F423903

General Info

Members Datasets Scaffolds Average Seq Length
366 191 732 154

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10074298|Ga0070658_100742985
Length 159
Sequence LHVRSLLAGLALTLALTGCAHKTVQLAGPSTAPTLRGDPAHPDAAKGWVDTRLYFGLGLRDQAEGDQADKGVSEADWRAFLDREVTPRFPSGLSVVDVYGQWQGKNQSRPERLRSKCLVIVYSDTAENRAKVEAIRAAWKQKTGDQSVMRVTEPVDVSF

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 2739367700 Dyella sp. YR388 Isolate Unclassified
190 2884411467 Dyella sp. AD56 Isolate Rhizosphere
191 2928963466 Dyella japonica 1073 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 6.01
Rhizosphere 79.23
Stem 0
Stem Tuber 0
Unclassified 21.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10074298 3300005327 Bacteria 2788
2 JGI25162J39368_1000323 3300002737 Bacteria 41942
3 JGI25162J39368_1000484 3300002737 Bacteria 30422
4 JGI25154J39366_1001511 3300002738 Bacteria 8125
5 JGI25157J39369_1000664 3300002741 Bacteria 19023
6 JGI25157J39369_1002136 3300002741 Bacteria 5537
7 JGI25157J39369_1009465 3300002741 Bacteria 1312
8 JGI25164J39214_1000032 3300002772 Bacteria 144465
9 JGI25165J46597_1000136 3300003214 Bacteria 122521
10 rootH2_10046136 3300003320 Bacteria 4569
11 Ga0055527_1005297 3300003760 Unclassified 1690
12 Ga0055535_1001148 3300003761 Bacteria 15640
13 Ga0055542_1000067 3300003762 Bacteria 154585
14 Ga0055542_1000678 3300003762 Bacteria 27388
15 Ga0055529_1000247 3300003763 Bacteria 66795
16 Ga0070658_10254133 3300005327 Bacteria 1491
17 Ga0070658_10623457 3300005327 Bacteria 935
18 Ga0070683_101534957 3300005329 Unclassified 640
19 Ga0070670_100050550 3300005331 Bacteria 3571
20 Ga0068869_100017465 3300005334 Bacteria 4863
21 Ga0070666_10002360 3300005335 Bacteria 11405
22 Ga0070680_100597108 3300005336 Bacteria 947
23 Ga0070682_100343782 3300005337 Bacteria 1110
24 Ga0070682_100415305 3300005337 Bacteria 1021
25 Ga0070682_101947585 3300005337 Unclassified 516
26 Ga0068868_100002293 3300005338 Bacteria 13234
27 Ga0068868_100769129 3300005338 Unclassified 867
28 Ga0070660_100015061 3300005339 Bacteria 5579
29 Ga0070689_100004372 3300005340 Bacteria 9537
30 Ga0070661_100033871 3300005344 Bacteria 3703
31 Ga0070661_100075878 3300005344 Unclassified 2478
32 Ga0070667_100024369 3300005367 Bacteria 5026
33 Ga0070714_100007370 3300005435 Bacteria 8560
34 Ga0070714_100329992 3300005435 Bacteria 1428
35 Ga0070713_100163806 3300005436 Bacteria 1987
36 Ga0070678_100101009 3300005456 Bacteria 2235
37 Ga0070681_10043962 3300005458 Unclassified 4471
38 Ga0070681_10287858 3300005458 Bacteria 1553
39 Ga0068867_100108818 3300005459 Bacteria 2126
40 Ga0070679_100001231 3300005530 Bacteria 22499
41 Ga0070679_100097945 3300005530 Bacteria 2920
42 Ga0070679_101119590 3300005530 Bacteria 732
43 Ga0070684_100443866 3300005535 Bacteria 1199
44 Ga0068853_100063467 3300005539 Unclassified 3200
45 Ga0068853_100262320 3300005539 Unclassified 1589
46 Ga0068853_100550935 3300005539 Unclassified 1092
47 Ga0068853_100665981 3300005539 Bacteria 991
48 Ga0068853_100818252 3300005539 Unclassified 892
49 Ga0070696_100057396 3300005546 Bacteria 2717
50 Ga0070665_100000069 3300005548 Bacteria 202384
51 Ga0070665_100010634 3300005548 Bacteria 9314
52 Ga0070665_100138249 3300005548 Unclassified 2439
53 Ga0068855_100004369 3300005563 Bacteria 17280
54 Ga0068855_100031923 3300005563 Bacteria 6287
55 Ga0068855_100046635 3300005563 Bacteria 5122
56 Ga0068855_100047123 3300005563 Bacteria 5093
57 Ga0068855_100569384 3300005563 Unclassified 1224
58 Ga0070664_100288106 3300005564 Unclassified 1482
59 Ga0068857_100008860 3300005577 Bacteria 8717
60 Ga0068856_100003607 3300005614 Bacteria 15581
61 Ga0068856_100020121 3300005614 Bacteria 6483
62 Ga0068856_100121673 3300005614 Bacteria 2612
63 Ga0068856_100133422 3300005614 Unclassified 2488
64 Ga0068852_100006065 3300005616 Bacteria 8707
65 Ga0068852_100076187 3300005616 Bacteria 2961
66 Ga0068852_100118620 3300005616 Unclassified 2418
67 Ga0068852_101640646 3300005616 Unclassified 665
68 Ga0068859_100003908 3300005617 Bacteria 15206
69 Ga0068864_100019993 3300005618 Bacteria 5599
70 Ga0068864_100088494 3300005618 Bacteria 2727
71 Ga0068861_100086849 3300005719 Bacteria 2460
72 Ga0068861_100960574 3300005719 Unclassified 813
73 Ga0068851_10043615 3300005834 Bacteria 2261
74 Ga0068851_10124886 3300005834 Bacteria 1387
75 Ga0068851_10440432 3300005834 Unclassified 773
76 Ga0068863_100017803 3300005841 Bacteria 6801
77 Ga0068863_100275174 3300005841 Bacteria 1630
78 Ga0068863_100603334 3300005841 Bacteria 1087
79 Ga0068858_100006766 3300005842 Bacteria 11155
80 Ga0068858_100042379 3300005842 Bacteria 4220
81 Ga0068860_100275463 3300005843 Bacteria 1643
82 Ga0068862_100149678 3300005844 Bacteria 2077
83 Ga0070717_10886719 3300006028 Unclassified 812
84 Ga0070712_100629477 3300006175 Bacteria 910
85 Ga0070712_101019474 3300006175 Bacteria 717
86 Ga0097621_100001305 3300006237 Bacteria 17160
87 Ga0097621_100016543 3300006237 Bacteria 5578
88 Ga0097621_100544150 3300006237 Bacteria 1056
89 Ga0068871_100034969 3300006358 Bacteria 3990
90 Ga0097620_100003908 3300006931 Bacteria 15206
91 Ga0105240_10003300 3300009093 Bacteria 25216
92 Ga0105240_10004345 3300009093 Bacteria 21637
93 Ga0105240_10006055 3300009093 Bacteria 17867
94 Ga0105240_10006260 3300009093 Bacteria 17508
95 Ga0105240_10024312 3300009093 Bacteria 7990
96 Ga0105240_10339895 3300009093 Bacteria 1706
97 Ga0105240_12167381 3300009093 Unclassified 576
98 Ga0105245_10000614 3300009098 Bacteria 32277
99 Ga0105247_10000525 3300009101 Bacteria 31246
100 Ga0105247_10159451 3300009101 Unclassified 1492
101 Ga0105241_10000024 3300009174 Bacteria 140808
102 Ga0105241_10001818 3300009174 Bacteria 16189
103 Ga0105241_10011479 3300009174 Bacteria 6493
104 Ga0105241_11396672 3300009174 Bacteria 670
105 Ga0105248_10001110 3300009177 Bacteria 29879
106 Ga0105237_10002522 3300009545 Bacteria 22684
107 Ga0105237_11639021 3300009545 Unclassified 650
108 Ga0105238_10001603 3300009551 Bacteria 22652
109 Ga0105238_10204850 3300009551 Unclassified 1949
110 Ga0105238_10521506 3300009551 Unclassified 1191
111 Ga0105249_10068649 3300009553 Bacteria 3269
112 Ga0105249_10602268 3300009553 Unclassified 1153
113 Ga0105239_10000020 3300010375 Bacteria 264435
114 Ga0105239_10004140 3300010375 Bacteria 17413
115 Ga0105239_10313844 3300010375 Bacteria 1767
116 Ga0105239_10463814 3300010375 Unclassified 1438
117 Ga0105239_11593704 3300010375 Unclassified 755
118 Ga0105246_10000336 3300011119 Bacteria 24910
119 Ga0105246_10033898 3300011119 Bacteria 3397
120 Ga0157370_10007447 3300013104 Bacteria 11900
121 Ga0157370_10387935 3300013104 Bacteria 1286
122 Ga0157369_10015535 3300013105 Bacteria 8580
123 Ga0157369_10032340 3300013105 Bacteria 5754
124 Ga0157369_10102839 3300013105 Bacteria 3043
125 Ga0157369_10117270 3300013105 Unclassified 2826
126 Ga0157369_10142281 3300013105 Bacteria 2537
127 Ga0157374_10001793 3300013296 Bacteria 18068
128 Ga0157374_10082162 3300013296 Bacteria 3059
129 Ga0157378_10006314 3300013297 Bacteria 10383
130 Ga0157378_10010465 3300013297 Bacteria 8102
131 Ga0157378_10375484 3300013297 Bacteria 1395
132 Ga0163162_10006261 3300013306 Bacteria 11534
133 Ga0163162_10410944 3300013306 Bacteria 1486
134 Ga0157372_10079491 3300013307 Bacteria 3709
135 Ga0157372_10115455 3300013307 Bacteria 3078
136 Ga0157372_10208579 3300013307 Bacteria 2264
137 Ga0157372_10387115 3300013307 Bacteria 1629
138 Ga0157372_10803182 3300013307 Unclassified 1093
139 Ga0157372_11235423 3300013307 Bacteria 863
140 Ga0157375_10001723 3300013308 Bacteria 18777
141 Ga0157375_10094857 3300013308 Bacteria 3053
142 Ga0157375_11178273 3300013308 Bacteria 898
143 Ga0163163_10000249 3300014325 Bacteria 54997
144 Ga0163163_10045372 3300014325 Bacteria 4313
145 Ga0182008_10097203 3300014497 Bacteria 1453
146 Ga0157379_10001475 3300014968 Bacteria 19383
147 Ga0157379_10138308 3300014968 Bacteria 2195
148 Ga0157379_10157164 3300014968 Bacteria 2052
149 Ga0157376_10001327 3300014969 Bacteria 16327
150 Ga0157376_10202745 3300014969 Bacteria 1826
151 Ga0157376_10286946 3300014969 Bacteria 1552
152 Ga0182007_10059573 3300015262 Bacteria 1252
153 Ga0163161_10051736 3300017792 Bacteria 2977
154 Ga0209672_100058 3300025228 Bacteria 211992
155 Ga0209672_100696 3300025228 Bacteria 16849
156 Ga0207427_100081 3300025231 Bacteria 144588
157 Ga0207427_106048 3300025231 Bacteria 1590
158 Ga0209437_100126 3300025233 Bacteria 192521
159 Ga0209437_100168 3300025233 Bacteria 144520
160 Ga0209437_103396 3300025233 Bacteria 2892
161 Ga0209258_100164 3300025242 Bacteria 148838
162 Ga0209646_1001060 3300025246 Bacteria 8257
163 Ga0209026_1000060 3300025250 Bacteria 220052
164 Ga0209026_1000231 3300025250 Bacteria 75789
165 Ga0209026_1001895 3300025250 Bacteria 8502
166 Ga0209148_1000002 3300025254 Bacteria 2399500
167 Ga0209148_1000039 3300025254 Bacteria 482479
168 Ga0209759_1000171 3300025256 Bacteria 109243
169 Ga0209759_1000249 3300025256 Bacteria 80341
170 Ga0209759_1022836 3300025256 Bacteria 1390
171 Ga0209233_1000151 3300025261 Bacteria 176515
172 Ga0209233_1005104 3300025261 Bacteria 4392
173 Ga0209455_1000034 3300025272 Bacteria 483129
174 Ga0207656_10167250 3300025321 Unclassified 1049
175 Ga0207656_10377677 3300025321 Unclassified 710
176 Ga0207680_10526245 3300025903 Unclassified 843
177 Ga0207645_10459441 3300025907 Bacteria 860
178 Ga0207705_10056309 3300025909 Bacteria 2834
179 Ga0207705_10479294 3300025909 Unclassified 966
180 Ga0207654_10050022 3300025911 Unclassified 2400
181 Ga0207654_10400793 3300025911 Unclassified 954
182 Ga0207707_10010358 3300025912 Bacteria 8090
183 Ga0207707_10471934 3300025912 Unclassified 1072
184 Ga0207695_10000047 3300025913 Bacteria 422459
185 Ga0207695_10000318 3300025913 Bacteria 116126
186 Ga0207695_10000382 3300025913 Bacteria 100524
187 Ga0207695_10038161 3300025913 Bacteria 5175
188 Ga0207695_10220515 3300025913 Bacteria 1804
189 Ga0207671_10525550 3300025914 Unclassified 943
190 Ga0207693_10951531 3300025915 Bacteria 657
191 Ga0207657_10008658 3300025919 Bacteria 10302
192 Ga0207649_10614125 3300025920 Unclassified 837
193 Ga0207652_10003219 3300025921 Bacteria 13570
194 Ga0207652_10763040 3300025921 Bacteria 860
195 Ga0207681_10279116 3300025923 Unclassified 1315
196 Ga0207694_10003966 3300025924 Bacteria 11676
197 Ga0207694_10011638 3300025924 Bacteria 6639
198 Ga0207694_10050115 3300025924 Bacteria 3232
199 Ga0207694_11419876 3300025924 Unclassified 586
200 Ga0207700_10377446 3300025928 Bacteria 1239
201 Ga0207664_10002351 3300025929 Bacteria 12504
202 Ga0207644_10023050 3300025931 Unclassified 4259
203 Ga0207670_10002479 3300025936 Bacteria 9687
204 Ga0207711_10003289 3300025941 Bacteria 14051
205 Ga0207711_10005147 3300025941 Bacteria 11079
206 Ga0207689_10001571 3300025942 Bacteria 21635
207 Ga0207689_10047415 3300025942 Bacteria 3548
208 Ga0207661_10001169 3300025944 Bacteria 17539
209 Ga0207679_10162059 3300025945 Unclassified 1832
210 Ga0207679_10193360 3300025945 Unclassified 1694
211 Ga0207667_10000056 3300025949 Bacteria 206107
212 Ga0207667_10049161 3300025949 Bacteria 4457
213 Ga0207667_10392633 3300025949 Unclassified 1413
214 Ga0207712_10291580 3300025961 Unclassified 1335
215 Ga0207712_10530664 3300025961 Bacteria 1010
216 Ga0207658_10026702 3300025986 Bacteria 4050
217 Ga0207658_10112810 3300025986 Unclassified 2152
218 Ga0207677_10001041 3300026023 Bacteria 15247
219 Ga0207703_10007586 3300026035 Bacteria 8601
220 Ga0207703_10051442 3300026035 Bacteria 3338
221 Ga0207639_10199274 3300026041 Unclassified 1716
222 Ga0207639_10418556 3300026041 Bacteria 1211
223 Ga0207639_10476204 3300026041 Unclassified 1137
224 Ga0207678_10036416 3300026067 Unclassified 4283
225 Ga0207678_10129482 3300026067 Bacteria 2152
226 Ga0207702_10003874 3300026078 Bacteria 13484
227 Ga0207702_10016046 3300026078 Bacteria 6202
228 Ga0207702_10327629 3300026078 Bacteria 1460
229 Ga0207702_10845285 3300026078 Unclassified 906
230 Ga0207641_10013686 3300026088 Bacteria 6657
231 Ga0207641_10115531 3300026088 Unclassified 2386
232 Ga0207641_10493743 3300026088 Bacteria 1188
233 Ga0207676_10002053 3300026095 Bacteria 14606
234 Ga0207674_10007858 3300026116 Bacteria 12397
235 Ga0207674_10109592 3300026116 Bacteria 2737
236 Ga0207674_10321455 3300026116 Bacteria 1497
237 Ga0207675_100049514 3300026118 Bacteria 3921
238 Ga0207675_100511844 3300026118 Unclassified 1196
239 Ga0207683_10001501 3300026121 Bacteria 21048
240 Ga0207698_10072721 3300026142 Unclassified 2734
241 Ga0207698_10239723 3300026142 Bacteria 1652
242 Ga0268266_10000001 3300028379 Bacteria 4040580
243 Ga0268266_10009912 3300028379 Bacteria 8369
244 Ga0268266_10395800 3300028379 Unclassified 1305
245 Ga0268265_10113642 3300028380 Bacteria 2216
246 Ga0268264_10001551 3300028381 Bacteria 21301
247 Ga0265334_10073007 3300028573 Bacteria 1275
248 Ga0265318_10008356 3300028577 Bacteria 4615
249 Ga0265336_10075004 3300028666 Bacteria 1010
250 Ga0265338_10005265 3300028800 Bacteria 16950
251 Ga0265338_10015746 3300028800 Bacteria 8283
252 Ga0265338_10260879 3300028800 Unclassified 1274
253 Ga0265338_10275363 3300028800 Bacteria 1232
254 Ga0265338_10791170 3300028800 Unclassified 650
255 Ga0265330_10002689 3300031235 Bacteria 9604
256 Ga0265330_10022414 3300031235 Bacteria 2874
257 Ga0265332_10119435 3300031238 Bacteria 1108
258 Ga0265328_10005580 3300031239 Bacteria 5381
259 Ga0265328_10007084 3300031239 Bacteria 4698
260 Ga0265320_10060603 3300031240 Bacteria 1806
261 Ga0265325_10000189 3300031241 Bacteria 43738
262 Ga0265325_10033112 3300031241 Bacteria 2755
263 Ga0265329_10005519 3300031242 Bacteria 5102
264 Ga0265340_10003556 3300031247 Bacteria 8772
265 Ga0265340_10063601 3300031247 Bacteria 1760
266 Ga0265340_10132139 3300031247 Bacteria 1144
267 Ga0265339_10003437 3300031249 Bacteria 11079
268 Ga0265339_10075721 3300031249 Bacteria 1786
269 Ga0265339_10104697 3300031249 Bacteria 1469
270 Ga0265316_10004388 3300031344 Bacteria 14059
271 Ga0265316_10058870 3300031344 Bacteria 2990
272 Ga0265316_10083695 3300031344 Bacteria 2444
273 Ga0265316_10157445 3300031344 Bacteria 1699
274 Ga0265316_10202051 3300031344 Bacteria 1473
275 Ga0265316_10415526 3300031344 Bacteria 967
276 Ga0265316_10671926 3300031344 Unclassified 731
277 Ga0265313_10002971 3300031595 Bacteria 14127
278 Ga0265313_10111604 3300031595 Bacteria 1201
279 Ga0265313_10199705 3300031595 Bacteria 832
280 Ga0265314_10000036 3300031711 Bacteria 234928
281 Ga0265314_10016057 3300031711 Bacteria 5928
282 Ga0265314_10156843 3300031711 Bacteria 1389
283 Ga0265342_10000377 3300031712 Bacteria 49212
284 Ga0265342_10022191 3300031712 Bacteria 4040
285 Ga0265342_10034901 3300031712 Bacteria 3082
286 Ga0265342_10138264 3300031712 Bacteria 1360
287 Ga0265342_10169953 3300031712 Bacteria 1200
288 Ga0373937_0430860 3300036401 Bacteria 1252
289 Ga0466969_0174945 3300044656 Unclassified 983
290 Ga0466961_0005064 3300044693 Bacteria 8290
291 Ga0466964_0315137 3300044706 Bacteria 793
292 Ga0466968_0045385 3300044735 Bacteria 1865
293 Ga0466970_0000943 3300044765 Bacteria 14045
294 Ga0466957_0001405 3300044842 Bacteria 12542
295 Ga0466959_0003859 3300045049 Bacteria 9945
296 Ga0495629_0022976 3300046459 Bacteria 4445
297 Ga0495629_0076948 3300046459 Bacteria 2329
298 Ga0495638_0000009 3300046460 Bacteria 525345
299 Ga0495580_0244339 3300046472 Unclassified 1230
300 Ga0495580_0887723 3300046472 Bacteria 574
301 Ga0495582_0103047 3300046473 Unclassified 1599
302 Ga0495664_0544001 3300046477 Unclassified 692
303 Ga0495606_0000056 3300046507 Bacteria 198575
304 Ga0495642_0328317 3300046528 Unclassified 671
305 Ga0495652_0181464 3300046529 Unclassified 1615
306 Ga0495665_0138627 3300046531 Unclassified 1272
307 Ga0495622_0014366 3300046557 Bacteria 3677
308 Ga0495625_0019841 3300046660 Bacteria 5202
309 Ga0495657_0272853 3300046675 Unclassified 1014
310 Ga0495669_0099821 3300046684 Unclassified 1347
311 Ga0495649_0008982 3300046694 Bacteria 5973
312 Ga0495674_0280953 3300047319 Unclassified 1364
313 Ga0496100_0092517 3300048903 Bacteria 2067
314 Ga0496100_0255095 3300048903 Unclassified 1299
315 Ga0496101_0010651 3300048904 Bacteria 6076
316 Ga0496102_0537889 3300048905 Bacteria 1091
317 Ga0496102_0999782 3300048905 Unclassified 757
318 Ga0496102_1024202 3300048905 Bacteria 746
319 Ga0496104_0094551 3300048907 Unclassified 2859
320 Ga0496104_0243544 3300048907 Bacteria 1710
321 Ga0496104_0966596 3300048907 Unclassified 756
322 Ga0496104_1493573 3300048907 Unclassified 579
323 Ga0496105_0011200 3300048908 Bacteria 7075
324 Ga0496106_0132421 3300048909 Bacteria 1956
325 Ga0496106_0233830 3300048909 Unclassified 1468
326 Ga0496106_0521842 3300048909 Bacteria 954
327 Ga0496107_0032845 3300048910 Unclassified 3711
328 Ga0496109_0254794 3300048912 Unclassified 1653
329 Ga0496114_0094322 3300048917 Unclassified 2545
330 Ga0496115_0000013 3300048918 Bacteria 213060
331 Ga0496115_0041296 3300048918 Bacteria 3670
332 Ga0496115_0120950 3300048918 Bacteria 2154
333 Ga0496115_0168089 3300048918 Unclassified 1813
334 Ga0496115_0175613 3300048918 Bacteria 1771
335 Ga0496117_0002896 3300048920 Bacteria 20773
336 Ga0496117_0055216 3300048920 Bacteria 2777
337 Ga0496117_0246045 3300048920 Unclassified 978
338 Ga0496118_0000224 3300048921 Bacteria 98813
339 Ga0496118_0002428 3300048921 Bacteria 25088
340 Ga0496118_0034044 3300048921 Bacteria 4166
341 Ga0496119_0000139 3300048922 Bacteria 101548
342 Ga0496119_0007726 3300048922 Bacteria 9609
343 Ga0496120_0000469 3300048923 Bacteria 63212
344 Ga0496120_0001896 3300048923 Bacteria 23193
345 Ga0496121_0000241 3300048924 Bacteria 117612
346 Ga0496121_0073264 3300048924 Bacteria 2745
347 Ga0496121_0200766 3300048924 Bacteria 1421
348 Ga0496121_0404308 3300048924 Bacteria 893
349 Ga0496126_0000935 3300048929 Bacteria 50389
350 Ga0496126_0037827 3300048929 Bacteria 4496
351 Ga0496126_0210666 3300048929 Bacteria 1636
352 Ga0496126_0668813 3300048929 Bacteria 810
353 Ga0495678_207836 3300049459 Unclassified 600
354 Ga0495682_0041102 3300049460 Bacteria 1695
355 Ga0501032_0007833 3300049569 Bacteria 7782
356 Ga0501037_0028546 3300049573 Bacteria 4121
357 Ga0501038_1007635 3300049574 Bacteria 611
358 Ga0501039_0848356 3300049575 Bacteria 712
359 Ga0501043_0070109 3300049579 Bacteria 2753
360 Ga0501046_0017505 3300049580 Bacteria 5977
361 Ga0501047_0056472 3300049581 Bacteria 3797
362 Ga0501035_0670289 3300049822 Bacteria 839
363 Ga0495619_0117451 3300053085 Unclassified 1822
364 2739731257 2739367700 Bacteria 4747630
365 2884413393 2884411467 Bacteria 5246714
366 2928964590 2928963466 Bacteria 5165703
367 Ga0070658_10074298
368 JGI25162J39368_1000323
369 JGI25162J39368_1000484
370 JGI25154J39366_1001511
371 JGI25157J39369_1000664
372 JGI25157J39369_1002136
373 JGI25157J39369_1009465
374 JGI25164J39214_1000032
375 JGI25165J46597_1000136
376 rootH2_10046136
377 Ga0055527_1005297
378 Ga0055535_1001148
379 Ga0055542_1000067
380 Ga0055542_1000678
381 Ga0055529_1000247
382 Ga0070658_10254133
383 Ga0070658_10623457
384 Ga0070683_101534957
385 Ga0070670_100050550
386 Ga0068869_100017465
387 Ga0070666_10002360
388 Ga0070680_100597108
389 Ga0070682_100343782
390 Ga0070682_100415305
391 Ga0070682_101947585
392 Ga0068868_100002293
393 Ga0068868_100769129
394 Ga0070660_100015061
395 Ga0070689_100004372
396 Ga0070661_100033871
397 Ga0070661_100075878
398 Ga0070667_100024369
399 Ga0070714_100007370
400 Ga0070714_100329992
401 Ga0070713_100163806
402 Ga0070678_100101009
403 Ga0070681_10043962
404 Ga0070681_10287858
405 Ga0068867_100108818
406 Ga0070679_100001231
407 Ga0070679_100097945
408 Ga0070679_101119590
409 Ga0070684_100443866
410 Ga0068853_100063467
411 Ga0068853_100262320
412 Ga0068853_100550935
413 Ga0068853_100665981
414 Ga0068853_100818252
415 Ga0070696_100057396
416 Ga0070665_100000069
417 Ga0070665_100010634
418 Ga0070665_100138249
419 Ga0068855_100004369
420 Ga0068855_100031923
421 Ga0068855_100046635
422 Ga0068855_100047123
423 Ga0068855_100569384
424 Ga0070664_100288106
425 Ga0068857_100008860
426 Ga0068856_100003607
427 Ga0068856_100020121
428 Ga0068856_100121673
429 Ga0068856_100133422
430 Ga0068852_100006065
431 Ga0068852_100076187
432 Ga0068852_100118620
433 Ga0068852_101640646
434 Ga0068859_100003908
435 Ga0068864_100019993
436 Ga0068864_100088494
437 Ga0068861_100086849
438 Ga0068861_100960574
439 Ga0068851_10043615
440 Ga0068851_10124886
441 Ga0068851_10440432
442 Ga0068863_100017803
443 Ga0068863_100275174
444 Ga0068863_100603334
445 Ga0068858_100006766
446 Ga0068858_100042379
447 Ga0068860_100275463
448 Ga0068862_100149678
449 Ga0070717_10886719
450 Ga0070712_100629477
451 Ga0070712_101019474
452 Ga0097621_100001305
453 Ga0097621_100016543
454 Ga0097621_100544150
455 Ga0068871_100034969
456 Ga0097620_100003908
457 Ga0105240_10003300
458 Ga0105240_10004345
459 Ga0105240_10006055
460 Ga0105240_10006260
461 Ga0105240_10024312
462 Ga0105240_10339895
463 Ga0105240_12167381
464 Ga0105245_10000614
465 Ga0105247_10000525
466 Ga0105247_10159451
467 Ga0105241_10000024
468 Ga0105241_10001818
469 Ga0105241_10011479
470 Ga0105241_11396672
471 Ga0105248_10001110
472 Ga0105237_10002522
473 Ga0105237_11639021
474 Ga0105238_10001603
475 Ga0105238_10204850
476 Ga0105238_10521506
477 Ga0105249_10068649
478 Ga0105249_10602268
479 Ga0105239_10000020
480 Ga0105239_10004140
481 Ga0105239_10313844
482 Ga0105239_10463814
483 Ga0105239_11593704
484 Ga0105246_10000336
485 Ga0105246_10033898
486 Ga0157370_10007447
487 Ga0157370_10387935
488 Ga0157369_10015535
489 Ga0157369_10032340
490 Ga0157369_10102839
491 Ga0157369_10117270
492 Ga0157369_10142281
493 Ga0157374_10001793
494 Ga0157374_10082162
495 Ga0157378_10006314
496 Ga0157378_10010465
497 Ga0157378_10375484
498 Ga0163162_10006261
499 Ga0163162_10410944
500 Ga0157372_10079491
501 Ga0157372_10115455
502 Ga0157372_10208579
503 Ga0157372_10387115
504 Ga0157372_10803182
505 Ga0157372_11235423
506 Ga0157375_10001723
507 Ga0157375_10094857
508 Ga0157375_11178273
509 Ga0163163_10000249
510 Ga0163163_10045372
511 Ga0182008_10097203
512 Ga0157379_10001475
513 Ga0157379_10138308
514 Ga0157379_10157164
515 Ga0157376_10001327
516 Ga0157376_10202745
517 Ga0157376_10286946
518 Ga0182007_10059573
519 Ga0163161_10051736
520 Ga0209672_100058
521 Ga0209672_100696
522 Ga0207427_100081
523 Ga0207427_106048
524 Ga0209437_100126
525 Ga0209437_100168
526 Ga0209437_103396
527 Ga0209258_100164
528 Ga0209646_1001060
529 Ga0209026_1000060
530 Ga0209026_1000231
531 Ga0209026_1001895
532 Ga0209148_1000002
533 Ga0209148_1000039
534 Ga0209759_1000171
535 Ga0209759_1000249
536 Ga0209759_1022836
537 Ga0209233_1000151
538 Ga0209233_1005104
539 Ga0209455_1000034
540 Ga0207656_10167250
541 Ga0207656_10377677
542 Ga0207680_10526245
543 Ga0207645_10459441
544 Ga0207705_10056309
545 Ga0207705_10479294
546 Ga0207654_10050022
547 Ga0207654_10400793
548 Ga0207707_10010358
549 Ga0207707_10471934
550 Ga0207695_10000047
551 Ga0207695_10000318
552 Ga0207695_10000382
553 Ga0207695_10038161
554 Ga0207695_10220515
555 Ga0207671_10525550
556 Ga0207693_10951531
557 Ga0207657_10008658
558 Ga0207649_10614125
559 Ga0207652_10003219
560 Ga0207652_10763040
561 Ga0207681_10279116
562 Ga0207694_10003966
563 Ga0207694_10011638
564 Ga0207694_10050115
565 Ga0207694_11419876
566 Ga0207700_10377446
567 Ga0207664_10002351
568 Ga0207644_10023050
569 Ga0207670_10002479
570 Ga0207711_10003289
571 Ga0207711_10005147
572 Ga0207689_10001571
573 Ga0207689_10047415
574 Ga0207661_10001169
575 Ga0207679_10162059
576 Ga0207679_10193360
577 Ga0207667_10000056
578 Ga0207667_10049161
579 Ga0207667_10392633
580 Ga0207712_10291580
581 Ga0207712_10530664
582 Ga0207658_10026702
583 Ga0207658_10112810
584 Ga0207677_10001041
585 Ga0207703_10007586
586 Ga0207703_10051442
587 Ga0207639_10199274
588 Ga0207639_10418556
589 Ga0207639_10476204
590 Ga0207678_10036416
591 Ga0207678_10129482
592 Ga0207702_10003874
593 Ga0207702_10016046
594 Ga0207702_10327629
595 Ga0207702_10845285
596 Ga0207641_10013686
597 Ga0207641_10115531
598 Ga0207641_10493743
599 Ga0207676_10002053
600 Ga0207674_10007858
601 Ga0207674_10109592
602 Ga0207674_10321455
603 Ga0207675_100049514
604 Ga0207675_100511844
605 Ga0207683_10001501
606 Ga0207698_10072721
607 Ga0207698_10239723
608 Ga0268266_10000001
609 Ga0268266_10009912
610 Ga0268266_10395800
611 Ga0268265_10113642
612 Ga0268264_10001551
613 Ga0265334_10073007
614 Ga0265318_10008356
615 Ga0265336_10075004
616 Ga0265338_10005265
617 Ga0265338_10015746
618 Ga0265338_10260879
619 Ga0265338_10275363
620 Ga0265338_10791170
621 Ga0265330_10002689
622 Ga0265330_10022414
623 Ga0265332_10119435
624 Ga0265328_10005580
625 Ga0265328_10007084
626 Ga0265320_10060603
627 Ga0265325_10000189
628 Ga0265325_10033112
629 Ga0265329_10005519
630 Ga0265340_10003556
631 Ga0265340_10063601
632 Ga0265340_10132139
633 Ga0265339_10003437
634 Ga0265339_10075721
635 Ga0265339_10104697
636 Ga0265316_10004388
637 Ga0265316_10058870
638 Ga0265316_10083695
639 Ga0265316_10157445
640 Ga0265316_10202051
641 Ga0265316_10415526
642 Ga0265316_10671926
643 Ga0265313_10002971
644 Ga0265313_10111604
645 Ga0265313_10199705
646 Ga0265314_10000036
647 Ga0265314_10016057
648 Ga0265314_10156843
649 Ga0265342_10000377
650 Ga0265342_10022191
651 Ga0265342_10034901
652 Ga0265342_10138264
653 Ga0265342_10169953
654 Ga0373937_0430860
655 Ga0466969_0174945
656 Ga0466961_0005064
657 Ga0466964_0315137
658 Ga0466968_0045385
659 Ga0466970_0000943
660 Ga0466957_0001405
661 Ga0466959_0003859
662 Ga0495629_0022976
663 Ga0495629_0076948
664 Ga0495638_0000009
665 Ga0495580_0244339
666 Ga0495580_0887723
667 Ga0495582_0103047
668 Ga0495664_0544001
669 Ga0495606_0000056
670 Ga0495642_0328317
671 Ga0495652_0181464
672 Ga0495665_0138627
673 Ga0495622_0014366
674 Ga0495625_0019841
675 Ga0495657_0272853
676 Ga0495669_0099821
677 Ga0495649_0008982
678 Ga0495674_0280953
679 Ga0496100_0092517
680 Ga0496100_0255095
681 Ga0496101_0010651
682 Ga0496102_0537889
683 Ga0496102_0999782
684 Ga0496102_1024202
685 Ga0496104_0094551
686 Ga0496104_0243544
687 Ga0496104_0966596
688 Ga0496104_1493573
689 Ga0496105_0011200
690 Ga0496106_0132421
691 Ga0496106_0233830
692 Ga0496106_0521842
693 Ga0496107_0032845
694 Ga0496109_0254794
695 Ga0496114_0094322
696 Ga0496115_0000013
697 Ga0496115_0041296
698 Ga0496115_0120950
699 Ga0496115_0168089
700 Ga0496115_0175613
701 Ga0496117_0002896
702 Ga0496117_0055216
703 Ga0496117_0246045
704 Ga0496118_0000224
705 Ga0496118_0002428
706 Ga0496118_0034044
707 Ga0496119_0000139
708 Ga0496119_0007726
709 Ga0496120_0000469
710 Ga0496120_0001896
711 Ga0496121_0000241
712 Ga0496121_0073264
713 Ga0496121_0200766
714 Ga0496121_0404308
715 Ga0496126_0000935
716 Ga0496126_0037827
717 Ga0496126_0210666
718 Ga0496126_0668813
719 Ga0495678_207836
720 Ga0495682_0041102
721 Ga0501032_0007833
722 Ga0501037_0028546
723 Ga0501038_1007635
724 Ga0501039_0848356
725 Ga0501043_0070109
726 Ga0501046_0017505
727 Ga0501047_0056472
728 Ga0501035_0670289
729 Ga0495619_0117451
730 2739731257
731 2884413393
732 2928964590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12098

DUF3574

Protein of unknown function (DUF3574)

50

159

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4usi-assembly1.cif.gz_C nitrogen regulatory protein pii from chlamydomonas reinhardtii in complex with mgatp and 2-oxoglutarate 0.759 64 166
4ush-assembly1.cif.gz_B nitrogen regulatory protein pii from chlamydomonas reinhardtii in unliganded state 0.7469 64 166
1o5j-assembly1.cif.gz_A crystal structure of periplasmic divalent cation tolerance protein (tm1056) from thermotoga maritima at 1.95 a resolution 0.7043 63 168
2gnk-assembly1.cif.gz_A glnk, a signal protein from e. coli 0.6998 65 167
4usi-assembly1.cif.gz_A nitrogen regulatory protein pii from chlamydomonas reinhardtii in complex with mgatp and 2-oxoglutarate 0.6992 64 166
ID Description Score Start End Superfamily
af_Q95Y94_23_239_2.70.170.10 Mainly Beta;Distorted Sandwich;Acetylcholine Binding Protein; Chain: A,;Neurotransmitter-gated ion-channel ligand-binding domain 0.8153 102 132 2.70.170.10
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.759 64 166 3.30.70.120
af_F1R808_24_246_2.70.170.10 Mainly Beta;Distorted Sandwich;Acetylcholine Binding Protein; Chain: A,;Neurotransmitter-gated ion-channel ligand-binding domain 0.7046 102 134 2.70.170.10
3l7pE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6978 64 168 3.30.70.120
af_P69488_1_112_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6887 63 168 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A6A7YDQ4-F1-model_v4 DUF3574 domain-containing protein 0.9181 64 170
AF-A0A7V2H8B9-F1-model_v4 DUF3574 domain-containing protein 0.9124 64 170
AF-A0A7C3KEI3-F1-model_v4 DUF3574 domain-containing protein 0.9106 64 165
AF-A0A7X2CHU3-F1-model_v4 DUF3574 domain-containing protein 0.9073 65 170
AF-A0A661S2N5-F1-model_v4 DUF3574 domain-containing protein 0.9055 63 170 GO:0016020

Map