Ga0055540_1001316 3300003792 Bacteria 14982
7 Ga0070676_10014031 3300005328 Bacteria 4396
8 Ga0070676_10020291 3300005328 Bacteria 3707
9 Ga0070683_100011100 3300005329 Bacteria 7768
10 Ga0070683_100040179 3300005329 Bacteria 4299
11 Ga0070670_100135012 3300005331 Bacteria 2132
12 Ga0068869_100010755 3300005334 Bacteria 5976
13 Ga0068869_100037991 3300005334 Bacteria 3427
14 Ga0068869_100205687 3300005334 Bacteria 1554
15 Ga0070666_10061561 3300005335 Bacteria 2541
16 Ga0070666_10144483 3300005335 Bacteria 1658
17 Ga0070682_100024282 3300005337 Bacteria 3605
18 Ga0068868_100013566 3300005338 Bacteria 5980
19 Ga0068868_100029228 3300005338 Bacteria 4220
20 Ga0070660_100239995 3300005339 Bacteria 1476
21 Ga0070689_100350842 3300005340 Bacteria 1237
22 Ga0070692_10051300 3300005345 Bacteria 2145
23 Ga0070668_100127992 3300005347 Bacteria 2036
24 Ga0070669_100129440 3300005353 Bacteria 1935
25 Ga0070675_100006430 3300005354 Bacteria 9017
26 Ga0070674_100022827 3300005356 Bacteria 4038
27 Ga0070674_100354251 3300005356 Bacteria 1186
28 Ga0070673_100373546 3300005364 Bacteria 1270
29 Ga0070688_100081246 3300005365 Bacteria 2099
30 Ga0070659_100039242 3300005366 Bacteria 3696
31 Ga0070667_100000048 3300005367 Bacteria 160347
32 Ga0070667_100043631 3300005367 Bacteria 3764
33 Ga0070667_100146583 3300005367 Bacteria 2071
34 Ga0070703_10006493 3300005406 Bacteria 3278
35 Ga0070709_10048908 3300005434 Bacteria 2641
36 Ga0070714_100590889 3300005435 Bacteria 1065
37 Ga0070701_10006385 3300005438 Bacteria 4958
38 Ga0070711_100011199 3300005439 Bacteria 5562
39 Ga0070705_100031261 3300005440 Bacteria 2947
40 Ga0070700_100006024 3300005441 Bacteria 6452
41 Ga0070700_100046667 3300005441 Bacteria 2677
42 Ga0070694_100286544 3300005444 Bacteria 1257
43 Ga0070663_100009388 3300005455 Bacteria 6055
44 Ga0070663_100227748 3300005455 Bacteria 1466
45 Ga0070678_100071139 3300005456 Bacteria 2603
46 Ga0070678_100265040 3300005456 Bacteria 1447
47 Ga0070662_100014363 3300005457 Bacteria 5288
48 Ga0070662_100057138 3300005457 Bacteria 2834
49 Ga0068867_100092680 3300005459 Bacteria 2295
50 Ga0070685_10055608 3300005466 Bacteria 2299
51 Ga0070684_100003350 3300005535 Bacteria 12005
52 Ga0070684_100078165 3300005535 Bacteria 2923
53 Ga0068853_100100029 3300005539 Bacteria 2562
54 Ga0070672_100145110 3300005543 Bacteria 1961
55 Ga0070672_100221634 3300005543 Bacteria 1587
56 Ga0070696_100015809 3300005546 Bacteria 5072
57 Ga0070693_100010681 3300005547 Bacteria 4605
58 Ga0070693_100302429 3300005547 Bacteria 1079
59 Ga0070665_100027616 3300005548 Bacteria 5716
60 Ga0070665_100040666 3300005548 Bacteria 4673
61 Ga0070665_100281250 3300005548 Bacteria 1666
62 Ga0070704_100336542 3300005549 Bacteria 1269
63 Ga0068855_100590458 3300005563 Bacteria 1199
64 Ga0070664_100017215 3300005564 Bacteria 5934
65 Ga0070664_100187473 3300005564 Bacteria 1842
66 Ga0068857_100109699 3300005577 Bacteria 2480
67 Ga0068854_100046483 3300005578 Bacteria 3090
68 Ga0068856_100087756 3300005614 Bacteria 3093
69 Ga0068856_100281452 3300005614 Bacteria 1680
70 Ga0070702_100057867 3300005615 Bacteria 2243
71 Ga0068852_100016825 3300005616 Bacteria 5717
72 Ga0068852_100064483 3300005616 Bacteria 3193
73 Ga0068859_100009170 3300005617 Bacteria 9994
74 Ga0068859_100130472 3300005617 Bacteria 2584
75 Ga0068859_100302389 3300005617 Bacteria 1693
76 Ga0068851_10104648 3300005834 Bacteria 1505
77 Ga0068863_100000176 3300005841 Bacteria 67756
78 Ga0068863_100294690 3300005841 Bacteria 1573
79 Ga0068858_100033419 3300005842 Bacteria 4773
80 Ga0068858_100056111 3300005842 Bacteria 3641
81 Ga0068860_100000225 3300005843 Bacteria 87813
82 Ga0068862_100000018 3300005844 Bacteria 231245
83 Ga0068862_100072979 3300005844 Bacteria 2965
84 Ga0068862_100284115 3300005844 Bacteria 1517
85 Ga0081539_10111322 3300005985 Bacteria 1377
86 Ga0075365_10044684 3300006038 Bacteria 2904
87 Ga0075365_10311546 3300006038 Bacteria 1108
88 Ga0070712_100016303 3300006175 Bacteria 4801
89 Ga0070712_100024138 3300006175 Bacteria 4025
90 Ga0070712_100107387 3300006175 Bacteria 2077
91 Ga0075362_10075531 3300006177 Bacteria 1546
92 Ga0075369_10006596 3300006186 Bacteria 4394
93 Ga0075369_10012692 3300006186 Bacteria 3329
94 Ga0097621_100306935 3300006237 Bacteria 1403
95 Ga0068871_100118089 3300006358 Bacteria 2237
96 Ga0068871_100479250 3300006358 Bacteria 1119
97 Ga0075431_100069521 3300006847 Bacteria 3633
98 Ga0075431_100421412 3300006847 Bacteria 1334
99 Ga0068865_100036191 3300006881 Bacteria 3326
100 Ga0068865_100073533 3300006881 Bacteria 2431
101 Ga0097620_100009168 3300006931 Bacteria 9994
102 Ga0097620_100130477 3300006931 Bacteria 2584
103 Ga0097620_100302400 3300006931 Bacteria 1693
104 Ga0105244_10026657 3300009036 Bacteria 3124
105 Ga0105250_10079842 3300009092 Bacteria 1326
106 Ga0105240_10701032 3300009093 Bacteria 1105
107 Ga0111539_10000628 3300009094 Bacteria 45672
108 Ga0105245_10005395 3300009098 Bacteria 11235
109 Ga0105245_10337504 3300009098 Bacteria 1489
110 Ga0105245_10864639 3300009098 Bacteria 945
111 Ga0105247_10000011 3300009101 Bacteria 296480
112 Ga0105247_10108240 3300009101 Bacteria 1785
113 Ga0105247_10208722 3300009101 Bacteria 1316
114 Ga0114129_10000253 3300009147 Bacteria 60283
115 Ga0105243_10029602 3300009148 Bacteria 4211
116 Ga0105243_10088627 3300009148 Bacteria 2542
117 Ga0105241_10068822 3300009174 Bacteria 2744
118 Ga0105241_10201822 3300009174 Bacteria 1661
119 Ga0105242_10050564 3300009176 Bacteria 3384
120 Ga0105248_10000057 3300009177 Bacteria 138279
121 Ga0105248_10086889 3300009177 Bacteria 3519
122 Ga0105248_10123157 3300009177 Bacteria 2925
123 Ga0105237_10004906 3300009545 Bacteria 15308
124 Ga0105237_10340317 3300009545 Bacteria 1505
125 Ga0105238_10125053 3300009551 Bacteria 2551
126 Ga0105249_10000088 3300009553 Bacteria 131228
127 Ga0105249_10061488 3300009553 Bacteria 3446
128 Ga0105239_10050726 3300010375 Bacteria 4550
129 Ga0105246_10016315 3300011119 Bacteria 4702
130 Ga0157370_10418881 3300013104 Bacteria 1232
131 Ga0157369_10170753 3300013105 Bacteria 2291
132 Ga0157374_10102907 3300013296 Bacteria 2739
133 Ga0157378_10612690 3300013297 Bacteria 1101
134 Ga0163162_10083250 3300013306 Bacteria 3273
135 Ga0163162_10085394 3300013306 Bacteria 3233
136 Ga0163162_10787165 3300013306 Bacteria 1069
137 Ga0157375_10046950 3300013308 Bacteria 4214
138 Ga0163163_10038432 3300014325 Bacteria 4665
139 Ga0157380_10028903 3300014326 Bacteria 4233
140 Ga0157380_10120760 3300014326 Bacteria 2219
141 Ga0157377_10014153 3300014745 Bacteria 4054
142 Ga0157377_10020867 3300014745 Bacteria 3438
143 Ga0157377_10131441 3300014745 Bacteria 1529
144 Ga0157379_10078531 3300014968 Bacteria 2956
145 Ga0163161_10043128 3300017792 Bacteria 3248
146 Ga0209673_1004730 3300025273 Bacteria 7164
147 Ga0209051_1001740 3300025303 Bacteria 17360
148 Ga0209051_1027449 3300025303 Bacteria 2268
149 Ga0207692_10005307 3300025898 Bacteria 5154
150 Ga0207710_10000067 3300025900 Bacteria 153244
151 Ga0207710_10071867 3300025900 Bacteria 1588
152 Ga0207688_10004547 3300025901 Bacteria 7553
153 Ga0207688_10009075 3300025901 Bacteria 5413
154 Ga0207647_10246218 3300025904 Bacteria 1026
155 Ga0207685_10145986 3300025905 Bacteria 1066
156 Ga0207645_10019759 3300025907 Bacteria 4413
157 Ga0207645_10021513 3300025907 Bacteria 4205
158 Ga0207645_10093326 3300025907 Bacteria 1936
159 Ga0207671_10009484 3300025914 Bacteria 8130
160 Ga0207671_10070028 3300025914 Bacteria 2614
161 Ga0207693_10013494 3300025915 Bacteria 6585
162 Ga0207660_10220432 3300025917 Bacteria 1488
163 Ga0207649_10215865 3300025920 Bacteria 1364
164 Ga0207649_10358896 3300025920 Bacteria 1081
165 Ga0207681_10003118 3300025923 Bacteria 10425
166 Ga0207659_10004322 3300025926 Bacteria 8591
167 Ga0207687_10017283 3300025927 Bacteria 4747
168 Ga0207687_10496983 3300025927 Bacteria 1018
169 Ga0207664_10309499 3300025929 Bacteria 1391
170 Ga0207644_10215191 3300025931 Bacteria 1521
171 Ga0207690_10014269 3300025932 Bacteria 4797
172 Ga0207706_10054747 3300025933 Bacteria 3520
173 Ga0207706_10113970 3300025933 Bacteria 2378
174 Ga0207706_10121686 3300025933 Bacteria 2295
175 Ga0207669_10179991 3300025937 Bacteria 1514
176 Ga0207704_10018809 3300025938 Bacteria 3615
177 Ga0207704_10032795 3300025938 Bacteria 2945
178 Ga0207665_10040856 3300025939 Bacteria 3095
179 Ga0207665_10044187 3300025939 Bacteria 2981
180 Ga0207691_10096874 3300025940 Bacteria 2637
181 Ga0207691_10174094 3300025940 Bacteria 1883
182 Ga0207711_10000588 3300025941 Bacteria 36824
183 Ga0207711_10188263 3300025941 Bacteria 1880
184 Ga0207711_10265318 3300025941 Bacteria 1579
185 Ga0207689_10005253 3300025942 Bacteria 11618
186 Ga0207689_10096258 3300025942 Bacteria 2431
187 Ga0207661_10003148 3300025944 Bacteria 11444
188 Ga0207679_10037820 3300025945 Bacteria 3434
189 Ga0207679_10204315 3300025945 Bacteria 1652
190 Ga0207679_10447655 3300025945 Bacteria 1145
191 Ga0207712_10000064 3300025961 Bacteria 132823
192 Ga0207712_10267676 3300025961 Bacteria 1389
193 Ga0207668_10000447 3300025972 Bacteria 26094
194 Ga0207668_10395538 3300025972 Bacteria 1167
195 Ga0207658_10000202 3300025986 Bacteria 62309
196 Ga0207677_10027576 3300026023 Bacteria 3580
197 Ga0207703_10301504 3300026035 Bacteria 1461
198 Ga0207703_10363532 3300026035 Bacteria 1335
199 Ga0207678_10178336 3300026067 Bacteria 1814
200 Ga0207708_10012703 3300026075 Bacteria 6279
201 Ga0207708_10014203 3300026075 Bacteria 5955
202 Ga0207708_10020531 3300026075 Bacteria 4982
203 Ga0207702_10192207 3300026078 Bacteria 1887
204 Ga0207641_10036582 3300026088 Bacteria 4098
205 Ga0207641_10128425 3300026088 Bacteria 2273
206 Ga0207648_10002242 3300026089 Bacteria 20936
207 Ga0207674_10035046 3300026116 Bacteria 5239
208 Ga0207675_100030074 3300026118 Bacteria 5057
209 Ga0207683_10225136 3300026121 Bacteria 1710
210 Ga0207683_10341385 3300026121 Bacteria 1374
211 Ga0268266_10026632 3300028379 Bacteria 4920
212 Ga0268266_10028548 3300028379 Bacteria 4741
213 Ga0268266_10059107 3300028379 Bacteria 3303
214 Ga0268265_10000005 3300028380 Bacteria 535350
215 Ga0268264_10000148 3300028381 Bacteria 164719
216 Ga0268264_10161132 3300028381 Bacteria 2021
217 Ga0307508_10055359 3300031616 Bacteria 3514
218 Ga0316576_10083774 3300031727 Bacteria 2369
219 Ga0307405_10396796 3300031731 Bacteria 1079
220 Ga0307413_10212649 3300031824 Bacteria 1406
221 Ga0307406_10056902 3300031901 Bacteria 2507
222 Ga0307409_100087088 3300031995 Bacteria 2544
223 Ga0307416_100277225 3300032002 Bacteria 1651
224 Ga0307411_10073077 3300032005 Bacteria 2331
225 Ga0307415_100005327 3300032126 Bacteria 6814
226 Ga0307415_100067027 3300032126 Bacteria 2507
227 Ga0307415_100070862 3300032126 Bacteria 2449
228 Ga0307507_10143465 3300033179 Bacteria 1822
229 Ga0373959_0012135 3300034820 Bacteria 1534
230 Ga0373929_0042984 3300035085 Bacteria 1010
231 Ga0373932_0024186 3300035112 Bacteria 1633
232 Ga0373941_0039980 3300035115 Bacteria 1444
233 Ga0373946_0213993 3300035171 Bacteria 928
234 Ga0316574_0002600 3300035398 Bacteria 9098
235 Ga0316574_0083000 3300035398 Bacteria 2037
236 Ga0373935_0293843 3300035692 Bacteria 1147
237 Ga0316584_0054521 3300036712 Bacteria 2992
238 Ga0373925_0664972 3300037068 Bacteria 859
239 Ga0466957_0067657 3300044842 Bacteria 2204
240 Ga0495603_0036830 3300046455 Bacteria 2936
241 Ga0495629_0015958 3300046459 Bacteria 5397
242 Ga0495638_0002120 3300046460 Bacteria 16730
243 Ga0495638_0021490 3300046460 Bacteria 4251
244 Ga0495641_0033235 3300046461 Bacteria 2450
245 Ga0495582_0124616 3300046473 Bacteria 1453
246 Ga0495662_0161098 3300046476 Bacteria 1105
247 Ga0495594_0261969 3300046499 Bacteria 985
248 Ga0495648_0012995 3300046524 Bacteria 6180
249 Ga0495663_0012410 3300046525 Bacteria 2374
250 Ga0495666_0151047 3300046526 Bacteria 1080
251 Ga0495665_0075763 3300046531 Bacteria 1771
252 Ga0495668_0023159 3300046616 Bacteria 3544
253 Ga0495611_0096793 3300046648 Bacteria 1367
254 Ga0495659_0049037 3300046664 Bacteria 1532
255 Ga0495658_0053878 3300046683 Bacteria 2286
256 Ga0495581_0031385 3300047315 Bacteria 3079
257 Ga0495674_0014513 3300047319 Bacteria 7371
258 Ga0495672_0015539 3300047320 Bacteria 5163
259 Ga0495673_0008781 3300047469 Bacteria 5643
260 Ga0495614_0092965 3300048089 Bacteria 1313
261 Ga0496100_0086993 3300048903 Bacteria 2124
262 Ga0496100_0131560 3300048903 Bacteria 1763
263 Ga0496101_0000021 3300048904 Bacteria 217090
264 Ga0496101_0011630 3300048904 Bacteria 5846
265 Ga0496101_0016259 3300048904 Bacteria 5022
266 Ga0496102_0000001 3300048905 Bacteria 873433
267 Ga0496102_0000754 3300048905 Bacteria 31639
268 Ga0496102_0028440 3300048905 Bacteria 4993
269 Ga0496102_0162646 3300048905 Bacteria 2100
270 Ga0496103_0000007 3300048906 Bacteria 354915
271 Ga0496103_0001041 3300048906 Bacteria 19427
272 Ga0496103_0081997 3300048906 Bacteria 2029
273 Ga0496104_0231679 3300048907 Bacteria 1759
274 Ga0496104_0339036 3300048907 Bacteria 1416
275 Ga0496106_0005783 3300048909 Bacteria 9146
276 Ga0496106_0020483 3300048909 Bacteria 4908
277 Ga0496107_0023605 3300048910 Bacteria 4349
278 Ga0496108_0015297 3300048911 Bacteria 6260
279 Ga0496109_0004185 3300048912 Bacteria 12038
280 Ga0496109_0007917 3300048912 Bacteria 9006
281 Ga0496110_0020578 3300048913 Bacteria 5573
282 Ga0496112_0133209 3300048915 Bacteria 2456
283 Ga0496112_0338197 3300048915 Bacteria 1449
284 Ga0496113_0098805 3300048916 Bacteria 2260
285 Ga0496114_0108858 3300048917 Bacteria 2372
286 Ga0496116_0000018 3300048919 Bacteria 545877
287 Ga0496116_0006380 3300048919 Bacteria 10718
288 Ga0496116_0066579 3300048919 Bacteria 2304
289 Ga0496117_0000015 3300048920 Bacteria 583316
290 Ga0496117_0008266 3300048920 Bacteria 9908
291 Ga0496118_0000012 3300048921 Bacteria 583316
292 Ga0496118_0001547 3300048921 Bacteria 34200
293 Ga0496119_0002902 3300048922 Bacteria 18297
294 Ga0496119_0035364 3300048922 Bacteria 3274
295 Ga0496119_0041472 3300048922 Bacteria 2930
296 Ga0496120_0000922 3300048923 Bacteria 40777
297 Ga0496120_0010873 3300048923 Bacteria 6299
298 Ga0496120_0038219 3300048923 Bacteria 2841
299 Ga0496121_0000809 3300048924 Bacteria 56983
300 Ga0496121_0010510 3300048924 Bacteria 10426
301 Ga0496122_0000065 3300048925 Bacteria 235242
302 Ga0496123_0000006 3300048926 Bacteria 647258
303 Ga0496124_0042909 3300048927 Bacteria 3890
304 Ga0496124_0224079 3300048927 Bacteria 1412
305 Ga0496125_0094587 3300048928 Bacteria 2225
306 Ga0496125_0199938 3300048928 Bacteria 1309
307 Ga0496126_0002555 3300048929 Bacteria 24367
308 Ga0496126_0007650 3300048929 Bacteria 11791
309 Ga0501031_0172972 3300049568 Bacteria 1411
310 Ga0501034_0011481 3300049571 Bacteria 9180
311 Ga0501034_0117222 3300049571 Bacteria 2650
312 Ga0501034_0178996 3300049571 Bacteria 2086
313 Ga0501036_0033124 3300049572 Bacteria 4370
314 Ga0501037_0018849 3300049573 Bacteria 5085
315 Ga0501038_0037303 3300049574 Bacteria 4261
316 Ga0501039_0104482 3300049575 Bacteria 2211
317 Ga0501043_0307157 3300049579 Bacteria 1211
318 Ga0501047_0025881 3300049581 Bacteria 5642
319 Ga0501074_0043991 3300049590 Bacteria 3233
320 Ga0501035_0027056 3300049822 Bacteria 5244
321 Ga0501044_0005668 3300049823 Bacteria 13845
322 Ga0501045_0197898 3300049824 Bacteria 1497
323 nmdc:mga0yw44_138303_c1 3300050492 Bacteria 1581
324 nmdc:mga05p37_1154_c1 3300050507 Bacteria 30444
325 nmdc:mga09592_497738_c1 3300050508 Bacteria 1049
326 nmdc:mga08y16_563666_c1 3300050511 Bacteria 1152
327 nmdc:mga0sz30_11332_c1 3300050516 Bacteria 3440
328 nmdc:mga0sz30_126409_c1 3300050516 Bacteria 1125
329 nmdc:mga0sz30_31070_c1 3300050516 Bacteria 2209
330 Ga0500635_0004293 3300053080 Bacteria 3663
331 Ga0495655_0047246 3300053083 Bacteria 1126
332 Ga0500643_006228 3300053087 Bacteria 5015
333 Ga0500646_0000891 3300053090 Bacteria 8244
334 Ga0500583_0057883 3300053092 Bacteria 1821
335 Ga0500556_0016584 3300053104 Bacteria 2293
336 Ga0500562_003113 3300053108 Bacteria 4141
337 Ga0500652_001411 3300053131 Bacteria 7470
338 Ga0500559_0024697 3300053136 Bacteria 2558
339 Ga0500588_0062737 3300053146 Bacteria 1196
340 Ga0500604_0057435 3300053151 Bacteria 1215
341 Ga0500616_0035063 3300053153 Bacteria 2730
342 Ga0500627_0023978 3300053158 Bacteria 2491
343 Ga0500645_000056 3300053730 Bacteria 92126
344 Ga0500645_028319 3300053730 Bacteria 1696
345 Ga0501082_0004890 3300060353 Bacteria 11689
346 Ga0530510_0063861 3300061734 Bacteria 2666
347 2645723895 2643221962 Bacteria 3874254
348 2676487366 2675903059 Bacteria 8644972
349 2738706327 2738541274 Bacteria 6909446
350 2739328816 2738543028 Bacteria 6917070
351 2774379480 2773857758 Bacteria 3592392
352 2832008540 2832004796 Bacteria 6538017
353 2866065332 2866065130 Bacteria 6518152
354 2867508628 2867507094 Bacteria 6506033
355 2902795002 2902792274 Bacteria 7270173
356 2904512242 2904509784 Bacteria 3520416
357 2908679499 2908678064 Bacteria 3482747
358 2919070138 2919069694 Bacteria 3622919
359 2929217877 2929212328 Bacteria 7708288
360 2974295527 2974294766 Bacteria 3767688
361 2974324669 2974324384 Bacteria 3750535
362 2977229697 2977228692 Bacteria 3450105
363 2977238253 2977236895 Bacteria 3569373
364 2984543965 2984542743 Bacteria 3569378
365 8001788111 8001781756 Bacteria 9586736
366 8047716245 8047710418 Bacteria 11023148
367 Ga0075369_10060147
368 JGI24735J21928_10073857
369 JGI24738J21930_10026453
370 JGI24744J21845_10020568
371 JGI24742J22300_10005783
372 Ga0055540_1001316
373 Ga0070676_10014031
374 Ga0070676_10020291
375 Ga0070683_100011100
376 Ga0070683_100040179
377 Ga0070670_100135012
378 Ga0068869_100010755
379 Ga0068869_100037991
380 Ga0068869_100205687
381 Ga0070666_10061561
382 Ga0070666_10144483
383 Ga0070682_100024282
384 Ga0068868_100013566
385 Ga0068868_100029228
386 Ga0070660_100239995
387 Ga0070689_100350842
388 Ga0070692_10051300
389 Ga0070668_100127992
390 Ga0070669_100129440
391 Ga0070675_100006430
392 Ga0070674_100022827
393 Ga0070674_100354251
394 Ga0070673_100373546
395 Ga0070688_100081246
396 Ga0070659_100039242
397 Ga0070667_100000048
398 Ga0070667_100043631
399 Ga0070667_100146583
400 Ga0070703_10006493
401 Ga0070709_10048908
402 Ga0070714_100590889
403 Ga0070701_10006385
404 Ga0070711_100011199
405 Ga0070705_100031261
406 Ga0070700_100006024
407 Ga0070700_100046667
408 Ga0070694_100286544
409 Ga0070663_100009388
410 Ga0070663_100227748
411 Ga0070678_100071139
412 Ga0070678_100265040
413 Ga0070662_100014363
414 Ga0070662_100057138
415 Ga0068867_100092680
416 Ga0070685_10055608
417 Ga0070684_100003350
418 Ga0070684_100078165
419 Ga0068853_100100029
420 Ga0070672_100145110
421 Ga0070672_100221634
422 Ga0070696_100015809
423 Ga0070693_100010681
424 Ga0070693_100302429
425 Ga0070665_100027616
426 Ga0070665_100040666
427 Ga0070665_100281250
428 Ga0070704_100336542
429 Ga0068855_100590458
430 Ga0070664_100017215
431 Ga0070664_100187473
432 Ga0068857_100109699
433 Ga0068854_100046483
434 Ga0068856_100087756
435 Ga0068856_100281452
436 Ga0070702_100057867
437 Ga0068852_100016825
438 Ga0068852_100064483
439 Ga0068859_100009170
440 Ga0068859_100130472
441 Ga0068859_100302389
442 Ga0068851_10104648
443 Ga0068863_100000176
444 Ga0068863_100294690
445 Ga0068858_100033419
446 Ga0068858_100056111
447 Ga0068860_100000225
448 Ga0068862_100000018
449 Ga0068862_100072979
450 Ga0068862_100284115
451 Ga0081539_10111322
452 Ga0075365_10044684
453 Ga0075365_10311546
454 Ga0070712_100016303
455 Ga0070712_100024138
456 Ga0070712_100107387
457 Ga0075362_10075531
458 Ga0075369_10006596
459 Ga0075369_10012692
460 Ga0097621_100306935
461 Ga0068871_100118089
462 Ga0068871_100479250
463 Ga0075431_100069521
464 Ga0075431_100421412
465 Ga0068865_100036191
466 Ga0068865_100073533
467 Ga0097620_100009168
468 Ga0097620_100130477
469 Ga0097620_100302400
470 Ga0105244_10026657
471 Ga0105250_10079842
472 Ga0105240_10701032
473 Ga0111539_10000628
474 Ga0105245_10005395
475 Ga0105245_10337504
476 Ga0105245_10864639
477 Ga0105247_10000011
478 Ga0105247_10108240
479 Ga0105247_10208722
480 Ga0114129_10000253
481 Ga0105243_10029602
482 Ga0105243_10088627
483 Ga0105241_10068822
484 Ga0105241_10201822
485 Ga0105242_10050564
486 Ga0105248_10000057
487 Ga0105248_10086889
488 Ga0105248_10123157
489 Ga0105237_10004906
490 Ga0105237_10340317
491 Ga0105238_10125053
492 Ga0105249_10000088
493 Ga0105249_10061488
494 Ga0105239_10050726
495 Ga0105246_10016315
496 Ga0157370_10418881
497 Ga0157369_10170753
498 Ga0157374_10102907
499 Ga0157378_10612690
500 Ga0163162_10083250
501 Ga0163162_10085394
502 Ga0163162_10787165
503 Ga0157375_10046950
504 Ga0163163_10038432
505 Ga0157380_10028903
506 Ga0157380_10120760
507 Ga0157377_10014153
508 Ga0157377_10020867
509 Ga0157377_10131441
510 Ga0157379_10078531
511 Ga0163161_10043128
512 Ga0209673_1004730
513 Ga0209051_1001740
514 Ga0209051_1027449
515 Ga0207692_10005307
516 Ga0207710_10000067
517 Ga0207710_10071867
518 Ga0207688_10004547
519 Ga0207688_10009075
520 Ga0207647_10246218
521 Ga0207685_10145986
522 Ga0207645_10019759
523 Ga0207645_10021513
524 Ga0207645_10093326
525 Ga0207671_10009484
526 Ga0207671_10070028
527 Ga0207693_10013494
528 Ga0207660_10220432
529 Ga0207649_10215865
530 Ga0207649_10358896
531 Ga0207681_10003118
532 Ga0207659_10004322
533 Ga0207687_10017283
534 Ga0207687_10496983
535 Ga0207664_10309499
536 Ga0207644_10215191
537 Ga0207690_10014269
538 Ga0207706_10054747
539 Ga0207706_10113970
540 Ga0207706_10121686
541 Ga0207669_10179991
542 Ga0207704_10018809
543 Ga0207704_10032795
544 Ga0207665_10040856
545 Ga0207665_10044187
546 Ga0207691_10096874
547 Ga0207691_10174094
548 Ga0207711_10000588
549 Ga0207711_10188263
550 Ga0207711_10265318
551 Ga0207689_10005253
552 Ga0207689_10096258
553 Ga0207661_10003148
554 Ga0207679_10037820
555 Ga0207679_10204315
556 Ga0207679_10447655
557 Ga0207712_10000064
558 Ga0207712_10267676
559 Ga0207668_10000447
560 Ga0207668_10395538
561 Ga0207658_10000202
562 Ga0207677_10027576
563 Ga0207703_10301504
564 Ga0207703_10363532
565 Ga0207678_10178336
566 Ga0207708_10012703
567 Ga0207708_10014203
568 Ga0207708_10020531
569 Ga0207702_10192207
570 Ga0207641_10036582
571 Ga0207641_10128425
572 Ga0207648_10002242
573 Ga0207674_10035046
574 Ga0207675_100030074
575 Ga0207683_10225136
576 Ga0207683_10341385
577 Ga0268266_10026632
578 Ga0268266_10028548
579 Ga0268266_10059107
580 Ga0268265_10000005
581 Ga0268264_10000148
582 Ga0268264_10161132
583 Ga0307508_10055359
584 Ga0316576_10083774
585 Ga0307405_10396796
586 Ga0307413_10212649
587 Ga0307406_10056902
588 Ga0307409_100087088
589 Ga0307416_100277225
590 Ga0307411_10073077
591 Ga0307415_100005327
592 Ga0307415_100067027
593 Ga0307415_100070862
594 Ga0307507_10143465
595 Ga0373959_0012135
596 Ga0373929_0042984
597 Ga0373932_0024186
598 Ga0373941_0039980
599 Ga0373946_0213993
600 Ga0316574_0002600
601 Ga0316574_0083000
602 Ga0373935_0293843
603 Ga0316584_0054521
604 Ga0373925_0664972
605 Ga0466957_0067657
606 Ga0495603_0036830
607 Ga0495629_0015958
608 Ga0495638_0002120
609 Ga0495638_0021490
610 Ga0495641_0033235
611 Ga0495582_0124616
612 Ga0495662_0161098
613 Ga0495594_0261969
614 Ga0495648_0012995
615 Ga0495663_0012410
616 Ga0495666_0151047
617 Ga0495665_0075763
618 Ga0495668_0023159
619 Ga0495611_0096793
620 Ga0495659_0049037
621 Ga0495658_0053878
622 Ga0495581_0031385
623 Ga0495674_0014513
624 Ga0495672_0015539
625 Ga0495673_0008781
626 Ga0495614_0092965
627 Ga0496100_0086993
628 Ga0496100_0131560
629 Ga0496101_0000021
630 Ga0496101_0011630
631 Ga0496101_0016259
632 Ga0496102_0000001
633 Ga0496102_0000754
634 Ga0496102_0028440
635 Ga0496102_0162646
636 Ga0496103_0000007
637 Ga0496103_0001041
638 Ga0496103_0081997
639 Ga0496104_0231679
640 Ga0496104_0339036
641 Ga0496106_0005783
642 Ga0496106_0020483
643 Ga0496107_0023605
644 Ga0496108_0015297
645 Ga0496109_0004185
646 Ga0496109_0007917
647 Ga0496110_0020578
648 Ga0496112_0133209
649 Ga0496112_0338197
650 Ga0496113_0098805
651 Ga0496114_0108858
652 Ga0496116_0000018
653 Ga0496116_0006380
654 Ga0496116_0066579
655 Ga0496117_0000015
656 Ga0496117_0008266
657 Ga0496118_0000012
658 Ga0496118_0001547
659 Ga0496119_0002902
660 Ga0496119_0035364
661 Ga0496119_0041472
662 Ga0496120_0000922
663 Ga0496120_0010873
664 Ga0496120_0038219
665 Ga0496121_0000809
666 Ga0496121_0010510
667 Ga0496122_0000065
668 Ga0496123_0000006
669 Ga0496124_0042909
670 Ga0496124_0224079
671 Ga0496125_0094587
672 Ga0496125_0199938
673 Ga0496126_0002555
674 Ga0496126_0007650
675 Ga0501031_0172972
676 Ga0501034_0011481
677 Ga0501034_0117222
678 Ga0501034_0178996
679 Ga0501036_0033124
680 Ga0501037_0018849
681 Ga0501038_0037303
682 Ga0501039_0104482
683 Ga0501043_0307157
684 Ga0501047_0025881
685 Ga0501074_0043991
686 Ga0501035_0027056
687 Ga0501044_0005668
688 Ga0501045_0197898
689 nmdc:mga0yw44_138303_c1
690 nmdc:mga05p37_1154_c1
691 nmdc:mga09592_497738_c1
692 nmdc:mga08y16_563666_c1
693 nmdc:mga0sz30_11332_c1
694 nmdc:mga0sz30_126409_c1
695 nmdc:mga0sz30_31070_c1
696 Ga0500635_0004293
697 Ga0495655_0047246
698 Ga0500643_006228
699 Ga0500646_0000891
700 Ga0500583_0057883
701 Ga0500556_0016584
702 Ga0500562_003113
703 Ga0500652_001411
704 Ga0500559_0024697
705 Ga0500588_0062737
706 Ga0500604_0057435
707 Ga0500616_0035063
708 Ga0500627_0023978
709 Ga0500645_000056
710 Ga0500645_028319
711 Ga0501082_0004890
712 Ga0530510_0063861
713 2645723895
714 2676487366
715 2738706327
716 2739328816
717 2774379480
718 2832008540
719 2866065332
720 2867508628
721 2902795002
722 2904512242
723 2908679499
724 2919070138
725 2929217877
726 2974295527
727 2974324669
728 2977229697
729 2977238253
730 2984543965
731 8001788111
732 8047716245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

70

295

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpm-assembly1.cif.gz_A crystal structure of domain 2 from tmargbp 0.8795 147 231
6gpm-assembly1.cif.gz_A crystal structure of domain 2 from tmargbp 0.8097 147 231
6xks-assembly3.cif.gz_C crystal structure of domain a from the periplasmic lysine-, arginine-, ornithine-binding protein (lao) of salmonella typhimurium 0.7698 54 278
6xks-assembly3.cif.gz_C crystal structure of domain a from the periplasmic lysine-, arginine-, ornithine-binding protein (lao) of salmonella typhimurium 0.7259 54 278
4oen-assembly1.cif.gz_A crystal structure of the second substrate binding domain of a putative amino acid abc transporter from streptococcus pneumoniae canada mdr_19a 0.6738 58 279
ID Description Score Start End Superfamily
1iiwA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8913 147 230 3.40.190.10
af_P96257_184_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8739 148 232 3.40.190.10
2q2aC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8703 146 231 3.40.190.10
4i62A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8511 148 230 3.40.190.10
2pyyC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8467 58 278 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6L6EEB6-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9104 36 124
AF-A0A7K0LKG2-F1-model_v4 Transporter substrate-binding domain-containing protein 0.8834 5 289
AF-A0A316GE79-F1-model_v4 Amino acid ABC transporter substrate-binding protein (PAAT family) 0.8829 24 289
AF-A0A7K0LKG2-F1-model_v4 Transporter substrate-binding domain-containing protein 0.8773 5 289
AF-A0A316GE79-F1-model_v4 Amino acid ABC transporter substrate-binding protein (PAAT family) 0.8639 24 289

Map