F423952

General Info

Members Datasets Scaffolds Average Seq Length
366 195 365 110

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100868297|Ga0070693_1008682971
Length 135
Sequence VPFVLIKKTFGFLELIVILRCNDEIMGLTKSEIFTDKQNRLAGMMKALAHPARIAIVQHLIKTNACINGDLVEELGLAQPTISQHLKELKNAGLIQGTIEGTSVCYCIEPKAWALYQKEIGALFAAYKGGEGCCG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
182 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
187 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
188 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.64
Nodule 0.55
Rhizoplane 1.64
Rhizosphere 90.44
Stem 0
Stem Tuber 0
Unclassified 2.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10061908 3300003316 Bacteria 8102
2 rootH2_10010515 3300003320 Bacteria 12220
3 rootH1_10146267 3300003323 Bacteria 3771
4 rootH1_10341668 3300003323 Bacteria 2230
5 Ga0065714_10094604 3300005288 Bacteria 1811
6 Ga0065715_11057349 3300005293 Bacteria 530
7 Ga0070658_10042691 3300005327 Bacteria 3663
8 Ga0070658_11833707 3300005327 Bacteria 524
9 Ga0070676_10034971 3300005328 Bacteria 2887
10 Ga0070683_100048314 3300005329 Bacteria 3934
11 Ga0070683_101345706 3300005329 Bacteria 686
12 Ga0070690_101604879 3300005330 Unclassified 527
13 Ga0068869_100044118 3300005334 Bacteria 3206
14 Ga0068869_100193801 3300005334 Unclassified 1599
15 Ga0070666_10002979 3300005335 Bacteria 10267
16 Ga0070666_10229944 3300005335 Bacteria 1309
17 Ga0068868_100016312 3300005338 Bacteria 5513
18 Ga0068868_101541889 3300005338 Unclassified 623
19 Ga0070691_10177336 3300005341 Bacteria 1107
20 Ga0070668_100034157 3300005347 Bacteria 3875
21 Ga0070675_100243326 3300005354 Unclassified 1572
22 Ga0070674_100126815 3300005356 Bacteria 1897
23 Ga0070673_100012995 3300005364 Bacteria 5742
24 Ga0070688_100262264 3300005365 Bacteria 1234
25 Ga0070659_100114084 3300005366 Unclassified 2183
26 Ga0070659_100487844 3300005366 Bacteria 1049
27 Ga0070667_100007158 3300005367 Bacteria 9270
28 Ga0070667_100490588 3300005367 Bacteria 1125
29 Ga0070711_101504284 3300005439 Bacteria 587
30 Ga0070711_101625109 3300005439 Unclassified 565
31 Ga0070663_100847618 3300005455 Unclassified 786
32 Ga0070662_100099135 3300005457 Bacteria 2202
33 Ga0068867_100003587 3300005459 Bacteria 10916
34 Ga0070685_10007381 3300005466 Bacteria 5622
35 Ga0070684_100006927 3300005535 Bacteria 8806
36 Ga0068853_100000587 3300005539 Bacteria 24911
37 Ga0068853_100020621 3300005539 Bacteria 5481
38 Ga0068853_100037849 3300005539 Bacteria 4107
39 Ga0068853_100335384 3300005539 Bacteria 1404
40 Ga0068853_100475653 3300005539 Bacteria 1177
41 Ga0068853_100890077 3300005539 Bacteria 855
42 Ga0068853_102343219 3300005539 Bacteria 517
43 Ga0070672_100364721 3300005543 Bacteria 1233
44 Ga0070693_100238310 3300005547 Bacteria 1200
45 Ga0070693_100868297 3300005547 Bacteria 674
46 Ga0070665_100000189 3300005548 Bacteria 109948
47 Ga0070665_100023780 3300005548 Bacteria 6172
48 Ga0068855_100048040 3300005563 Bacteria 5038
49 Ga0068855_100099459 3300005563 Bacteria 3350
50 Ga0068855_100559712 3300005563 Unclassified 1237
51 Ga0068855_102528087 3300005563 Bacteria 510
52 Ga0070664_100158950 3300005564 Bacteria 1998
53 Ga0068857_100000317 3300005577 Bacteria 33272
54 Ga0068854_100042028 3300005578 Bacteria 3233
55 Ga0068854_100060467 3300005578 Bacteria 2741
56 Ga0068854_100688453 3300005578 Unclassified 881
57 Ga0068856_100000104 3300005614 Bacteria 81872
58 Ga0068856_100011868 3300005614 Bacteria 8439
59 Ga0068856_100134736 3300005614 Bacteria 2475
60 Ga0068856_100409281 3300005614 Bacteria 1376
61 Ga0068852_100000982 3300005616 Bacteria 18761
62 Ga0068852_100119730 3300005616 Bacteria 2407
63 Ga0068852_100136005 3300005616 Bacteria 2269
64 Ga0068852_100154534 3300005616 Bacteria 2136
65 Ga0068852_100980948 3300005616 Bacteria 863
66 Ga0068864_100005927 3300005618 Bacteria 10018
67 Ga0068864_101007609 3300005618 Bacteria 826
68 Ga0068866_10650838 3300005718 Unclassified 717
69 Ga0068861_100067221 3300005719 Unclassified 2765
70 Ga0068851_10090476 3300005834 Bacteria 1610
71 Ga0068863_100196041 3300005841 Bacteria 1941
72 Ga0068858_100004728 3300005842 Bacteria 13335
73 Ga0068858_101434107 3300005842 Bacteria 680
74 Ga0068860_100000005 3300005843 Bacteria 472349
75 Ga0068860_100027661 3300005843 Bacteria 5460
76 Ga0068860_100051086 3300005843 Bacteria 3934
77 Ga0068862_100272658 3300005844 Bacteria 1548
78 Ga0081540_1016128 3300005983 Bacteria 4692
79 Ga0081540_1247854 3300005983 Unclassified 622
80 Ga0097621_100007509 3300006237 Bacteria 7804
81 Ga0097621_100425608 3300006237 Bacteria 1192
82 Ga0068871_101813128 3300006358 Bacteria 579
83 Ga0068865_100028645 3300006881 Unclassified 3689
84 Ga0099826_10058522 3300006948 Bacteria 2527
85 Ga0105240_10000023 3300009093 Bacteria 385028
86 Ga0105240_10000276 3300009093 Bacteria 101817
87 Ga0105240_10000833 3300009093 Bacteria 55556
88 Ga0105240_10002010 3300009093 Bacteria 33532
89 Ga0105240_10002592 3300009093 Bacteria 28936
90 Ga0105240_10020428 3300009093 Bacteria 8834
91 Ga0105240_10064502 3300009093 Unclassified 4551
92 Ga0105240_10128920 3300009093 Bacteria 3036
93 Ga0105240_10249307 3300009093 Unclassified 2054
94 Ga0105240_11422667 3300009093 Bacteria 728
95 Ga0105240_12434749 3300009093 Bacteria 542
96 Ga0105247_10007937 3300009101 Bacteria 6487
97 Ga0105243_10393902 3300009148 Unclassified 1285
98 Ga0105241_10006070 3300009174 Bacteria 8913
99 Ga0105241_10158659 3300009174 Bacteria 1857
100 Ga0105241_10410098 3300009174 Unclassified 1190
101 Ga0105241_10444444 3300009174 Bacteria 1146
102 Ga0105241_12619481 3300009174 Unclassified 507
103 Ga0105241_12619853 3300009174 Unclassified 507
104 Ga0105242_10025813 3300009176 Bacteria 4653
105 Ga0105242_10944310 3300009176 Bacteria 866
106 Ga0105248_10006702 3300009177 Bacteria 12632
107 Ga0105237_10006548 3300009545 Bacteria 12885
108 Ga0105237_10026390 3300009545 Bacteria 5937
109 Ga0105237_10228850 3300009545 Bacteria 1860
110 Ga0105237_10238527 3300009545 Bacteria 1819
111 Ga0105237_10246370 3300009545 Bacteria 1789
112 Ga0105238_10001751 3300009551 Bacteria 21779
113 Ga0105238_10016912 3300009551 Bacteria 7401
114 Ga0105238_10031339 3300009551 Bacteria 5412
115 Ga0105238_10515817 3300009551 Bacteria 1197
116 Ga0105238_10531330 3300009551 Unclassified 1179
117 Ga0105238_12619717 3300009551 Unclassified 540
118 Ga0105249_10113036 3300009553 Bacteria 2569
119 Ga0105249_10179296 3300009553 Bacteria 2060
120 Ga0099796_10517329 3300010159 Bacteria 535
121 Ga0105239_10000267 3300010375 Bacteria 77181
122 Ga0105239_10000433 3300010375 Bacteria 61072
123 Ga0105239_10001651 3300010375 Bacteria 29415
124 Ga0105239_10022970 3300010375 Bacteria 6877
125 Ga0105239_10038549 3300010375 Bacteria 5237
126 Ga0105239_10068134 3300010375 Bacteria 3911
127 Ga0105239_10173139 3300010375 Bacteria 2414
128 Ga0105239_10920405 3300010375 Archaea 1004
129 Ga0157373_11085852 3300013100 Bacteria 600
130 Ga0157370_10042373 3300013104 Bacteria 4387
131 Ga0157370_10217348 3300013104 Bacteria 1771
132 Ga0157370_11010957 3300013104 Bacteria 752
133 Ga0157369_10086766 3300013105 Bacteria 3342
134 Ga0157369_10299353 3300013105 Bacteria 1673
135 Ga0157369_10703063 3300013105 Bacteria 1041
136 Ga0157374_10000003 3300013296 Bacteria 854471
137 Ga0157374_10050351 3300013296 Bacteria 3871
138 Ga0157374_10055701 3300013296 Unclassified 3691
139 Ga0157374_10638329 3300013296 Bacteria 1076
140 Ga0157378_10032394 3300013297 Unclassified 4619
141 Ga0157378_10041607 3300013297 Bacteria 4076
142 Ga0157378_10109063 3300013297 Unclassified 2535
143 Ga0157378_11524809 3300013297 Unclassified 713
144 Ga0163162_10000459 3300013306 Bacteria 37749
145 Ga0163162_10001420 3300013306 Bacteria 22262
146 Ga0163162_10013639 3300013306 Bacteria 7940
147 Ga0163162_10041824 3300013306 Bacteria 4585
148 Ga0163162_10319150 3300013306 Bacteria 1686
149 Ga0163162_13150417 3300013306 Bacteria 529
150 Ga0157372_10007012 3300013307 Bacteria 12004
151 Ga0157372_10015962 3300013307 Bacteria 8055
152 Ga0157372_10046901 3300013307 Unclassified 4798
153 Ga0157372_10165526 3300013307 Bacteria 2557
154 Ga0157372_10813583 3300013307 Bacteria 1085
155 Ga0157372_11540641 3300013307 Bacteria 766
156 Ga0157372_13417859 3300013307 Unclassified 505
157 Ga0157375_10046366 3300013308 Unclassified 4237
158 Ga0157375_10104445 3300013308 Bacteria 2922
159 Ga0163163_10008368 3300014325 Bacteria 9185
160 Ga0163163_10217605 3300014325 Bacteria 1959
161 Ga0163163_10867730 3300014325 Bacteria 966
162 Ga0157379_10002403 3300014968 Bacteria 15642
163 Ga0157379_10246835 3300014968 Bacteria 1620
164 Ga0157376_10000580 3300014969 Bacteria 23607
165 Ga0157376_10035642 3300014969 Bacteria 4025
166 Ga0157376_10170778 3300014969 Unclassified 1980
167 Ga0157376_10378467 3300014969 Bacteria 1363
168 Ga0157376_11197005 3300014969 Bacteria 788
169 Ga0157376_11461732 3300014969 Bacteria 716
170 Ga0157376_12344799 3300014969 Bacteria 573
171 Ga0163161_10172193 3300017792 Bacteria 1656
172 Ga0163161_10770790 3300017792 Bacteria 806
173 Ga0207656_10618185 3300025321 Unclassified 553
174 Ga0207642_10541321 3300025899 Unclassified 718
175 Ga0207710_10120802 3300025900 Bacteria 1251
176 Ga0207688_10574437 3300025901 Bacteria 709
177 Ga0207680_10017113 3300025903 Bacteria 3823
178 Ga0207680_10285375 3300025903 Bacteria 1148
179 Ga0207680_10797593 3300025903 Bacteria 677
180 Ga0207647_10043755 3300025904 Bacteria 2800
181 Ga0207647_10089096 3300025904 Bacteria 1842
182 Ga0207645_10156852 3300025907 Bacteria 1487
183 Ga0207705_10032752 3300025909 Bacteria 3714
184 Ga0207705_10045407 3300025909 Bacteria 3157
185 Ga0207705_11429995 3300025909 Bacteria 525
186 Ga0207654_10069601 3300025911 Bacteria 2086
187 Ga0207654_10335143 3300025911 Bacteria 1038
188 Ga0207654_10414132 3300025911 Bacteria 939
189 Ga0207654_11416318 3300025911 Unclassified 507
190 Ga0207695_10000016 3300025913 Bacteria 771991
191 Ga0207695_10000184 3300025913 Bacteria 181201
192 Ga0207695_10000645 3300025913 Bacteria 69294
193 Ga0207695_10001186 3300025913 Bacteria 44969
194 Ga0207695_10046630 3300025913 Unclassified 4593
195 Ga0207695_10092837 3300025913 Unclassified 3028
196 Ga0207695_10195178 3300025913 Bacteria 1941
197 Ga0207695_10364844 3300025913 Bacteria 1331
198 Ga0207695_10661473 3300025913 Bacteria 925
199 Ga0207695_11003224 3300025913 Bacteria 715
200 Ga0207695_11708113 3300025913 Bacteria 510
201 Ga0207671_10012172 3300025914 Bacteria 6940
202 Ga0207671_10043367 3300025914 Unclassified 3326
203 Ga0207671_10323135 3300025914 Bacteria 1221
204 Ga0207671_10398112 3300025914 Bacteria 1095
205 Ga0207671_10521937 3300025914 Bacteria 947
206 Ga0207663_11294509 3300025916 Unclassified 587
207 Ga0207694_10013767 3300025924 Bacteria 6097
208 Ga0207694_10320890 3300025924 Bacteria 1278
209 Ga0207694_10709002 3300025924 Bacteria 849
210 Ga0207694_11288392 3300025924 Bacteria 618
211 Ga0207694_11298415 3300025924 Bacteria 615
212 Ga0207650_11340657 3300025925 Unclassified 609
213 Ga0207690_10079711 3300025932 Unclassified 2283
214 Ga0207690_10673846 3300025932 Unclassified 849
215 Ga0207706_10160084 3300025933 Bacteria 1979
216 Ga0207686_10312160 3300025934 Unclassified 1172
217 Ga0207709_11090722 3300025935 Bacteria 655
218 Ga0207669_10392814 3300025937 Bacteria 1084
219 Ga0207704_10004363 3300025938 Bacteria 6469
220 Ga0207691_10000596 3300025940 Bacteria 36065
221 Ga0207711_10052344 3300025941 Bacteria 3499
222 Ga0207689_10083897 3300025942 Bacteria 2619
223 Ga0207661_10064277 3300025944 Bacteria 2974
224 Ga0207679_10103466 3300025945 Bacteria 2231
225 Ga0207667_10001285 3300025949 Bacteria 31480
226 Ga0207667_10003030 3300025949 Bacteria 20857
227 Ga0207667_10080493 3300025949 Bacteria 3375
228 Ga0207651_10072565 3300025960 Bacteria 2444
229 Ga0207712_10394155 3300025961 Bacteria 1162
230 Ga0207668_10020118 3300025972 Unclassified 4233
231 Ga0207640_10056837 3300025981 Bacteria 2571
232 Ga0207658_10211215 3300025986 Bacteria 1626
233 Ga0207658_10429067 3300025986 Unclassified 1167
234 Ga0207677_10012236 3300026023 Bacteria 4924
235 Ga0207677_11277160 3300026023 Unclassified 674
236 Ga0207703_10076156 3300026035 Bacteria 2782
237 Ga0207703_11282225 3300026035 Bacteria 704
238 Ga0207639_10136021 3300026041 Bacteria 2041
239 Ga0207639_10185237 3300026041 Unclassified 1774
240 Ga0207639_10400827 3300026041 Bacteria 1236
241 Ga0207639_10413811 3300026041 Bacteria 1217
242 Ga0207639_10831757 3300026041 Bacteria 861
243 Ga0207639_11443129 3300026041 Bacteria 646
244 Ga0207678_10961880 3300026067 Unclassified 755
245 Ga0207702_10000119 3300026078 Bacteria 92653
246 Ga0207702_10008170 3300026078 Bacteria 8848
247 Ga0207702_10169685 3300026078 Bacteria 2000
248 Ga0207702_10404503 3300026078 Bacteria 1317
249 Ga0207641_10016996 3300026088 Bacteria 5956
250 Ga0207648_10002112 3300026089 Bacteria 21646
251 Ga0207676_10004151 3300026095 Bacteria 10229
252 Ga0207674_10001038 3300026116 Bacteria 36091
253 Ga0207675_100092089 3300026118 Bacteria 2851
254 Ga0207683_10094143 3300026121 Bacteria 2670
255 Ga0207698_10041632 3300026142 Bacteria 3425
256 Ga0207698_11104259 3300026142 Bacteria 806
257 Ga0207698_11762625 3300026142 Bacteria 634
258 Ga0209489_118780 3300027361 Bacteria 2567
259 Ga0268266_10000180 3300028379 Bacteria 112295
260 Ga0268266_10179953 3300028379 Bacteria 1924
261 Ga0268264_10000012 3300028381 Bacteria 521740
262 Ga0268264_10019504 3300028381 Bacteria 5540
263 Ga0268264_10051124 3300028381 Bacteria 3443
264 Ga0268264_10151017 3300028381 Bacteria 2082
265 Ga0307517_10014647 3300028786 Bacteria 10505
266 Ga0307517_10017476 3300028786 Bacteria 9348
267 Ga0307517_10362532 3300028786 Bacteria 782
268 Ga0307511_10151612 3300030521 Bacteria 1329
269 Ga0316576_10276593 3300031727 Bacteria 1258
270 Ga0307405_11962948 3300031731 Bacteria 523
271 Ga0316577_10096403 3300031733 Unclassified 1657
272 Ga0307413_10004024 3300031824 Bacteria 6320
273 Ga0307413_11329203 3300031824 Bacteria 630
274 Ga0307416_100009832 3300032002 Bacteria 6288
275 Ga0307414_10000001 3300032004 Bacteria 1352954
276 Ga0307414_10186876 3300032004 Bacteria 1672
277 Ga0307414_10370897 3300032004 Bacteria 1234
278 Ga0307414_10825552 3300032004 Bacteria 846
279 Ga0307411_10000001 3300032005 Bacteria 931810
280 Ga0316574_0510015 3300035398 Bacteria 749
281 Ga0373933_0924897 3300035724 Unclassified 574
282 Ga0373937_0192883 3300036401 Bacteria 1915
283 Ga0316582_0255266 3300036647 Bacteria 1202
284 Ga0316584_0060279 3300036712 Bacteria 2842
285 Ga0395905_0842414 3300037471 Unclassified 820
286 Ga0439466_0107207 3300041411 Bacteria 868
287 Ga0451807_1616836 3300041486 Bacteria 2538
288 Ga0451837_0405384 3300041494 Bacteria 1196
289 Ga0439445_0270689 3300042004 Unclassified 509
290 Ga0466969_0580018 3300044656 Unclassified 514
291 Ga0466972_0011885 3300044658 Bacteria 4373
292 Ga0466972_0275503 3300044658 Bacteria 786
293 Ga0466965_0765855 3300044683 Bacteria 557
294 Ga0466966_0111171 3300044684 Bacteria 1689
295 Ga0466961_0160299 3300044693 Bacteria 1402
296 Ga0466971_0041967 3300044719 Bacteria 2055
297 Ga0466968_0117531 3300044735 Unclassified 1201
298 Ga0466957_0950393 3300044842 Unclassified 616
299 Ga0466959_0001248 3300045049 Bacteria 15359
300 Ga0466959_0214757 3300045049 Bacteria 1336
301 Ga0466958_0932253 3300045836 Bacteria 566
302 Ga0466967_1535956 3300045976 Unclassified 663
303 Ga0495638_0033777 3300046460 Bacteria 3270
304 Ga0495638_0198801 3300046460 Bacteria 1133
305 Ga0495638_0522882 3300046460 Bacteria 594
306 Ga0495650_0000050 3300046471 Bacteria 318894
307 Ga0495606_0000036 3300046507 Bacteria 234596
308 Ga0495606_0019305 3300046507 Bacteria 5077
309 Ga0495610_0000167 3300046512 Bacteria 73458
310 Ga0495610_0001572 3300046512 Bacteria 20100
311 Ga0495616_0000271 3300046513 Bacteria 42005
312 Ga0495630_0386640 3300046517 Bacteria 1072
313 Ga0495648_0001914 3300046524 Bacteria 19837
314 Ga0495586_0512900 3300046535 Bacteria 692
315 Ga0495609_0005232 3300046538 Bacteria 6903
316 Ga0495645_0930075 3300046543 Unclassified 515
317 Ga0495633_0002805 3300046558 Bacteria 12052
318 Ga0495625_0000105 3300046660 Bacteria 126078
319 Ga0495635_0363430 3300046663 Bacteria 965
320 Ga0495661_0013486 3300046665 Bacteria 5487
321 Ga0495623_0500309 3300046679 Bacteria 642
322 Ga0495671_0096463 3300046692 Bacteria 1447
323 Ga0495649_0000011 3300046694 Bacteria 416695
324 Ga0495649_0457247 3300046694 Bacteria 637
325 Ga0495660_0036810 3300046810 Bacteria 2728
326 Ga0495660_0110152 3300046810 Bacteria 1406
327 Ga0495604_0866288 3300047317 Bacteria 566
328 Ga0495683_0070377 3300047323 Bacteria 1718
329 Ga0495683_0142663 3300047323 Bacteria 1121
330 Ga0495687_005139 3300047443 Bacteria 8471
331 Ga0495673_0104808 3300047469 Bacteria 1138
332 Ga0495686_0271201 3300047472 Bacteria 946
333 Ga0495686_0482355 3300047472 Bacteria 655
334 Ga0496104_0706740 3300048907 Bacteria 916
335 Ga0496104_1661811 3300048907 Unclassified 541
336 Ga0496115_0506934 3300048918 Bacteria 969
337 Ga0496115_0532752 3300048918 Bacteria 940
338 Ga0496115_0564604 3300048918 Unclassified 908
339 Ga0496120_0328233 3300048923 Bacteria 693
340 Ga0501038_1190600 3300049574 Bacteria 554
341 Ga0501072_1169481 3300049588 Bacteria 598
342 Ga0501249_002692 3300049679 Bacteria 3580
343 Ga0501080_0019659 3300049742 Bacteria 6256
344 Ga0501080_0144392 3300049742 Bacteria 2200
345 Ga0501266_000016 3300049763 Bacteria 164181
346 Ga0495619_0118540 3300053085 Bacteria 1814
347 Ga0495619_0407478 3300053085 Unclassified 939
348 Ga0500646_0001073 3300053090 Bacteria 7440
349 Ga0500646_0011392 3300053090 Unclassified 2288
350 Ga0500646_0075945 3300053090 Bacteria 1016
351 Ga0500583_0001438 3300053092 Bacteria 6829
352 Ga0500641_0000013 3300053096 Bacteria 156919
353 Ga0500594_0059325 3300053118 Bacteria 1099
354 Ga0500618_018512 3300053125 Bacteria 1722
355 Ga0500628_044649 3300053129 Bacteria 1027
356 Ga0500642_0120876 3300053130 Bacteria 1225
357 Ga0500568_0018087 3300053139 Bacteria 3094
358 Ga0500588_0413822 3300053146 Unclassified 514
359 Ga0500616_0004907 3300053153 Bacteria 9299
360 Ga0500622_0000686 3300053156 Bacteria 29937
361 Ga0500622_0099901 3300053156 Bacteria 1430
362 Ga0500636_0465122 3300053177 Bacteria 568
363 Ga0500637_0350081 3300053178 Unclassified 786
364 Ga0500645_094589 3300053730 Bacteria 846
365 Ga0466962_0090466 3300061719 Bacteria 1466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0275503 Ga0466972_0275503_83_412 108
2 3300003316 rootH1_10061908 rootH1_100619085 109
3 3300003320 rootH2_10010515 rootH2_100105157 109
4 3300003323 rootH1_10146267 rootH1_101462672 109
5 3300003323 rootH1_10341668 rootH1_103416682 109
6 3300005288 Ga0065714_10094604 Ga0065714_100946042 109
7 3300005293 Ga0065715_11057349 Ga0065715_110573491 109
8 3300005327 Ga0070658_10042691 Ga0070658_100426912 109
9 3300005327 Ga0070658_11833707 Ga0070658_118337071 109
10 3300005328 Ga0070676_10034971 Ga0070676_100349713 109
11 3300005329 Ga0070683_100048314 Ga0070683_1000483143 109
12 3300005329 Ga0070683_101345706 Ga0070683_1013457061 109
13 3300005330 Ga0070690_101604879 Ga0070690_1016048791 109
14 3300005334 Ga0068869_100044118 Ga0068869_1000441184 109
15 3300005334 Ga0068869_100193801 Ga0068869_1001938012 109
16 3300005335 Ga0070666_10002979 Ga0070666_100029797 109
17 3300005335 Ga0070666_10229944 Ga0070666_102299442 109
18 3300005338 Ga0068868_100016312 Ga0068868_1000163121 109
19 3300005338 Ga0068868_101541889 Ga0068868_1015418891 109
20 3300005341 Ga0070691_10177336 Ga0070691_101773361 109
21 3300005347 Ga0070668_100034157 Ga0070668_1000341574 109
22 3300005354 Ga0070675_100243326 Ga0070675_1002433262 109
23 3300005356 Ga0070674_100126815 Ga0070674_1001268153 109
24 3300005364 Ga0070673_100012995 Ga0070673_1000129953 109
25 3300005365 Ga0070688_100262264 Ga0070688_1002622642 109
26 3300005366 Ga0070659_100114084 Ga0070659_1001140845 109
27 3300005366 Ga0070659_100487844 Ga0070659_1004878441 109
28 3300005367 Ga0070667_100007158 Ga0070667_1000071585 109
29 3300005367 Ga0070667_100490588 Ga0070667_1004905882 109
30 3300005439 Ga0070711_101504284 Ga0070711_1015042841 109
31 3300005439 Ga0070711_101625109 Ga0070711_1016251091 109
32 3300005455 Ga0070663_100847618 Ga0070663_1008476181 109
33 3300005457 Ga0070662_100099135 Ga0070662_1000991352 109
34 3300005459 Ga0068867_100003587 Ga0068867_10000358710 109
35 3300005466 Ga0070685_10007381 Ga0070685_100073815 109
36 3300005535 Ga0070684_100006927 Ga0070684_1000069273 109
37 3300005539 Ga0068853_100000587 Ga0068853_10000058714 109
38 3300005539 Ga0068853_100020621 Ga0068853_1000206212 109
39 3300005539 Ga0068853_100037849 Ga0068853_1000378493 109
40 3300005539 Ga0068853_100335384 Ga0068853_1003353843 109
41 3300005539 Ga0068853_100475653 Ga0068853_1004756531 109
42 3300005539 Ga0068853_100890077 Ga0068853_1008900771 109
43 3300005539 Ga0068853_102343219 Ga0068853_1023432191 109
44 3300005543 Ga0070672_100364721 Ga0070672_1003647213 109
45 3300005547 Ga0070693_100238310 Ga0070693_1002383102 109
46 3300005547 Ga0070693_100868297 Ga0070693_1008682971 109
47 3300005548 Ga0070665_100000189 Ga0070665_10000018951 109
48 3300005548 Ga0070665_100023780 Ga0070665_1000237807 109
49 3300005563 Ga0068855_100048040 Ga0068855_1000480403 109
50 3300005563 Ga0068855_100099459 Ga0068855_1000994591 109
51 3300005563 Ga0068855_100559712 Ga0068855_1005597121 109
52 3300005563 Ga0068855_102528087 Ga0068855_1025280872 109
53 3300005564 Ga0070664_100158950 Ga0070664_1001589502 109
54 3300005577 Ga0068857_100000317 Ga0068857_1000003176 109
55 3300005578 Ga0068854_100042028 Ga0068854_1000420283 109
56 3300005578 Ga0068854_100060467 Ga0068854_1000604674 109
57 3300005578 Ga0068854_100688453 Ga0068854_1006884532 109
58 3300005614 Ga0068856_100000104 Ga0068856_10000010425 109
59 3300005614 Ga0068856_100011868 Ga0068856_1000118683 109
60 3300005614 Ga0068856_100134736 Ga0068856_1001347362 109
61 3300005614 Ga0068856_100409281 Ga0068856_1004092813 109
62 3300005616 Ga0068852_100000982 Ga0068852_10000098212 109
63 3300005616 Ga0068852_100119730 Ga0068852_1001197304 109
64 3300005616 Ga0068852_100136005 Ga0068852_1001360053 109
65 3300005616 Ga0068852_100154534 Ga0068852_1001545343 109
66 3300005616 Ga0068852_100980948 Ga0068852_1009809481 109
67 3300005618 Ga0068864_100005927 Ga0068864_1000059276 109
68 3300005618 Ga0068864_101007609 Ga0068864_1010076092 109
69 3300005718 Ga0068866_10650838 Ga0068866_106508382 109
70 3300005719 Ga0068861_100067221 Ga0068861_1000672211 109
71 3300005834 Ga0068851_10090476 Ga0068851_100904762 109
72 3300005841 Ga0068863_100196041 Ga0068863_1001960413 109
73 3300005842 Ga0068858_100004728 Ga0068858_1000047285 109
74 3300005842 Ga0068858_101434107 Ga0068858_1014341072 109
75 3300005843 Ga0068860_100000005 Ga0068860_100000005119 109
76 3300005843 Ga0068860_100027661 Ga0068860_1000276616 109
77 3300005843 Ga0068860_100051086 Ga0068860_1000510864 109
78 3300005844 Ga0068862_100272658 Ga0068862_1002726582 109
79 3300005983 Ga0081540_1016128 Ga0081540_10161282 109
80 3300005983 Ga0081540_1247854 Ga0081540_12478541 109
81 3300006237 Ga0097621_100007509 Ga0097621_1000075095 109
82 3300006237 Ga0097621_100425608 Ga0097621_1004256081 109
83 3300006358 Ga0068871_101813128 Ga0068871_1018131282 109
84 3300006881 Ga0068865_100028645 Ga0068865_1000286455 109
85 3300006948 Ga0099826_10058522 Ga0099826_100585222 109
86 3300009093 Ga0105240_10000023 Ga0105240_1000002383 109
87 3300009093 Ga0105240_10000276 Ga0105240_1000027621 109
88 3300009093 Ga0105240_10000833 Ga0105240_1000083333 109
89 3300009093 Ga0105240_10002010 Ga0105240_1000201016 109
90 3300009093 Ga0105240_10002592 Ga0105240_1000259221 109
91 3300009093 Ga0105240_10020428 Ga0105240_100204281 109
92 3300009093 Ga0105240_10064502 Ga0105240_100645023 109
93 3300009093 Ga0105240_10128920 Ga0105240_101289203 109
94 3300009093 Ga0105240_10249307 Ga0105240_102493073 109
95 3300009093 Ga0105240_11422667 Ga0105240_114226672 109
96 3300009093 Ga0105240_12434749 Ga0105240_124347492 109
97 3300009101 Ga0105247_10007937 Ga0105247_100079373 109
98 3300009148 Ga0105243_10393902 Ga0105243_103939022 109
99 3300009174 Ga0105241_10006070 Ga0105241_100060707 109
100 3300009174 Ga0105241_10158659 Ga0105241_101586592 109
101 3300009174 Ga0105241_10410098 Ga0105241_104100981 109
102 3300009174 Ga0105241_10444444 Ga0105241_104444442 109
103 3300009174 Ga0105241_12619481 Ga0105241_126194811 109
104 3300009174 Ga0105241_12619853 Ga0105241_126198532 109
105 3300009176 Ga0105242_10025813 Ga0105242_100258134 109
106 3300009176 Ga0105242_10944310 Ga0105242_109443102 109
107 3300009177 Ga0105248_10006702 Ga0105248_100067027 109
108 3300009545 Ga0105237_10006548 Ga0105237_100065485 109
109 3300009545 Ga0105237_10026390 Ga0105237_100263908 109
110 3300009545 Ga0105237_10228850 Ga0105237_102288503 109
111 3300009545 Ga0105237_10238527 Ga0105237_102385272 109
112 3300009545 Ga0105237_10246370 Ga0105237_102463702 109
113 3300009551 Ga0105238_10001751 Ga0105238_1000175112 109
114 3300009551 Ga0105238_10016912 Ga0105238_100169127 109
115 3300009551 Ga0105238_10031339 Ga0105238_100313393 109
116 3300009551 Ga0105238_10515817 Ga0105238_105158172 109
117 3300009551 Ga0105238_10531330 Ga0105238_105313301 109
118 3300009551 Ga0105238_12619717 Ga0105238_126197171 109
119 3300009553 Ga0105249_10113036 Ga0105249_101130363 109
120 3300009553 Ga0105249_10179296 Ga0105249_101792962 109
121 3300010159 Ga0099796_10517329 Ga0099796_105173292 109
122 3300010375 Ga0105239_10000267 Ga0105239_1000026726 109
123 3300010375 Ga0105239_10000433 Ga0105239_1000043330 109
124 3300010375 Ga0105239_10001651 Ga0105239_1000165110 109
125 3300010375 Ga0105239_10022970 Ga0105239_100229707 109
126 3300010375 Ga0105239_10038549 Ga0105239_100385495 109
127 3300010375 Ga0105239_10068134 Ga0105239_100681341 109
128 3300010375 Ga0105239_10173139 Ga0105239_101731392 109
129 3300010375 Ga0105239_10920405 Ga0105239_109204052 109
130 3300013100 Ga0157373_11085852 Ga0157373_110858522 109
131 3300013104 Ga0157370_10042373 Ga0157370_100423734 109
132 3300013104 Ga0157370_10217348 Ga0157370_102173482 109
133 3300013104 Ga0157370_11010957 Ga0157370_110109571 109
134 3300013105 Ga0157369_10086766 Ga0157369_100867663 109
135 3300013105 Ga0157369_10299353 Ga0157369_102993533 109
136 3300013105 Ga0157369_10703063 Ga0157369_107030632 109
137 3300013296 Ga0157374_10000003 Ga0157374_10000003320 109
138 3300013296 Ga0157374_10050351 Ga0157374_100503515 109
139 3300013296 Ga0157374_10055701 Ga0157374_100557015 109
140 3300013296 Ga0157374_10638329 Ga0157374_106383292 109
141 3300013297 Ga0157378_10032394 Ga0157378_100323942 109
142 3300013297 Ga0157378_10041607 Ga0157378_100416076 109
143 3300013297 Ga0157378_10109063 Ga0157378_101090634 109
144 3300013297 Ga0157378_11524809 Ga0157378_115248091 109
145 3300013306 Ga0163162_10000459 Ga0163162_1000045934 109
146 3300013306 Ga0163162_10001420 Ga0163162_1000142010 109
147 3300013306 Ga0163162_10013639 Ga0163162_100136398 109
148 3300013306 Ga0163162_10041824 Ga0163162_100418241 109
149 3300013306 Ga0163162_10319150 Ga0163162_103191503 109
150 3300013306 Ga0163162_13150417 Ga0163162_131504171 109
151 3300013307 Ga0157372_10007012 Ga0157372_100070123 109
152 3300013307 Ga0157372_10015962 Ga0157372_100159624 109
153 3300013307 Ga0157372_10046901 Ga0157372_100469016 109
154 3300013307 Ga0157372_10165526 Ga0157372_101655261 109
155 3300013307 Ga0157372_10813583 Ga0157372_108135832 109
156 3300013307 Ga0157372_11540641 Ga0157372_115406412 109
157 3300013307 Ga0157372_13417859 Ga0157372_134178591 109
158 3300013308 Ga0157375_10046366 Ga0157375_100463666 109
159 3300013308 Ga0157375_10104445 Ga0157375_101044452 109
160 3300014325 Ga0163163_10008368 Ga0163163_100083685 109
161 3300014325 Ga0163163_10217605 Ga0163163_102176053 109
162 3300014325 Ga0163163_10867730 Ga0163163_108677302 109
163 3300014968 Ga0157379_10002403 Ga0157379_100024039 109
164 3300014968 Ga0157379_10246835 Ga0157379_102468351 109
165 3300014969 Ga0157376_10000580 Ga0157376_100005808 109
166 3300014969 Ga0157376_10035642 Ga0157376_100356426 109
167 3300014969 Ga0157376_10170778 Ga0157376_101707783 109
168 3300014969 Ga0157376_10378467 Ga0157376_103784671 109
169 3300014969 Ga0157376_11197005 Ga0157376_111970051 109
170 3300014969 Ga0157376_11461732 Ga0157376_114617322 109
171 3300014969 Ga0157376_12344799 Ga0157376_123447992 109
172 3300017792 Ga0163161_10172193 Ga0163161_101721931 109
173 3300017792 Ga0163161_10770790 Ga0163161_107707901 109
174 3300025321 Ga0207656_10618185 Ga0207656_106181851 109
175 3300025899 Ga0207642_10541321 Ga0207642_105413211 109
176 3300025900 Ga0207710_10120802 Ga0207710_101208021 109
177 3300025901 Ga0207688_10574437 Ga0207688_105744371 109
178 3300025903 Ga0207680_10017113 Ga0207680_100171132 109
179 3300025903 Ga0207680_10285375 Ga0207680_102853751 109
180 3300025903 Ga0207680_10797593 Ga0207680_107975931 109
181 3300025904 Ga0207647_10043755 Ga0207647_100437554 109
182 3300025904 Ga0207647_10089096 Ga0207647_100890962 109
183 3300025907 Ga0207645_10156852 Ga0207645_101568523 109
184 3300025909 Ga0207705_10032752 Ga0207705_100327524 109
185 3300025909 Ga0207705_10045407 Ga0207705_100454072 109
186 3300025909 Ga0207705_11429995 Ga0207705_114299951 109
187 3300025911 Ga0207654_10069601 Ga0207654_100696014 109
188 3300025911 Ga0207654_10335143 Ga0207654_103351432 109
189 3300025911 Ga0207654_10414132 Ga0207654_104141321 109
190 3300025911 Ga0207654_11416318 Ga0207654_114163181 109
191 3300025913 Ga0207695_10000016 Ga0207695_10000016234 109
192 3300025913 Ga0207695_10000184 Ga0207695_1000018461 109
193 3300025913 Ga0207695_10000645 Ga0207695_1000064548 109
194 3300025913 Ga0207695_10001186 Ga0207695_1000118614 109
195 3300025913 Ga0207695_10046630 Ga0207695_100466304 109
196 3300025913 Ga0207695_10092837 Ga0207695_100928374 109
197 3300025913 Ga0207695_10195178 Ga0207695_101951784 109
198 3300025913 Ga0207695_10364844 Ga0207695_103648442 109
199 3300025913 Ga0207695_10661473 Ga0207695_106614732 109
200 3300025913 Ga0207695_11003224 Ga0207695_110032242 109
201 3300025913 Ga0207695_11708113 Ga0207695_117081131 109
202 3300025914 Ga0207671_10012172 Ga0207671_100121725 109
203 3300025914 Ga0207671_10043367 Ga0207671_100433673 109
204 3300025914 Ga0207671_10323135 Ga0207671_103231352 109
205 3300025914 Ga0207671_10398112 Ga0207671_103981122 109
206 3300025914 Ga0207671_10521937 Ga0207671_105219371 109
207 3300025916 Ga0207663_11294509 Ga0207663_112945092 109
208 3300025924 Ga0207694_10013767 Ga0207694_100137676 109
209 3300025924 Ga0207694_10320890 Ga0207694_103208902 109
210 3300025924 Ga0207694_10709002 Ga0207694_107090021 109
211 3300025924 Ga0207694_11288392 Ga0207694_112883921 109
212 3300025924 Ga0207694_11298415 Ga0207694_112984152 109
213 3300025925 Ga0207650_11340657 Ga0207650_113406572 109
214 3300025932 Ga0207690_10079711 Ga0207690_100797111 109
215 3300025932 Ga0207690_10673846 Ga0207690_106738461 109
216 3300025933 Ga0207706_10160084 Ga0207706_101600843 109
217 3300025934 Ga0207686_10312160 Ga0207686_103121601 109
218 3300025935 Ga0207709_11090722 Ga0207709_110907221 109
219 3300025937 Ga0207669_10392814 Ga0207669_103928142 109
220 3300025938 Ga0207704_10004363 Ga0207704_100043635 109
221 3300025940 Ga0207691_10000596 Ga0207691_100005967 109
222 3300025941 Ga0207711_10052344 Ga0207711_100523442 109
223 3300025942 Ga0207689_10083897 Ga0207689_100838973 109
224 3300025944 Ga0207661_10064277 Ga0207661_100642773 109
225 3300025945 Ga0207679_10103466 Ga0207679_101034664 109
226 3300025949 Ga0207667_10001285 Ga0207667_100012858 109
227 3300025949 Ga0207667_10003030 Ga0207667_1000303017 109
228 3300025949 Ga0207667_10080493 Ga0207667_100804934 109
229 3300025960 Ga0207651_10072565 Ga0207651_100725654 109
230 3300025961 Ga0207712_10394155 Ga0207712_103941552 109
231 3300025972 Ga0207668_10020118 Ga0207668_100201185 109
232 3300025981 Ga0207640_10056837 Ga0207640_100568373 109
233 3300025986 Ga0207658_10211215 Ga0207658_102112153 109
234 3300025986 Ga0207658_10429067 Ga0207658_104290672 109
235 3300026023 Ga0207677_10012236 Ga0207677_100122366 109
236 3300026023 Ga0207677_11277160 Ga0207677_112771602 109
237 3300026035 Ga0207703_10076156 Ga0207703_100761564 109
238 3300026035 Ga0207703_11282225 Ga0207703_112822252 109
239 3300026041 Ga0207639_10136021 Ga0207639_101360214 109
240 3300026041 Ga0207639_10185237 Ga0207639_101852371 109
241 3300026041 Ga0207639_10400827 Ga0207639_104008273 109
242 3300026041 Ga0207639_10413811 Ga0207639_104138111 109
243 3300026041 Ga0207639_10831757 Ga0207639_108317572 109
244 3300026041 Ga0207639_11443129 Ga0207639_114431292 109
245 3300026067 Ga0207678_10961880 Ga0207678_109618802 109
246 3300026078 Ga0207702_10000119 Ga0207702_1000011942 109
247 3300026078 Ga0207702_10008170 Ga0207702_100081705 109
248 3300026078 Ga0207702_10169685 Ga0207702_101696852 109
249 3300026078 Ga0207702_10404503 Ga0207702_104045031 109
250 3300026088 Ga0207641_10016996 Ga0207641_100169965 109
251 3300026089 Ga0207648_10002112 Ga0207648_1000211217 109
252 3300026095 Ga0207676_10004151 Ga0207676_100041517 109
253 3300026116 Ga0207674_10001038 Ga0207674_1000103813 109
254 3300026118 Ga0207675_100092089 Ga0207675_1000920895 109
255 3300026121 Ga0207683_10094143 Ga0207683_100941433 109
256 3300026142 Ga0207698_10041632 Ga0207698_100416324 109
257 3300026142 Ga0207698_11104259 Ga0207698_111042591 109
258 3300026142 Ga0207698_11762625 Ga0207698_117626251 109
259 3300027361 Ga0209489_118780 Ga0209489_1187803 109
260 3300028379 Ga0268266_10000180 Ga0268266_1000018046 109
261 3300028379 Ga0268266_10179953 Ga0268266_101799532 109
262 3300028381 Ga0268264_10000012 Ga0268264_10000012101 109
263 3300028381 Ga0268264_10019504 Ga0268264_100195045 109
264 3300028381 Ga0268264_10051124 Ga0268264_100511244 109
265 3300028381 Ga0268264_10151017 Ga0268264_101510172 109
266 3300028786 Ga0307517_10014647 Ga0307517_100146477 109
267 3300028786 Ga0307517_10017476 Ga0307517_100174767 109
268 3300028786 Ga0307517_10362532 Ga0307517_103625322 109
269 3300030521 Ga0307511_10151612 Ga0307511_101516123 109
270 3300031727 Ga0316576_10276593 Ga0316576_102765932 109
271 3300031731 Ga0307405_11962948 Ga0307405_119629481 109
272 3300031733 Ga0316577_10096403 Ga0316577_100964033 109
273 3300031824 Ga0307413_10004024 Ga0307413_100040245 109
274 3300031824 Ga0307413_11329203 Ga0307413_113292032 109
275 3300032002 Ga0307416_100009832 Ga0307416_1000098324 109
276 3300032004 Ga0307414_10000001 Ga0307414_10000001598 109
277 3300032004 Ga0307414_10186876 Ga0307414_101868763 109
278 3300032004 Ga0307414_10370897 Ga0307414_103708972 109
279 3300032004 Ga0307414_10825552 Ga0307414_108255522 109
280 3300032005 Ga0307411_10000001 Ga0307411_10000001600 109
281 3300035398 Ga0316574_0510015 Ga0316574_0510015_341_670 109
282 3300035724 Ga0373933_0924897 Ga0373933_0924897_200_532 109
283 3300036401 Ga0373937_0192883 Ga0373937_0192883_1199_1528 109
284 3300036647 Ga0316582_0255266 Ga0316582_0255266_707_1036 109
285 3300036712 Ga0316584_0060279 Ga0316584_0060279_606_935 109
286 3300037471 Ga0395905_0842414 Ga0395905_0842414_176_505 109
287 3300041411 Ga0439466_0107207 Ga0439466_0107207_486_818 109
288 3300041486 Ga0451807_1616836 Ga0451807_1616836_1618_1953 109
289 3300041494 Ga0451837_0405384 Ga0451837_0405384_603_935 109
290 3300042004 Ga0439445_0270689 Ga0439445_0270689_64_393 109
291 3300044656 Ga0466969_0580018 Ga0466969_0580018_77_409 109
292 3300044658 Ga0466972_0011885 Ga0466972_0011885_1394_1726 109
293 3300044683 Ga0466965_0765855 Ga0466965_0765855_120_458 109
294 3300044684 Ga0466966_0111171 Ga0466966_0111171_434_766 109
295 3300044693 Ga0466961_0160299 Ga0466961_0160299_510_842 109
296 3300044719 Ga0466971_0041967 Ga0466971_0041967_1159_1491 109
297 3300044735 Ga0466968_0117531 Ga0466968_0117531_475_813 109
298 3300044842 Ga0466957_0950393 Ga0466957_0950393_249_581 109
299 3300045049 Ga0466959_0001248 Ga0466959_0001248_5399_5731 109
300 3300045049 Ga0466959_0214757 Ga0466959_0214757_768_1100 109
301 3300045836 Ga0466958_0932253 Ga0466958_0932253_208_540 109
302 3300045976 Ga0466967_1535956 Ga0466967_1535956_39_371 109
303 3300046460 Ga0495638_0033777 Ga0495638_0033777_2699_3031 109
304 3300046460 Ga0495638_0198801 Ga0495638_0198801_676_1005 109
305 3300046460 Ga0495638_0522882 Ga0495638_0522882_174_506 109
306 3300046471 Ga0495650_0000050 Ga0495650_0000050_252820_253149 109
307 3300046507 Ga0495606_0000036 Ga0495606_0000036_2770_3099 109
308 3300046507 Ga0495606_0019305 Ga0495606_0019305_1462_1791 109
309 3300046507 Ga0495606_0019305 Ga0495606_0019305_3448_3777 109
310 3300046512 Ga0495610_0000167 Ga0495610_0000167_63845_64174 109
311 3300046512 Ga0495610_0001572 Ga0495610_0001572_16887_17216 109
312 3300046513 Ga0495616_0000271 Ga0495616_0000271_27311_27640 109
313 3300046517 Ga0495630_0386640 Ga0495630_0386640_87_416 109
314 3300046524 Ga0495648_0001914 Ga0495648_0001914_12434_12766 109
315 3300046535 Ga0495586_0512900 Ga0495586_0512900_165_494 109
316 3300046538 Ga0495609_0005232 Ga0495609_0005232_6151_6480 109
317 3300046543 Ga0495645_0930075 Ga0495645_0930075_121_450 109
318 3300046558 Ga0495633_0002805 Ga0495633_0002805_8046_8375 109
319 3300046660 Ga0495625_0000105 Ga0495625_0000105_17064_17393 109
320 3300046663 Ga0495635_0363430 Ga0495635_0363430_603_932 109
321 3300046665 Ga0495661_0013486 Ga0495661_0013486_1476_1805 109
322 3300046679 Ga0495623_0500309 Ga0495623_0500309_115_444 109
323 3300046692 Ga0495671_0096463 Ga0495671_0096463_621_953 109
324 3300046694 Ga0495649_0000011 Ga0495649_0000011_107548_107877 109
325 3300046694 Ga0495649_0457247 Ga0495649_0457247_251_583 109
326 3300046810 Ga0495660_0036810 Ga0495660_0036810_1682_2011 109
327 3300046810 Ga0495660_0110152 Ga0495660_0110152_153_482 109
328 3300047317 Ga0495604_0866288 Ga0495604_0866288_177_506 109
329 3300047323 Ga0495683_0070377 Ga0495683_0070377_342_671 109
330 3300047323 Ga0495683_0142663 Ga0495683_0142663_60_389 109
331 3300047443 Ga0495687_005139 Ga0495687_005139_2848_3180 109
332 3300047469 Ga0495673_0104808 Ga0495673_0104808_56_385 109
333 3300047472 Ga0495686_0271201 Ga0495686_0271201_163_495 109
334 3300047472 Ga0495686_0482355 Ga0495686_0482355_73_402 109
335 3300048907 Ga0496104_0706740 Ga0496104_0706740_61_456 109
336 3300048907 Ga0496104_1661811 Ga0496104_1661811_183_512 109
337 3300048918 Ga0496115_0506934 Ga0496115_0506934_104_499 109
338 3300048918 Ga0496115_0532752 Ga0496115_0532752_581_913 109
339 3300048918 Ga0496115_0564604 Ga0496115_0564604_458_793 109
340 3300048923 Ga0496120_0328233 Ga0496120_0328233_153_485 109
341 3300049574 Ga0501038_1190600 Ga0501038_1190600_128_463 109
342 3300049588 Ga0501072_1169481 Ga0501072_1169481_225_554 109
343 3300049679 Ga0501249_002692 Ga0501249_002692_474_806 109
344 3300049742 Ga0501080_0019659 Ga0501080_0019659_4533_4862 109
345 3300049742 Ga0501080_0144392 Ga0501080_0144392_520_849 109
346 3300049763 Ga0501266_000016 Ga0501266_000016_112337_112669 109
347 3300053085 Ga0495619_0118540 Ga0495619_0118540_19_348 109
348 3300053085 Ga0495619_0407478 Ga0495619_0407478_511_840 109
349 3300053090 Ga0500646_0001073 Ga0500646_0001073_712_1041 109
350 3300053090 Ga0500646_0011392 Ga0500646_0011392_660_992 109
351 3300053090 Ga0500646_0075945 Ga0500646_0075945_521_853 109
352 3300053092 Ga0500583_0001438 Ga0500583_0001438_387_719 109
353 3300053096 Ga0500641_0000013 Ga0500641_0000013_32841_33173 109
354 3300053118 Ga0500594_0059325 Ga0500594_0059325_603_935 109
355 3300053125 Ga0500618_018512 Ga0500618_018512_251_580 109
356 3300053129 Ga0500628_044649 Ga0500628_044649_252_581 109
357 3300053130 Ga0500642_0120876 Ga0500642_0120876_524_856 109
358 3300053139 Ga0500568_0018087 Ga0500568_0018087_1402_1734 109
359 3300053146 Ga0500588_0413822 Ga0500588_0413822_77_409 109
360 3300053153 Ga0500616_0004907 Ga0500616_0004907_2958_3287 109
361 3300053156 Ga0500622_0000686 Ga0500622_0000686_20784_21116 109
362 3300053156 Ga0500622_0099901 Ga0500622_0099901_559_888 109
363 3300053177 Ga0500636_0465122 Ga0500636_0465122_222_551 109
364 3300053178 Ga0500637_0350081 Ga0500637_0350081_146_475 109
365 3300053730 Ga0500645_094589 Ga0500645_094589_179_511 109
366 3300061719 Ga0466962_0090466 Ga0466962_0090466_489_821 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

48

98

0.96

PF01022

HTH_5

Bacterial regulatory protein, arsR family

50

96

0.91

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

51

96

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.9064 15 84
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8957 9 95
3irq-assembly1.cif.gz_D crystal structure of a z-z junction 0.8887 24 83
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.8856 20 101
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8813 45 83
ID Description Score Start End Superfamily
af_O53478_1_106_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9089 16 99 1.10.10.10
af_O53773_1_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.907 20 99 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9032 25 82 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9032 10 96 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8999 15 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7T9D5Z1-F1-model_v4 deleted 0.9622 1 105
AF-A0A2M8HID5-F1-model_v4 Transcriptional regulator 0.9608 1 98 GO:0003700
AF-A0A2T3LEI4-F1-model_v4 Transcriptional regulator 0.9574 12 96 GO:0003700
AF-A0A316U001-F1-model_v4 Transcriptional regulator 0.9548 10 98 GO:0003700
AF-A0A437PPG9-F1-model_v4 ArsR family transcriptional regulator 0.9548 9 99 GO:0003700
GO:0005737

Feature Viewer

pLDDT pTM Quality
90.53 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map