F423932

General Info

Members Datasets Scaffolds Average Seq Length
366 210 732 253

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100247385|Ga0070713_1002473852
Length 275
Sequence MCALAPGSYVRLMLNSARLLPAEALNSAAPASAAAVALRDVRKVFGRGEGAIVALDGVSAALPPGSFTAIMGPSGSGKSTFLNVAAGLDRPTSGSVALGGADLAQLSERRLTILRRQRIGFVFQAFNLLPSLTVAQNIALPLRLDGRRPRRSDVRAIAARVGLEKRLRDRPSQLSGGQQQRVAIARALITRPEVVFADEPTGALDIRTGGAVLALLRGVVDEDGQTVVMVTHDPVAAGYADRVLLLADGRVAGALVAPTAAEVAERLANLARLGG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
210 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0.82
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.84
Rhizosphere 85.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100247385 3300005436 Bacteria 1625
2 JGI25404J52841_10003358 3300003659 Bacteria 3156
3 Ga0070658_10235956 3300005327 Bacteria 1550
4 Ga0070683_100276055 3300005329 Bacteria 1599
5 Ga0070683_100490787 3300005329 Bacteria 1173
6 Ga0070666_10189195 3300005335 Bacteria 1446
7 Ga0070680_100110110 3300005336 Bacteria 2292
8 Ga0068868_100422057 3300005338 Bacteria 1155
9 Ga0068868_100759893 3300005338 Bacteria 872
10 Ga0070660_100171454 3300005339 Bacteria 1753
11 Ga0070660_100266872 3300005339 Bacteria 1398
12 Ga0070689_100444116 3300005340 Bacteria 1103
13 Ga0070675_100618676 3300005354 Bacteria 983
14 Ga0070674_100122299 3300005356 Bacteria 1928
15 Ga0070673_100279215 3300005364 Bacteria 1465
16 Ga0070688_100362476 3300005365 Bacteria 1064
17 Ga0070688_100396375 3300005365 Bacteria 1021
18 Ga0070659_100077412 3300005366 Bacteria 2653
19 Ga0070709_10051797 3300005434 Bacteria 2577
20 Ga0070714_100001776 3300005435 Bacteria 15727
21 Ga0070714_100065261 3300005435 Bacteria 3135
22 Ga0070714_100192751 3300005435 Bacteria 1860
23 Ga0070714_100208507 3300005435 Bacteria 1790
24 Ga0070714_100228081 3300005435 Bacteria 1715
25 Ga0070714_100655558 3300005435 Bacteria 1011
26 Ga0070713_100052333 3300005436 Bacteria 3381
27 Ga0070713_100087199 3300005436 Bacteria 2677
28 Ga0070713_100100990 3300005436 Bacteria 2498
29 Ga0070713_100106151 3300005436 Bacteria 2441
30 Ga0070713_100120318 3300005436 Bacteria 2302
31 Ga0070713_100606232 3300005436 Bacteria 1040
32 Ga0070710_10024258 3300005437 Bacteria 3197
33 Ga0070710_10113180 3300005437 Bacteria 1633
34 Ga0070701_10042344 3300005438 Bacteria 2324
35 Ga0070711_100008305 3300005439 Bacteria 6355
36 Ga0070705_100041496 3300005440 Bacteria 2624
37 Ga0070705_100115501 3300005440 Bacteria 1723
38 Ga0070694_100191519 3300005444 Bacteria 1519
39 Ga0070678_100210562 3300005456 Bacteria 1610
40 Ga0070662_100073941 3300005457 Bacteria 2520
41 Ga0070681_10415211 3300005458 Bacteria 1257
42 Ga0070681_10610116 3300005458 Bacteria 1006
43 Ga0068867_100112432 3300005459 Bacteria 2094
44 Ga0068867_100156998 3300005459 Bacteria 1792
45 Ga0070685_10095569 3300005466 Bacteria 1807
46 Ga0070706_100022559 3300005467 Bacteria 5795
47 Ga0070672_100423414 3300005543 Bacteria 1144
48 Ga0070672_100443046 3300005543 Bacteria 1118
49 Ga0070672_100459130 3300005543 Bacteria 1098
50 Ga0070686_100462778 3300005544 Bacteria 977
51 Ga0070695_100131499 3300005545 Bacteria 1725
52 Ga0070696_100027067 3300005546 Bacteria 3905
53 Ga0070696_100340456 3300005546 Bacteria 1159
54 Ga0070693_100282158 3300005547 Bacteria 1113
55 Ga0068855_100113933 3300005563 Bacteria 3101
56 Ga0070664_100152549 3300005564 Bacteria 2040
57 Ga0068854_100154820 3300005578 Bacteria 1770
58 Ga0068856_100121669 3300005614 Bacteria 2612
59 Ga0068856_100472009 3300005614 Bacteria 1275
60 Ga0068852_100228796 3300005616 Bacteria 1772
61 Ga0068852_100339609 3300005616 Bacteria 1463
62 Ga0068859_100120650 3300005617 Bacteria 2689
63 Ga0068859_100445621 3300005617 Bacteria 1391
64 Ga0068864_100138881 3300005618 Bacteria 2190
65 Ga0068866_10056983 3300005718 Bacteria 2011
66 Ga0068866_10130491 3300005718 Bacteria 1429
67 Ga0068858_100157608 3300005842 Bacteria 2136
68 Ga0068860_100237740 3300005843 Bacteria 1771
69 Ga0068862_100707144 3300005844 Bacteria 977
70 Ga0081455_10012072 3300005937 Bacteria 8639
71 Ga0081455_10174119 3300005937 Bacteria 1636
72 Ga0081540_1000509 3300005983 Bacteria 38185
73 Ga0070717_10064224 3300006028 Bacteria 3049
74 Ga0070717_10110578 3300006028 Bacteria 2343
75 Ga0070717_10114558 3300006028 Bacteria 2303
76 Ga0070717_10273841 3300006028 Bacteria 1495
77 Ga0070717_10404489 3300006028 Bacteria 1227
78 Ga0070715_10014525 3300006163 Bacteria 2918
79 Ga0070716_100006057 3300006173 Bacteria 5894
80 Ga0070712_100073762 3300006175 Bacteria 2449
81 Ga0070712_100193426 3300006175 Bacteria 1593
82 Ga0070712_100234676 3300006175 Bacteria 1458
83 Ga0075430_100415096 3300006846 Bacteria 1111
84 Ga0075434_100244422 3300006871 Bacteria 1814
85 Ga0068865_100078071 3300006881 Bacteria 2368
86 Ga0068865_100204464 3300006881 Bacteria 1535
87 Ga0097620_100120650 3300006931 Bacteria 2689
88 Ga0097620_100445616 3300006931 Bacteria 1391
89 Ga0111539_10565642 3300009094 Bacteria 1324
90 Ga0105245_10060629 3300009098 Bacteria 3407
91 Ga0105245_10073545 3300009098 Bacteria 3108
92 Ga0105247_10096546 3300009101 Bacteria 1884
93 Ga0114129_10303499 3300009147 Bacteria 2127
94 Ga0114129_10451689 3300009147 Bacteria 1685
95 Ga0105243_10264318 3300009148 Bacteria 1542
96 Ga0105243_10311378 3300009148 Bacteria 1431
97 Ga0105243_10341674 3300009148 Bacteria 1371
98 Ga0105242_10016298 3300009176 Bacteria 5778
99 Ga0105242_10114892 3300009176 Bacteria 2301
100 Ga0105248_10279986 3300009177 Bacteria 1878
101 Ga0105248_10590208 3300009177 Bacteria 1253
102 Ga0105249_10102422 3300009553 Bacteria 2695
103 Ga0105246_10057986 3300011119 Bacteria 2681
104 Ga0157369_10023068 3300013105 Bacteria 6935
105 Ga0163162_10186132 3300013306 Bacteria 2203
106 Ga0157375_10229540 3300013308 Bacteria 2015
107 Ga0157380_10251366 3300014326 Bacteria 1600
108 Ga0157377_10246188 3300014745 Bacteria 1156
109 Ga0157376_10017065 3300014969 Bacteria 5529
110 Ga0157376_10364135 3300014969 Bacteria 1387
111 Ga0163161_10302063 3300017792 Bacteria 1261
112 Ga0206356_11508656 3300020070 Bacteria 950
113 Ga0206354_10548626 3300020081 Bacteria 1932
114 Ga0206353_10248759 3300020082 Bacteria 1263
115 Ga0213874_10000814 3300021377 Bacteria 6365
116 Ga0207656_10196920 3300025321 Bacteria 972
117 Ga0207692_10000297 3300025898 Bacteria 17196
118 Ga0207692_10023121 3300025898 Bacteria 2870
119 Ga0207642_10026109 3300025899 Bacteria 2374
120 Ga0207642_10267652 3300025899 Bacteria 977
121 Ga0207688_10037798 3300025901 Bacteria 2678
122 Ga0207685_10005865 3300025905 Bacteria 3290
123 Ga0207699_10006562 3300025906 Bacteria 5644
124 Ga0207699_10148879 3300025906 Bacteria 1546
125 Ga0207699_10215210 3300025906 Bacteria 1309
126 Ga0207705_10133110 3300025909 Bacteria 1851
127 Ga0207654_10260518 3300025911 Bacteria 1166
128 Ga0207707_10105429 3300025912 Bacteria 2464
129 Ga0207695_10254012 3300025913 Bacteria 1657
130 Ga0207693_10019152 3300025915 Bacteria 5447
131 Ga0207693_10035549 3300025915 Bacteria 3927
132 Ga0207693_10070909 3300025915 Bacteria 2727
133 Ga0207693_10077025 3300025915 Bacteria 2611
134 Ga0207693_10092761 3300025915 Bacteria 2366
135 Ga0207663_10017491 3300025916 Bacteria 3996
136 Ga0207663_10033452 3300025916 Bacteria 3063
137 Ga0207663_10095921 3300025916 Bacteria 1980
138 Ga0207663_10322883 3300025916 Bacteria 1161
139 Ga0207657_10035501 3300025919 Bacteria 4469
140 Ga0207657_10202896 3300025919 Bacteria 1594
141 Ga0207652_10085000 3300025921 Bacteria 2772
142 Ga0207652_10501092 3300025921 Bacteria 1093
143 Ga0207646_10109287 3300025922 Bacteria 2481
144 Ga0207694_10587548 3300025924 Bacteria 936
145 Ga0207700_10005676 3300025928 Bacteria 7491
146 Ga0207700_10019707 3300025928 Bacteria 4561
147 Ga0207700_10023351 3300025928 Bacteria 4261
148 Ga0207700_10092414 3300025928 Bacteria 2392
149 Ga0207700_10105809 3300025928 Bacteria 2254
150 Ga0207700_10393722 3300025928 Bacteria 1213
151 Ga0207664_10000495 3300025929 Bacteria 28038
152 Ga0207664_10002399 3300025929 Bacteria 12391
153 Ga0207664_10087841 3300025929 Bacteria 2542
154 Ga0207664_10162330 3300025929 Bacteria 1906
155 Ga0207664_10179256 3300025929 Bacteria 1818
156 Ga0207664_10402080 3300025929 Bacteria 1218
157 Ga0207644_10034250 3300025931 Bacteria 3553
158 Ga0207690_10240385 3300025932 Bacteria 1394
159 Ga0207690_10281526 3300025932 Bacteria 1295
160 Ga0207686_10146266 3300025934 Bacteria 1640
161 Ga0207709_10046619 3300025935 Bacteria 2631
162 Ga0207709_10092037 3300025935 Bacteria 1984
163 Ga0207670_10032608 3300025936 Bacteria 3351
164 Ga0207669_10128490 3300025937 Bacteria 1736
165 Ga0207669_10180629 3300025937 Bacteria 1512
166 Ga0207665_10025157 3300025939 Bacteria 3927
167 Ga0207665_10170655 3300025939 Bacteria 1571
168 Ga0207691_10261295 3300025940 Bacteria 1492
169 Ga0207691_10429061 3300025940 Bacteria 1126
170 Ga0207691_10576596 3300025940 Bacteria 953
171 Ga0207689_10008051 3300025942 Bacteria 9200
172 Ga0207661_10202460 3300025944 Bacteria 1746
173 Ga0207661_10663904 3300025944 Bacteria 958
174 Ga0207651_10333717 3300025960 Bacteria 1272
175 Ga0207651_10675476 3300025960 Bacteria 908
176 Ga0207712_10133194 3300025961 Bacteria 1897
177 Ga0207668_10299279 3300025972 Bacteria 1327
178 Ga0207640_10050866 3300025981 Bacteria 2690
179 Ga0207640_10094353 3300025981 Bacteria 2081
180 Ga0207640_10137175 3300025981 Bacteria 1778
181 Ga0207677_10103922 3300026023 Bacteria 2098
182 Ga0207703_10121569 3300026035 Bacteria 2242
183 Ga0207703_10256509 3300026035 Bacteria 1579
184 Ga0207678_10055706 3300026067 Bacteria 3405
185 Ga0207678_10106778 3300026067 Bacteria 2388
186 Ga0207708_10092501 3300026075 Bacteria 2334
187 Ga0207708_10248944 3300026075 Bacteria 1431
188 Ga0207702_10058299 3300026078 Bacteria 3286
189 Ga0207702_10106157 3300026078 Bacteria 2488
190 Ga0207702_10183742 3300026078 Bacteria 1927
191 Ga0207648_10057283 3300026089 Bacteria 3399
192 Ga0207648_10209538 3300026089 Bacteria 1730
193 Ga0207676_10465506 3300026095 Bacteria 1194
194 Ga0207674_10205911 3300026116 Bacteria 1917
195 Ga0207674_10488996 3300026116 Bacteria 1189
196 Ga0207675_100041868 3300026118 Bacteria 4277
197 Ga0207675_100083924 3300026118 Bacteria 2989
198 Ga0207683_10005302 3300026121 Bacteria 11056
199 Ga0207683_10016820 3300026121 Bacteria 6223
200 Ga0207698_10028255 3300026142 Bacteria 3997
201 Ga0207428_10564021 3300027907 Bacteria 823
202 Ga0268266_10313728 3300028379 Bacteria 1466
203 Ga0268266_10541509 3300028379 Bacteria 1114
204 Ga0268266_11014765 3300028379 Bacteria 803
205 Ga0268265_10324785 3300028380 Bacteria 1395
206 Ga0268264_10217229 3300028381 Bacteria 1758
207 Ga0307405_10021213 3300031731 Bacteria 3648
208 Ga0307413_10465685 3300031824 Bacteria 1007
209 Ga0307407_10252625 3300031903 Bacteria 1209
210 Ga0307412_10243726 3300031911 Bacteria 1392
211 Ga0307412_10260052 3300031911 Bacteria 1353
212 Ga0307416_100129235 3300032002 Bacteria 2270
213 Ga0307416_100385038 3300032002 Bacteria 1434
214 Ga0307411_10595637 3300032005 Bacteria 950
215 Ga0307415_100000229 3300032126 Bacteria 24620
216 Ga0373926_0000850 3300035083 Bacteria 8708
217 Ga0373944_0000427 3300035089 Bacteria 9635
218 Ga0373936_0000725 3300035113 Bacteria 11524
219 Ga0373936_0027143 3300035113 Bacteria 2245
220 Ga0373945_0000016 3300035116 Bacteria 34712
221 Ga0373945_0073155 3300035116 Bacteria 1301
222 Ga0373953_0047196 3300035117 Bacteria 1732
223 Ga0373955_0321644 3300035172 Bacteria 934
224 Ga0373961_0028104 3300035241 Bacteria 1549
225 Ga0373924_0042869 3300035410 Bacteria 1857
226 Ga0373935_0116799 3300035692 Bacteria 1777
227 Ga0373935_0155858 3300035692 Bacteria 1553
228 Ga0373927_0000603 3300035695 Bacteria 27426
229 Ga0373933_0017769 3300035724 Bacteria 3990
230 Ga0373933_0156983 3300035724 Bacteria 1443
231 Ga0373947_0005652 3300035725 Bacteria 7298
232 Ga0373937_0051146 3300036401 Bacteria 3787
233 Ga0373937_0169535 3300036401 Bacteria 2048
234 Ga0373937_0505549 3300036401 Bacteria 1148
235 Ga0373925_0013934 3300037068 Bacteria 5819
236 Ga0395899_0131607 3300037312 Bacteria 1785
237 Ga0395900_0442061 3300037418 Bacteria 1258
238 Ga0395898_0070475 3300037466 Bacteria 3379
239 Ga0395898_0374687 3300037466 Bacteria 1357
240 Ga0395898_0718463 3300037466 Bacteria 941
241 Ga0395905_0018474 3300037471 Bacteria 6617
242 Ga0436364_0023114 3300037853 Bacteria 1116
243 Ga0436364_0744607 3300037853 Bacteria 2536
244 Ga0395901_0015678 3300038443 Bacteria 7719
245 Ga0436365_1480809 3300039437 Bacteria 2295
246 Ga0436363_0749559 3300039450 Bacteria 6920
247 Ga0439449_0005218 3300042007 Bacteria 4984
248 Ga0466963_0035270 3300044694 Bacteria 3258
249 Ga0466963_0071187 3300044694 Bacteria 2340
250 Ga0466963_0451891 3300044694 Bacteria 907
251 Ga0466970_0306100 3300044765 Bacteria 897
252 Ga0466960_0213589 3300044901 Bacteria 1059
253 Ga0466959_0093256 3300045049 Bacteria 2161
254 Ga0466958_0122955 3300045836 Bacteria 1626
255 Ga0466958_0300643 3300045836 Bacteria 1030
256 Ga0466967_0002144 3300045976 Bacteria 12105
257 Ga0466967_0062597 3300045976 Bacteria 3303
258 Ga0466967_0191668 3300045976 Bacteria 1932
259 Ga0466967_0405010 3300045976 Bacteria 1328
260 Ga0466967_0484643 3300045976 Bacteria 1212
261 Ga0466967_0665620 3300045976 Bacteria 1030
262 Ga0466967_0905252 3300045976 Bacteria 877
263 Ga0495641_0016479 3300046461 Bacteria 3894
264 Ga0495651_0051592 3300046462 Bacteria 3170
265 Ga0495653_0000660 3300046463 Bacteria 26383
266 Ga0495653_0007461 3300046463 Bacteria 8945
267 Ga0495582_0103979 3300046473 Bacteria 1592
268 Ga0495639_0016573 3300046475 Bacteria 3200
269 Ga0495639_0034584 3300046475 Bacteria 2261
270 Ga0495662_0047813 3300046476 Bacteria 2065
271 Ga0495664_0002456 3300046477 Bacteria 9974
272 Ga0495664_0067062 3300046477 Bacteria 2141
273 Ga0495608_0020845 3300046511 Bacteria 4503
274 Ga0495608_0042591 3300046511 Bacteria 3036
275 Ga0495618_0031751 3300046514 Bacteria 3306
276 Ga0495630_0021778 3300046517 Bacteria 4734
277 Ga0495652_0116191 3300046529 Bacteria 2143
278 Ga0495652_0178294 3300046529 Bacteria 1633
279 Ga0495652_0233352 3300046529 Bacteria 1374
280 Ga0495665_0043082 3300046531 Bacteria 2400
281 Ga0495640_0015158 3300046533 Bacteria 5806
282 Ga0495667_0004696 3300046559 Bacteria 9236
283 Ga0495667_0093635 3300046559 Bacteria 1945
284 Ga0495667_0205942 3300046559 Bacteria 1258
285 Ga0495634_0013912 3300046642 Bacteria 5816
286 Ga0495634_0074403 3300046642 Bacteria 2232
287 Ga0495635_0006235 3300046663 Bacteria 8307
288 Ga0495635_0370575 3300046663 Bacteria 954
289 Ga0495657_0020284 3300046675 Bacteria 4781
290 Ga0495657_0034955 3300046675 Bacteria 3487
291 Ga0495599_0037879 3300046678 Bacteria 3029
292 Ga0495658_0394075 3300046683 Bacteria 882
293 Ga0495613_0114495 3300046689 Bacteria 1941
294 Ga0495624_0017865 3300046690 Bacteria 4752
295 Ga0495581_0017834 3300047315 Bacteria 4125
296 Ga0495604_0124525 3300047317 Bacteria 1861
297 Ga0495604_0138209 3300047317 Bacteria 1744
298 Ga0495674_0012698 3300047319 Bacteria 7937
299 Ga0495674_0132559 3300047319 Bacteria 2099
300 Ga0495676_0003229 3300047321 Bacteria 14734
301 Ga0495680_0007542 3300047322 Bacteria 9949
302 Ga0495680_0010294 3300047322 Bacteria 8343
303 Ga0495680_0191790 3300047322 Bacteria 1470
304 Ga0495684_0022777 3300047471 Bacteria 4817
305 Ga0495684_0032181 3300047471 Bacteria 4025
306 Ga0495602_0049528 3300048088 Bacteria 3762
307 Ga0495602_0232224 3300048088 Bacteria 1385
308 Ga0496100_0041655 3300048903 Bacteria 2929
309 Ga0496100_0064216 3300048903 Bacteria 2428
310 Ga0496101_0176186 3300048904 Bacteria 1645
311 Ga0496102_0037374 3300048905 Bacteria 4380
312 Ga0496102_0766547 3300048905 Bacteria 887
313 Ga0496103_0041122 3300048906 Bacteria 2841
314 Ga0496104_0010680 3300048907 Bacteria 8209
315 Ga0496104_0021586 3300048907 Bacteria 5912
316 Ga0496105_0009735 3300048908 Bacteria 7526
317 Ga0496105_0027997 3300048908 Bacteria 4608
318 Ga0496105_0081116 3300048908 Bacteria 2680
319 Ga0496105_0083018 3300048908 Bacteria 2646
320 Ga0496106_0089150 3300048909 Bacteria 2378
321 Ga0496106_0119065 3300048909 Bacteria 2062
322 Ga0496107_0000787 3300048910 Bacteria 18332
323 Ga0496107_0085941 3300048910 Bacteria 2295
324 Ga0496107_0161162 3300048910 Bacteria 1662
325 Ga0496108_0001060 3300048911 Bacteria 21455
326 Ga0496108_0002885 3300048911 Bacteria 13794
327 Ga0496108_0010263 3300048911 Bacteria 7603
328 Ga0496108_0118636 3300048911 Bacteria 2268
329 Ga0496109_0002834 3300048912 Bacteria 14531
330 Ga0496109_0018823 3300048912 Bacteria 6075
331 Ga0496109_0026840 3300048912 Bacteria 5137
332 Ga0496109_0133294 3300048912 Bacteria 2320
333 Ga0496109_0307334 3300048912 Bacteria 1496
334 Ga0496109_0722689 3300048912 Bacteria 934
335 Ga0496110_0053779 3300048913 Bacteria 3541
336 Ga0496110_0271154 3300048913 Bacteria 1545
337 Ga0496110_0349360 3300048913 Bacteria 1347
338 Ga0496111_0011630 3300048914 Bacteria 5937
339 Ga0496111_0172649 3300048914 Bacteria 1606
340 Ga0496112_0016250 3300048915 Bacteria 6965
341 Ga0496112_0040653 3300048915 Bacteria 4547
342 Ga0496112_0174716 3300048915 Bacteria 2113
343 Ga0496112_0284660 3300048915 Bacteria 1599
344 Ga0496113_0004949 3300048916 Bacteria 8254
345 Ga0496113_0015673 3300048916 Bacteria 5219
346 Ga0496113_0042296 3300048916 Bacteria 3366
347 Ga0496114_0029646 3300048917 Bacteria 4499
348 Ga0496114_0160668 3300048917 Bacteria 1953
349 Ga0496114_0215693 3300048917 Bacteria 1684
350 Ga0496114_0331007 3300048917 Bacteria 1346
351 Ga0496115_0015787 3300048918 Bacteria 5735
352 Ga0496115_0104419 3300048918 Bacteria 2325
353 Ga0496115_0136844 3300048918 Bacteria 2020
354 Ga0496115_0584993 3300048918 Bacteria 889
355 Ga0496126_0122373 3300048929 Bacteria 2255
356 Ga0501067_0093055 3300049583 Bacteria 1674
357 nmdc:mga05p37_245961_c1 3300050507 Bacteria 2147
358 nmdc:mga05p37_721248_c1 3300050507 Bacteria 1104
359 nmdc:mga08y16_343861_c1 3300050511 Bacteria 1533
360 nmdc:mga08x19_446718_c1 3300050514 Bacteria 910
361 nmdc:mga08x19_473666_c1 3300050514 Bacteria 882
362 nmdc:mga0a205_390684_c1 3300050515 Bacteria 1255
363 Ga0495601_0106133 3300053077 Bacteria 1816
364 Ga0466962_0104710 3300061719 Bacteria 1360
365 2918501146 2918501144 Bacteria 8668083
366 8057572867 8057568493 Bacteria 7221719
367 Ga0070713_100247385
368 JGI25404J52841_10003358
369 Ga0070658_10235956
370 Ga0070683_100276055
371 Ga0070683_100490787
372 Ga0070666_10189195
373 Ga0070680_100110110
374 Ga0068868_100422057
375 Ga0068868_100759893
376 Ga0070660_100171454
377 Ga0070660_100266872
378 Ga0070689_100444116
379 Ga0070675_100618676
380 Ga0070674_100122299
381 Ga0070673_100279215
382 Ga0070688_100362476
383 Ga0070688_100396375
384 Ga0070659_100077412
385 Ga0070709_10051797
386 Ga0070714_100001776
387 Ga0070714_100065261
388 Ga0070714_100192751
389 Ga0070714_100208507
390 Ga0070714_100228081
391 Ga0070714_100655558
392 Ga0070713_100052333
393 Ga0070713_100087199
394 Ga0070713_100100990
395 Ga0070713_100106151
396 Ga0070713_100120318
397 Ga0070713_100606232
398 Ga0070710_10024258
399 Ga0070710_10113180
400 Ga0070701_10042344
401 Ga0070711_100008305
402 Ga0070705_100041496
403 Ga0070705_100115501
404 Ga0070694_100191519
405 Ga0070678_100210562
406 Ga0070662_100073941
407 Ga0070681_10415211
408 Ga0070681_10610116
409 Ga0068867_100112432
410 Ga0068867_100156998
411 Ga0070685_10095569
412 Ga0070706_100022559
413 Ga0070672_100423414
414 Ga0070672_100443046
415 Ga0070672_100459130
416 Ga0070686_100462778
417 Ga0070695_100131499
418 Ga0070696_100027067
419 Ga0070696_100340456
420 Ga0070693_100282158
421 Ga0068855_100113933
422 Ga0070664_100152549
423 Ga0068854_100154820
424 Ga0068856_100121669
425 Ga0068856_100472009
426 Ga0068852_100228796
427 Ga0068852_100339609
428 Ga0068859_100120650
429 Ga0068859_100445621
430 Ga0068864_100138881
431 Ga0068866_10056983
432 Ga0068866_10130491
433 Ga0068858_100157608
434 Ga0068860_100237740
435 Ga0068862_100707144
436 Ga0081455_10012072
437 Ga0081455_10174119
438 Ga0081540_1000509
439 Ga0070717_10064224
440 Ga0070717_10110578
441 Ga0070717_10114558
442 Ga0070717_10273841
443 Ga0070717_10404489
444 Ga0070715_10014525
445 Ga0070716_100006057
446 Ga0070712_100073762
447 Ga0070712_100193426
448 Ga0070712_100234676
449 Ga0075430_100415096
450 Ga0075434_100244422
451 Ga0068865_100078071
452 Ga0068865_100204464
453 Ga0097620_100120650
454 Ga0097620_100445616
455 Ga0111539_10565642
456 Ga0105245_10060629
457 Ga0105245_10073545
458 Ga0105247_10096546
459 Ga0114129_10303499
460 Ga0114129_10451689
461 Ga0105243_10264318
462 Ga0105243_10311378
463 Ga0105243_10341674
464 Ga0105242_10016298
465 Ga0105242_10114892
466 Ga0105248_10279986
467 Ga0105248_10590208
468 Ga0105249_10102422
469 Ga0105246_10057986
470 Ga0157369_10023068
471 Ga0163162_10186132
472 Ga0157375_10229540
473 Ga0157380_10251366
474 Ga0157377_10246188
475 Ga0157376_10017065
476 Ga0157376_10364135
477 Ga0163161_10302063
478 Ga0206356_11508656
479 Ga0206354_10548626
480 Ga0206353_10248759
481 Ga0213874_10000814
482 Ga0207656_10196920
483 Ga0207692_10000297
484 Ga0207692_10023121
485 Ga0207642_10026109
486 Ga0207642_10267652
487 Ga0207688_10037798
488 Ga0207685_10005865
489 Ga0207699_10006562
490 Ga0207699_10148879
491 Ga0207699_10215210
492 Ga0207705_10133110
493 Ga0207654_10260518
494 Ga0207707_10105429
495 Ga0207695_10254012
496 Ga0207693_10019152
497 Ga0207693_10035549
498 Ga0207693_10070909
499 Ga0207693_10077025
500 Ga0207693_10092761
501 Ga0207663_10017491
502 Ga0207663_10033452
503 Ga0207663_10095921
504 Ga0207663_10322883
505 Ga0207657_10035501
506 Ga0207657_10202896
507 Ga0207652_10085000
508 Ga0207652_10501092
509 Ga0207646_10109287
510 Ga0207694_10587548
511 Ga0207700_10005676
512 Ga0207700_10019707
513 Ga0207700_10023351
514 Ga0207700_10092414
515 Ga0207700_10105809
516 Ga0207700_10393722
517 Ga0207664_10000495
518 Ga0207664_10002399
519 Ga0207664_10087841
520 Ga0207664_10162330
521 Ga0207664_10179256
522 Ga0207664_10402080
523 Ga0207644_10034250
524 Ga0207690_10240385
525 Ga0207690_10281526
526 Ga0207686_10146266
527 Ga0207709_10046619
528 Ga0207709_10092037
529 Ga0207670_10032608
530 Ga0207669_10128490
531 Ga0207669_10180629
532 Ga0207665_10025157
533 Ga0207665_10170655
534 Ga0207691_10261295
535 Ga0207691_10429061
536 Ga0207691_10576596
537 Ga0207689_10008051
538 Ga0207661_10202460
539 Ga0207661_10663904
540 Ga0207651_10333717
541 Ga0207651_10675476
542 Ga0207712_10133194
543 Ga0207668_10299279
544 Ga0207640_10050866
545 Ga0207640_10094353
546 Ga0207640_10137175
547 Ga0207677_10103922
548 Ga0207703_10121569
549 Ga0207703_10256509
550 Ga0207678_10055706
551 Ga0207678_10106778
552 Ga0207708_10092501
553 Ga0207708_10248944
554 Ga0207702_10058299
555 Ga0207702_10106157
556 Ga0207702_10183742
557 Ga0207648_10057283
558 Ga0207648_10209538
559 Ga0207676_10465506
560 Ga0207674_10205911
561 Ga0207674_10488996
562 Ga0207675_100041868
563 Ga0207675_100083924
564 Ga0207683_10005302
565 Ga0207683_10016820
566 Ga0207698_10028255
567 Ga0207428_10564021
568 Ga0268266_10313728
569 Ga0268266_10541509
570 Ga0268266_11014765
571 Ga0268265_10324785
572 Ga0268264_10217229
573 Ga0307405_10021213
574 Ga0307413_10465685
575 Ga0307407_10252625
576 Ga0307412_10243726
577 Ga0307412_10260052
578 Ga0307416_100129235
579 Ga0307416_100385038
580 Ga0307411_10595637
581 Ga0307415_100000229
582 Ga0373926_0000850
583 Ga0373944_0000427
584 Ga0373936_0000725
585 Ga0373936_0027143
586 Ga0373945_0000016
587 Ga0373945_0073155
588 Ga0373953_0047196
589 Ga0373955_0321644
590 Ga0373961_0028104
591 Ga0373924_0042869
592 Ga0373935_0116799
593 Ga0373935_0155858
594 Ga0373927_0000603
595 Ga0373933_0017769
596 Ga0373933_0156983
597 Ga0373947_0005652
598 Ga0373937_0051146
599 Ga0373937_0169535
600 Ga0373937_0505549
601 Ga0373925_0013934
602 Ga0395899_0131607
603 Ga0395900_0442061
604 Ga0395898_0070475
605 Ga0395898_0374687
606 Ga0395898_0718463
607 Ga0395905_0018474
608 Ga0436364_0023114
609 Ga0436364_0744607
610 Ga0395901_0015678
611 Ga0436365_1480809
612 Ga0436363_0749559
613 Ga0439449_0005218
614 Ga0466963_0035270
615 Ga0466963_0071187
616 Ga0466963_0451891
617 Ga0466970_0306100
618 Ga0466960_0213589
619 Ga0466959_0093256
620 Ga0466958_0122955
621 Ga0466958_0300643
622 Ga0466967_0002144
623 Ga0466967_0062597
624 Ga0466967_0191668
625 Ga0466967_0405010
626 Ga0466967_0484643
627 Ga0466967_0665620
628 Ga0466967_0905252
629 Ga0495641_0016479
630 Ga0495651_0051592
631 Ga0495653_0000660
632 Ga0495653_0007461
633 Ga0495582_0103979
634 Ga0495639_0016573
635 Ga0495639_0034584
636 Ga0495662_0047813
637 Ga0495664_0002456
638 Ga0495664_0067062
639 Ga0495608_0020845
640 Ga0495608_0042591
641 Ga0495618_0031751
642 Ga0495630_0021778
643 Ga0495652_0116191
644 Ga0495652_0178294
645 Ga0495652_0233352
646 Ga0495665_0043082
647 Ga0495640_0015158
648 Ga0495667_0004696
649 Ga0495667_0093635
650 Ga0495667_0205942
651 Ga0495634_0013912
652 Ga0495634_0074403
653 Ga0495635_0006235
654 Ga0495635_0370575
655 Ga0495657_0020284
656 Ga0495657_0034955
657 Ga0495599_0037879
658 Ga0495658_0394075
659 Ga0495613_0114495
660 Ga0495624_0017865
661 Ga0495581_0017834
662 Ga0495604_0124525
663 Ga0495604_0138209
664 Ga0495674_0012698
665 Ga0495674_0132559
666 Ga0495676_0003229
667 Ga0495680_0007542
668 Ga0495680_0010294
669 Ga0495680_0191790
670 Ga0495684_0022777
671 Ga0495684_0032181
672 Ga0495602_0049528
673 Ga0495602_0232224
674 Ga0496100_0041655
675 Ga0496100_0064216
676 Ga0496101_0176186
677 Ga0496102_0037374
678 Ga0496102_0766547
679 Ga0496103_0041122
680 Ga0496104_0010680
681 Ga0496104_0021586
682 Ga0496105_0009735
683 Ga0496105_0027997
684 Ga0496105_0081116
685 Ga0496105_0083018
686 Ga0496106_0089150
687 Ga0496106_0119065
688 Ga0496107_0000787
689 Ga0496107_0085941
690 Ga0496107_0161162
691 Ga0496108_0001060
692 Ga0496108_0002885
693 Ga0496108_0010263
694 Ga0496108_0118636
695 Ga0496109_0002834
696 Ga0496109_0018823
697 Ga0496109_0026840
698 Ga0496109_0133294
699 Ga0496109_0307334
700 Ga0496109_0722689
701 Ga0496110_0053779
702 Ga0496110_0271154
703 Ga0496110_0349360
704 Ga0496111_0011630
705 Ga0496111_0172649
706 Ga0496112_0016250
707 Ga0496112_0040653
708 Ga0496112_0174716
709 Ga0496112_0284660
710 Ga0496113_0004949
711 Ga0496113_0015673
712 Ga0496113_0042296
713 Ga0496114_0029646
714 Ga0496114_0160668
715 Ga0496114_0215693
716 Ga0496114_0331007
717 Ga0496115_0015787
718 Ga0496115_0104419
719 Ga0496115_0136844
720 Ga0496115_0584993
721 Ga0496126_0122373
722 Ga0501067_0093055
723 nmdc:mga05p37_245961_c1
724 nmdc:mga05p37_721248_c1
725 nmdc:mga08y16_343861_c1
726 nmdc:mga08x19_446718_c1
727 nmdc:mga08x19_473666_c1
728 nmdc:mga0a205_390684_c1
729 Ga0495601_0106133
730 Ga0466962_0104710
731 2918501146
732 8057572867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

202

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9631 2 198
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9626 2 204
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9605 6 202
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.9599 2 199
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9591 6 202
ID Description Score Start End Superfamily
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9673 12 207 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9665 2 199 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9629 6 199 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9623 2 204 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9616 6 204 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5N6A565-F1-model_v4 ATP-binding cassette domain-containing protein 0.9973 2 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7H0IH93-F1-model_v4 ABC transporter ATP-binding protein 0.997 2 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2V1NJD8-F1-model_v4 ABC transporter 0.9967 2 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A1H6C8S0-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9967 2 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2M9L4T5-F1-model_v4 ABC transporter 0.9964 2 218 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map