F423869

General Info

Members Datasets Scaffolds Average Seq Length
365 205 335 164

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2945945610|2945945854
Length 174
Sequence LLEVCKKAMTSAYLIWLLFIAIYDFRQRRVPNWLVLAGAFLALAALSTGMAPIEQDWTAALLGAGVGFGFLLLFYALRVMGAGDVKFAGALGLWVGLSALPPVWLIGSLLAGLHAALWLALQRWPVFPRLSLVLFGPSSSPQGQPAPTRVRFIPYAAYLALAAAVWMVWGRQGS

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221672 Variovorax sp. Root434 Isolate Unclassified
8 2738541277 Variovorax sp. GV051 Isolate Unclassified
9 2738543019 Variovorax sp. GV040 Isolate Unclassified
10 2818991446 Variovorax sp. 1180 Isolate Unclassified
11 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
12 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
13 2842677519 Variovorax sp. R-72495 Isolate Unclassified
14 2885198086 Variovorax sp. 679 Isolate Unclassified
15 2885211737 Variovorax sp. 553 Isolate Unclassified
16 2899924645 Variovorax sp. 369 Isolate Unclassified
17 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
18 2904456579 Variovorax sp. 2002 Isolate Unclassified
19 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
20 2928037797 Variovorax sp. 1126 Isolate Unclassified
21 2928044640 Variovorax sp. 1128 Isolate Unclassified
22 2928051484 Variovorax sp. 1133 Isolate Unclassified
23 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
24 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
25 2929520902 Variovorax beijingensis 502 Isolate Unclassified
26 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
27 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
28 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
29 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
30 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
124 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
125 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
126 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
127 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
128 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
129 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
144 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
169 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
178 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
179 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
180 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
184 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
185 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
186 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
187 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
188 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
189 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
192 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
195 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
201 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
202 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
203 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.51
Metatranscriptomes 0.27
Isolates 8.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 49.59
Nodule 1.37
Rhizoplane 1.1
Rhizosphere 36.71
Stem 0
Stem Tuber 0
Unclassified 11.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10035598 3300001979 Bacteria 1554
2 JGI24739J22299_10107532 3300001989 Bacteria 839
3 JGI25158J39367_1001784 3300002739 Bacteria 3664
4 JGI25158J39367_1006154 3300002739 Bacteria 1732
5 JGI25152J39213_1002717 3300002773 Bacteria 6461
6 JGI25152J39213_1006012 3300002773 Bacteria 3401
7 JGI25152J39213_1006699 3300002773 Bacteria 3078
8 JGI25150J39212_1000692 3300002774 Bacteria 12226
9 JGI25159J45721_1005264 3300002987 Bacteria 4087
10 JGI25159J45721_1007000 3300002987 Bacteria 3292
11 JGI25159J45721_1012020 3300002987 Bacteria 2087
12 JGI25151J46595_10000966 3300003187 Bacteria 21838
13 JGI25151J46595_10001112 3300003187 Bacteria 19723
14 JGI25151J46595_10005646 3300003187 Bacteria 6431
15 JGI25151J46595_10015221 3300003187 Bacteria 3401
16 JGI25151J46595_10017723 3300003187 Bacteria 3078
17 JGI25153J46596_10005754 3300003215 Bacteria 6461
18 JGI25153J46596_10013693 3300003215 Bacteria 3414
19 JGI25153J46596_10015702 3300003215 Bacteria 3070
20 rootH2_10132772 3300003320 Bacteria 2444
21 rootL2_10097100 3300003322 Bacteria 5926
22 rootH1_10027375 3300003323 Bacteria 1165
23 rootH1_10214128 3300003323 Bacteria 1125
24 JGI25160J50197_1004016 3300003354 Bacteria 6422
25 JGI25160J50197_1009525 3300003354 Bacteria 3593
26 JGI25161J50226_1002770 3300003374 Bacteria 4320
27 JGI25161J50226_1004393 3300003374 Bacteria 2959
28 Ga0055527_1025152 3300003760 Bacteria 604
29 Ga0055535_1001074 3300003761 Bacteria 16812
30 Ga0055542_1000074 3300003762 Bacteria 141185
31 Ga0055526_1006319 3300003771 Bacteria 6470
32 Ga0055526_1006793 3300003771 Bacteria 6107
33 Ga0055537_1000095 3300003773 Bacteria 66096
34 Ga0055537_1002328 3300003773 Bacteria 6470
35 Ga0055537_1005003 3300003773 Bacteria 3638
36 Ga0055537_1005698 3300003773 Bacteria 3292
37 Ga0055524_1004444 3300003775 Bacteria 6470
38 Ga0055524_1010884 3300003775 Bacteria 3593
39 Ga0055536_1007882 3300003781 Bacteria 4680
40 Ga0055534_1000068 3300003784 Bacteria 80722
41 Ga0055534_1001957 3300003784 Bacteria 7550
42 Ga0055534_1004545 3300003784 Bacteria 3978
43 Ga0055534_1005667 3300003784 Bacteria 3292
44 Ga0055528_1000215 3300003790 Bacteria 48667
45 Ga0055528_1004753 3300003790 Bacteria 6470
46 Ga0055528_1010959 3300003790 Bacteria 3638
47 Ga0055528_1012474 3300003790 Bacteria 3292
48 Ga0055530_10000437 3300003791 Bacteria 37027
49 Ga0055540_1000662 3300003792 Bacteria 24155
50 Ga0055540_1006221 3300003792 Bacteria 4792
51 Ga0055540_1013051 3300003792 Bacteria 2562
52 Ga0055531_10006612 3300003794 Bacteria 6534
53 Ga0055531_10011941 3300003794 Bacteria 4132
54 Ga0055543_1002534 3300004625 Bacteria 5971
55 Ga0055543_1012149 3300004625 Bacteria 1741
56 Ga0065165_1005124 3300005262 Bacteria 7588
57 Ga0065165_1014669 3300005262 Bacteria 3031
58 Ga0065165_1057122 3300005262 Bacteria 1082
59 Ga0065704_10124556 3300005289 Bacteria 1716
60 Ga0070662_100035244 3300005457 Bacteria 3533
61 Ga0070662_100062362 3300005457 Bacteria 2723
62 Ga0068853_100011188 3300005539 Bacteria 7280
63 Ga0068853_100141248 3300005539 Bacteria 2162
64 Ga0068855_100259596 3300005563 Bacteria 1936
65 Ga0068857_100170490 3300005577 Bacteria 1978
66 Ga0068854_100370630 3300005578 Bacteria 1177
67 Ga0068856_100418924 3300005614 Bacteria 1359
68 Ga0068862_100059571 3300005844 Bacteria 3279
69 Ga0075365_10001481 3300006038 Bacteria 10688
70 Ga0075368_10109502 3300006042 Bacteria 1138
71 Ga0075363_100010185 3300006048 Bacteria 4448
72 Ga0075363_100040725 3300006048 Bacteria 2449
73 Ga0075363_100042531 3300006048 Bacteria 2401
74 Ga0075363_100113465 3300006048 Bacteria 1508
75 Ga0075364_10669832 3300006051 Bacteria 708
76 Ga0075432_10003340 3300006058 Bacteria 5420
77 Ga0075432_10083775 3300006058 Bacteria 1159
78 Ga0075362_10006225 3300006177 Bacteria 4435
79 Ga0075362_10018195 3300006177 Bacteria 2903
80 Ga0075362_10122360 3300006177 Bacteria 1232
81 Ga0075362_10301238 3300006177 Bacteria 795
82 Ga0075367_10111193 3300006178 Bacteria 1682
83 Ga0075367_10143477 3300006178 Bacteria 1480
84 Ga0075366_10053341 3300006195 Bacteria 2402
85 Ga0097621_100582842 3300006237 Bacteria 1021
86 Ga0075370_10000052 3300006353 Bacteria 35240
87 Ga0075370_10000608 3300006353 Bacteria 13846
88 Ga0075370_10000650 3300006353 Bacteria 13482
89 Ga0075370_10116042 3300006353 Bacteria 1556
90 Ga0099826_10002922 3300006948 Bacteria 11345
91 Ga0099826_10024907 3300006948 Bacteria 4441
92 Ga0099826_10093503 3300006948 Bacteria 1832
93 Ga0105244_10004764 3300009036 Bacteria 9236
94 Ga0105244_10009718 3300009036 Bacteria 5884
95 Ga0105244_10066936 3300009036 Bacteria 1798
96 Ga0105243_10020301 3300009148 Bacteria 5038
97 Ga0105243_10080909 3300009148 Bacteria 2651
98 Ga0105243_10342505 3300009148 Bacteria 1370
99 Ga0105237_10084840 3300009545 Bacteria 3157
100 Ga0105237_10366154 3300009545 Bacteria 1446
101 Ga0105238_10327177 3300009551 Bacteria 1519
102 Ga0105239_10032631 3300010375 Bacteria 5722
103 Ga0105239_11018936 3300010375 Bacteria 952
104 Ga0105246_10075196 3300011119 Bacteria 2390
105 Ga0157339_1003387 3300012505 Bacteria 1148
106 Ga0157339_1040517 3300012505 Bacteria 583
107 Ga0157373_10004049 3300013100 Bacteria 11043
108 Ga0157373_10014593 3300013100 Bacteria 5759
109 Ga0157373_10134636 3300013100 Bacteria 1737
110 Ga0157371_10159175 3300013102 Bacteria 1612
111 Ga0157370_10003332 3300013104 Bacteria 18929
112 Ga0157370_10036402 3300013104 Bacteria 4776
113 Ga0157370_10179910 3300013104 Bacteria 1965
114 Ga0157369_10009375 3300013105 Bacteria 11192
115 Ga0157372_10037198 3300013307 Bacteria 5366
116 Ga0182008_10002207 3300014497 Bacteria 12350
117 Ga0182008_10072597 3300014497 Bacteria 1693
118 Ga0182008_10323855 3300014497 Bacteria 812
119 Ga0182006_1008645 3300015261 Bacteria 4611
120 Ga0182006_1100589 3300015261 Bacteria 1027
121 Ga0182006_1109114 3300015261 Bacteria 973
122 Ga0182006_1111786 3300015261 Bacteria 958
123 Ga0182007_10000958 3300015262 Bacteria 15849
124 Ga0163161_10329360 3300017792 Bacteria 1209
125 Ga0209436_101982 3300025208 Bacteria 6536
126 Ga0209436_103697 3300025208 Bacteria 3980
127 Ga0209672_101028 3300025228 Bacteria 12054
128 Ga0209147_101428 3300025229 Bacteria 8692
129 Ga0209258_100176 3300025242 Bacteria 141261
130 Ga0207425_1000133 3300025245 Bacteria 67802
131 Ga0207425_1020365 3300025245 Bacteria 1419
132 Ga0209148_1000033 3300025254 Bacteria 555508
133 Ga0209129_1000186 3300025258 Bacteria 85793
134 Ga0209129_1001080 3300025258 Bacteria 16023
135 Ga0209129_1005846 3300025258 Bacteria 4187
136 Ga0209129_1007022 3300025258 Bacteria 3461
137 Ga0209565_1000020 3300025263 Bacteria 432627
138 Ga0209565_1000190 3300025263 Bacteria 75207
139 Ga0209565_1005468 3300025263 Bacteria 3690
140 Ga0209565_1006301 3300025263 Bacteria 3344
141 Ga0209673_1000209 3300025273 Bacteria 117670
142 Ga0209673_1000350 3300025273 Bacteria 84527
143 Ga0209673_1000393 3300025273 Bacteria 78531
144 Ga0209130_1000372 3300025284 Bacteria 50940
145 Ga0209130_1002726 3300025284 Bacteria 8372
146 Ga0209130_1006745 3300025284 Bacteria 3671
147 Ga0209675_1000014 3300025291 Bacteria 421902
148 Ga0209675_1000902 3300025291 Bacteria 19011
149 Ga0209675_1003060 3300025291 Bacteria 8201
150 Ga0209675_1005108 3300025291 Bacteria 5596
151 Ga0209676_1000048 3300025292 Bacteria 403716
152 Ga0209676_1000304 3300025292 Bacteria 98482
153 Ga0209676_1002013 3300025292 Bacteria 16017
154 Ga0209676_1019803 3300025292 Bacteria 2305
155 Ga0209676_1024277 3300025292 Bacteria 1968
156 Ga0209676_1044050 3300025292 Bacteria 1227
157 Ga0209025_1000324 3300025294 Bacteria 106257
158 Ga0209025_1001380 3300025294 Bacteria 32437
159 Ga0209025_1001614 3300025294 Bacteria 28196
160 Ga0209025_1012180 3300025294 Bacteria 5549
161 Ga0209025_1013156 3300025294 Bacteria 5226
162 Ga0209025_1016396 3300025294 Bacteria 4376
163 Ga0209564_1000417 3300025295 Bacteria 74808
164 Ga0209564_1005140 3300025295 Bacteria 7602
165 Ga0209564_1012835 3300025295 Bacteria 3613
166 Ga0209758_1000092 3300025297 Bacteria 241910
167 Ga0209758_1003764 3300025297 Bacteria 13403
168 Ga0209758_1017703 3300025297 Bacteria 3529
169 Ga0209050_1000012 3300025298 Bacteria 813717
170 Ga0209050_1004084 3300025298 Bacteria 10213
171 Ga0209050_1029467 3300025298 Bacteria 1755
172 Ga0209050_1051115 3300025298 Bacteria 1045
173 Ga0209256_1000094 3300025299 Bacteria 208177
174 Ga0209256_1000095 3300025299 Bacteria 206120
175 Ga0209256_1011045 3300025299 Bacteria 3675
176 Ga0207426_1000084 3300025302 Bacteria 298123
177 Ga0207426_1000161 3300025302 Bacteria 172765
178 Ga0207426_1010707 3300025302 Bacteria 3544
179 Ga0209051_1000117 3300025303 Bacteria 150156
180 Ga0209051_1000273 3300025303 Bacteria 84847
181 Ga0209051_1050594 3300025303 Bacteria 1390
182 Ga0209257_1000024 3300025304 Bacteria 726068
183 Ga0209257_1004734 3300025304 Bacteria 10176
184 Ga0209257_1006794 3300025304 Bacteria 7199
185 Ga0207655_1004770 3300025728 Bacteria 9456
186 Ga0207671_10018941 3300025914 Bacteria 5273
187 Ga0207671_10274594 3300025914 Bacteria 1328
188 Ga0207706_10040414 3300025933 Bacteria 4133
189 Ga0207709_10003682 3300025935 Bacteria 9021
190 Ga0207709_10012572 3300025935 Bacteria 4664
191 Ga0207709_10058738 3300025935 Bacteria 2391
192 Ga0207709_10111334 3300025935 Bacteria 1831
193 Ga0207709_10327732 3300025935 Bacteria 1148
194 Ga0207639_10130479 3300026041 Bacteria 2080
195 Ga0207639_10269670 3300026041 Bacteria 1492
196 Ga0207702_10152298 3300026078 Bacteria 2104
197 Ga0209282_1000169 3300027666 Bacteria 36909
198 Ga0207428_10044731 3300027907 Bacteria 3570
199 Ga0207428_10490867 3300027907 Bacteria 893
200 Ga0268265_10036514 3300028380 Bacteria 3600
201 Ga0307515_10160701 3300028794 Bacteria 2293
202 Ga0316177_1186783 3300030731 Bacteria 3096
203 Ga0316176_1109314 3300030732 Bacteria 1016
204 Ga0314311_1060445 3300030733 Bacteria 897
205 Ga0316179_1052133 3300030734 Bacteria 4122
206 Ga0316178_1025359 3300030735 Bacteria 5651
207 Ga0316183_1034957 3300030742 Bacteria 2949
208 Ga0316182_1048437 3300030745 Bacteria 2642
209 Ga0307408_100023025 3300031548 Bacteria 4239
210 Ga0307408_100038370 3300031548 Bacteria 3379
211 Ga0307405_10000303 3300031731 Bacteria 18168
212 Ga0307405_10016512 3300031731 Bacteria 4028
213 Ga0307405_10279033 3300031731 Bacteria 1257
214 Ga0307413_10463042 3300031824 Bacteria 1009
215 Ga0307410_10270433 3300031852 Bacteria 1329
216 Ga0307406_10064188 3300031901 Bacteria 2382
217 Ga0307406_10397180 3300031901 Bacteria 1092
218 Ga0307407_10013137 3300031903 Bacteria 4006
219 Ga0307412_10070656 3300031911 Bacteria 2380
220 Ga0307412_10091144 3300031911 Bacteria 2133
221 Ga0307412_10144329 3300031911 Bacteria 1747
222 Ga0307412_10200516 3300031911 Bacteria 1515
223 Ga0307412_10365669 3300031911 Bacteria 1163
224 Ga0307412_10779777 3300031911 Bacteria 828
225 Ga0307409_101658896 3300031995 Bacteria 668
226 Ga0307416_100212588 3300032002 Bacteria 1846
227 Ga0307416_102389488 3300032002 Unclassified 628
228 Ga0307411_10066855 3300032005 Bacteria 2416
229 Ga0307411_10074929 3300032005 Bacteria 2308
230 Ga0307411_10180899 3300032005 Bacteria 1600
231 Ga0307411_10619331 3300032005 Bacteria 933
232 Ga0439465_0013311 3300041413 Bacteria 2568
233 Ga0451807_0399926 3300041486 Bacteria 901
234 Ga0439449_0268089 3300042007 Bacteria 643
235 Ga0450906_006989 3300042145 Bacteria 2247
236 Ga0450918_001414 3300042531 Bacteria 4770
237 Ga0450918_001549 3300042531 Bacteria 4542
238 Ga0450918_012478 3300042531 Bacteria 1482
239 Ga0495616_0000933 3300046513 Bacteria 21041
240 Ga0495631_0000176 3300046518 Bacteria 43388
241 Ga0495654_0003294 3300046530 Bacteria 9952
242 Ga0495654_0019577 3300046530 Bacteria 3540
243 Ga0495621_0001613 3300046539 Bacteria 5889
244 Ga0495668_0228406 3300046616 Bacteria 1019
245 Ga0495625_0000045 3300046660 Bacteria 202475
246 Ga0495625_0004736 3300046660 Bacteria 12736
247 Ga0495625_0054583 3300046660 Bacteria 2852
248 Ga0495625_0189507 3300046660 Bacteria 1363
249 Ga0495661_0152943 3300046665 Bacteria 1245
250 Ga0495588_0041874 3300046674 Bacteria 2340
251 Ga0495588_0095710 3300046674 Bacteria 1557
252 Ga0495671_0001321 3300046692 Bacteria 16827
253 Ga0495660_0081884 3300046810 Bacteria 1691
254 Ga0495660_0144751 3300046810 Bacteria 1179
255 Ga0495676_0050257 3300047321 Bacteria 3345
256 Ga0495676_0055055 3300047321 Bacteria 3157
257 Ga0495593_0007620 3300047673 Bacteria 6321
258 Ga0495614_0286964 3300048089 Bacteria 758
259 Ga0496117_0014962 3300048920 Bacteria 6647
260 Ga0496117_0025796 3300048920 Bacteria 4610
261 Ga0496117_0107236 3300048920 Bacteria 1750
262 Ga0496117_0126201 3300048920 Bacteria 1561
263 Ga0496117_0158503 3300048920 Bacteria 1329
264 Ga0496118_0018910 3300048921 Bacteria 6180
265 Ga0496118_0283638 3300048921 Bacteria 920
266 Ga0496121_0014563 3300048924 Bacteria 8332
267 Ga0496121_0047132 3300048924 Bacteria 3680
268 Ga0496121_0184666 3300048924 Bacteria 1501
269 Ga0496121_0194013 3300048924 Bacteria 1453
270 Ga0496122_0061464 3300048925 Bacteria 2757
271 Ga0496122_0099718 3300048925 Bacteria 1946
272 Ga0496123_0069826 3300048926 Bacteria 2203
273 Ga0496124_0017973 3300048927 Bacteria 6645
274 Ga0496124_0085832 3300048927 Bacteria 2578
275 Ga0496124_0590298 3300048927 Bacteria 725
276 Ga0496125_0030283 3300048928 Bacteria 4844
277 Ga0496125_0048473 3300048928 Bacteria 3542
278 Ga0496125_0049440 3300048928 Bacteria 3494
279 Ga0496125_0381980 3300048928 Bacteria 830
280 Ga0501303_001434 3300049526 Bacteria 1786
281 Ga0501223_072051 3300049663 Bacteria 684
282 Ga0501249_007678 3300049679 Bacteria 2233
283 Ga0501225_0010225 3300049705 Bacteria 2661
284 Ga0501262_000875 3300049759 Bacteria 3438
285 nmdc:mga03683_14261_c2 3300050489 Bacteria 1892
286 nmdc:mga03683_25306_c1 3300050489 Bacteria 2330
287 nmdc:mga03n38_11757_c1 3300050490 Bacteria 3272
288 nmdc:mga03n38_203767_c1 3300050490 Bacteria 1025
289 nmdc:mga03n38_3911_c1 3300050490 Bacteria 4855
290 nmdc:mga00v17_5029_c1 3300050491 Bacteria 6942
291 nmdc:mga0yw44_50366_c1 3300050492 Bacteria 2518
292 nmdc:mga0yw44_892652_c1 3300050492 Unclassified 603
293 nmdc:mga0k408_191660_c1 3300050493 Bacteria 1220
294 nmdc:mga06z11_146936_c1 3300050494 Bacteria 1337
295 nmdc:mga06z11_212009_c1 3300050494 Bacteria 1129
296 nmdc:mga07m45_12830_c1 3300050496 Bacteria 4433
297 nmdc:mga07m45_146_c1 3300050496 Bacteria 28314
298 nmdc:mga07m45_2026_c1 3300050496 Bacteria 4907
299 nmdc:mga07m45_252736_c1 3300050496 Bacteria 1025
300 nmdc:mga07m45_36262_c1 3300050496 Bacteria 2746
301 Ga0500610_0025369 3300053079 Bacteria 2955
302 Ga0500610_0029045 3300053079 Bacteria 2790
303 Ga0500643_011862 3300053087 Bacteria 3153
304 Ga0500647_0246316 3300053091 Bacteria 788
305 Ga0500651_0000289 3300053093 Bacteria 29197
306 Ga0500651_0222114 3300053093 Bacteria 1107
307 Ga0500566_0037033 3300053094 Bacteria 2828
308 Ga0500641_0135241 3300053096 Bacteria 1064
309 Ga0500562_004643 3300053108 Bacteria 3467
310 Ga0500571_000089 3300053110 Bacteria 29120
311 Ga0500593_000412 3300053117 Bacteria 16916
312 Ga0500594_0000269 3300053118 Bacteria 12069
313 Ga0500597_144177 3300053120 Bacteria 1025
314 Ga0500607_000942 3300053121 Bacteria 27845
315 Ga0500608_014603 3300053122 Bacteria 3510
316 Ga0500618_014211 3300053125 Bacteria 2039
317 Ga0500626_016786 3300053128 Bacteria 3209
318 Ga0500655_000391 3300053133 Bacteria 9299
319 Ga0500658_0000137 3300053134 Bacteria 34691
320 Ga0500658_0000140 3300053134 Bacteria 34349
321 Ga0500559_0003859 3300053136 Bacteria 7246
322 Ga0500564_005549 3300053138 Bacteria 5168
323 Ga0500568_0000735 3300053139 Bacteria 23510
324 Ga0500568_0038286 3300053139 Bacteria 1941
325 Ga0500574_013864 3300053141 Bacteria 1886
326 Ga0500604_0028333 3300053151 Bacteria 1626
327 Ga0500616_0003226 3300053153 Bacteria 12647
328 Ga0500616_0079732 3300053153 Bacteria 1647
329 Ga0500624_023439 3300053157 Bacteria 1012
330 Ga0500627_0002479 3300053158 Bacteria 5482
331 Ga0500634_0027556 3300053161 Bacteria 3095
332 Ga0500634_0075339 3300053161 Bacteria 1755
333 Ga0500638_289577 3300053162 Unclassified 637
334 Ga0500636_0000403 3300053177 Bacteria 23769
335 Ga0587072_014449 3300059643 Bacteria 1330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009036 Ga0105244_10066936 Ga0105244_100669362 130
2 3300050496 nmdc:mga07m45_252736_c1 nmdc:mga07m45_252736_c1_553_993 132
3 3300002739 JGI25158J39367_1001784 JGI25158J39367_10017843 136
4 3300002773 JGI25152J39213_1002717 JGI25152J39213_10027174 136
5 3300002774 JGI25150J39212_1000692 JGI25150J39212_10006928 136
6 3300002987 JGI25159J45721_1005264 JGI25159J45721_10052643 136
7 3300003187 JGI25151J46595_10005646 JGI25151J46595_100056464 136
8 3300003215 JGI25153J46596_10005754 JGI25153J46596_100057544 136
9 3300003354 JGI25160J50197_1004016 JGI25160J50197_10040164 136
10 3300003374 JGI25161J50226_1002770 JGI25161J50226_10027704 136
11 3300003771 Ga0055526_1006319 Ga0055526_10063194 136
12 3300003773 Ga0055537_1002328 Ga0055537_10023284 136
13 3300003775 Ga0055524_1004444 Ga0055524_10044444 136
14 3300003784 Ga0055534_1001957 Ga0055534_10019574 136
15 3300003790 Ga0055528_1004753 Ga0055528_10047534 136
16 3300003792 Ga0055540_1013051 Ga0055540_10130513 136
17 3300003794 Ga0055531_10011941 Ga0055531_100119412 136
18 3300004625 Ga0055543_1002534 Ga0055543_10025344 136
19 3300005262 Ga0065165_1005124 Ga0065165_10051244 136
20 3300025208 Ga0209436_101982 Ga0209436_1019824 136
21 3300025245 Ga0207425_1000133 Ga0207425_100013356 136
22 3300025258 Ga0209129_1000186 Ga0209129_100018629 136
23 3300025263 Ga0209565_1000190 Ga0209565_100019020 136
24 3300025273 Ga0209673_1000393 Ga0209673_100039320 136
25 3300025284 Ga0209130_1000372 Ga0209130_10003728 136
26 3300025291 Ga0209675_1000902 Ga0209675_10009028 136
27 3300025294 Ga0209025_1001380 Ga0209025_10013809 136
28 3300025295 Ga0209564_1005140 Ga0209564_10051404 136
29 3300025297 Ga0209758_1000092 Ga0209758_1000092177 136
30 3300025299 Ga0209256_1000094 Ga0209256_1000094147 136
31 3300025302 Ga0207426_1000084 Ga0207426_100008456 136
32 3300025304 Ga0209257_1004734 Ga0209257_10047344 136
33 3300025292 Ga0209676_1002013 Ga0209676_10020135 137
34 3300025303 Ga0209051_1050594 Ga0209051_10505942 137
35 iso_pu_bacteria 2928037797 2928040925 140
36 3300027907 Ga0207428_10490867 Ga0207428_104908672 141
37 3300013104 Ga0157370_10003332 Ga0157370_1000333213 142
38 iso_pu_bacteria 2831265667 2831272123 142
39 iso_pu_bacteria 2899924645 2899930754 142
40 3300013307 Ga0157372_10037198 Ga0157372_100371984 144
41 iso_pu_bacteria 2928064002 2928069755 144
42 3300005289 Ga0065704_10124556 Ga0065704_101245562 145
43 3300005563 Ga0068855_100259596 Ga0068855_1002595963 145
44 3300005844 Ga0068862_100059571 Ga0068862_1000595714 145
45 3300006353 Ga0075370_10116042 Ga0075370_101160422 145
46 3300006948 Ga0099826_10024907 Ga0099826_100249072 145
47 3300009545 Ga0105237_10084840 Ga0105237_100848402 145
48 3300009551 Ga0105238_10327177 Ga0105238_103271772 145
49 3300025294 Ga0209025_1000324 Ga0209025_100032420 145
50 3300031911 Ga0307412_10365669 Ga0307412_103656692 145
51 3300032005 Ga0307411_10066855 Ga0307411_100668553 145
52 3300048920 Ga0496117_0025796 Ga0496117_0025796_3983_4465 145
53 3300048925 Ga0496122_0099718 Ga0496122_0099718_656_1138 145
54 3300048927 Ga0496124_0085832 Ga0496124_0085832_1808_2290 145
55 3300002739 JGI25158J39367_1006154 JGI25158J39367_10061541 146
56 3300012505 Ga0157339_1040517 Ga0157339_10405171 146
57 3300025273 Ga0209673_1000209 Ga0209673_100020917 146
58 3300025284 Ga0209130_1002726 Ga0209130_10027264 146
59 3300025292 Ga0209676_1000048 Ga0209676_100004870 146
60 3300025294 Ga0209025_1013156 Ga0209025_10131564 146
61 3300025295 Ga0209564_1000417 Ga0209564_100041755 146
62 3300025298 Ga0209050_1000012 Ga0209050_100001270 146
63 3300025302 Ga0207426_1000161 Ga0207426_1000161103 146
64 3300025304 Ga0209257_1000024 Ga0209257_100002416 146
65 3300031548 Ga0307408_100038370 Ga0307408_1000383703 146
66 3300031731 Ga0307405_10000303 Ga0307405_1000030315 146
67 3300048928 Ga0496125_0049440 Ga0496125_0049440_816_1298 146
68 iso_pu_bacteria 2643221628 2644161661 146
69 iso_pu_bacteria 2818991446 2819601687 146
70 iso_pu_bacteria 2838054893 2838059287 146
71 iso_pu_bacteria 2929520902 2929522587 146
72 3300006177 Ga0075362_10006225 Ga0075362_100062253 147
73 3300025292 Ga0209676_1024277 Ga0209676_10242771 147
74 iso_pu_bacteria 2842677519 2842680288 147
75 iso_pu_bacteria 2904449895 2904452635 147
76 iso_pu_bacteria 2904456579 2904460768 147
77 iso_pu_bacteria 2945972063 2945975485 147
78 iso_pu_bacteria 2954767861 2954769075 147
79 3300028380 Ga0268265_10036514 Ga0268265_100365144 148
80 3300048928 Ga0496125_0381980 Ga0496125_0381980_319_810 148
81 3300049663 Ga0501223_072051 Ga0501223_072051_162_653 148
82 iso_pu_bacteria 2928044640 2928047767 148
83 3300003773 Ga0055537_1000095 Ga0055537_100009533 149
84 3300003784 Ga0055534_1000068 Ga0055534_100006849 149
85 3300003790 Ga0055528_1000215 Ga0055528_100021517 149
86 3300006353 Ga0075370_10000052 Ga0075370_1000005216 149
87 3300006948 Ga0099826_10002922 Ga0099826_100029224 149
88 3300025263 Ga0209565_1000020 Ga0209565_1000020246 149
89 3300025273 Ga0209673_1000350 Ga0209673_100035047 149
90 3300025291 Ga0209675_1000014 Ga0209675_1000014235 149
91 3300025292 Ga0209676_1044050 Ga0209676_10440501 149
92 3300025294 Ga0209025_1016396 Ga0209025_10163964 149
93 3300027666 Ga0209282_1000169 Ga0209282_100016920 149
94 3300032005 Ga0307411_10180899 Ga0307411_101808993 149
95 3300050496 nmdc:mga07m45_146_c1 nmdc:mga07m45_146_c1_12311_12805 149
96 iso_pu_bacteria 2643221672 2644399809 149
97 iso_pu_bacteria 2945909444 2945909756 149
98 iso_pu_bacteria 2945984333 2945988276 149
99 3300006048 Ga0075363_100010185 Ga0075363_1000101853 150
100 3300006177 Ga0075362_10018195 Ga0075362_100181953 150
101 3300009036 Ga0105244_10009718 Ga0105244_100097185 150
102 3300010375 Ga0105239_11018936 Ga0105239_110189362 150
103 3300014497 Ga0182008_10072597 Ga0182008_100725972 150
104 3300025728 Ga0207655_1004770 Ga0207655_10047702 150
105 3300025935 Ga0207709_10327732 Ga0207709_103277323 150
106 3300031731 Ga0307405_10279033 Ga0307405_102790332 150
107 3300031824 Ga0307413_10463042 Ga0307413_104630422 150
108 3300031852 Ga0307410_10270433 Ga0307410_102704331 150
109 3300031901 Ga0307406_10397180 Ga0307406_103971801 150
110 3300031903 Ga0307407_10013137 Ga0307407_100131373 150
111 3300031911 Ga0307412_10144329 Ga0307412_101443293 150
112 3300032005 Ga0307411_10074929 Ga0307411_100749292 150
113 3300041413 Ga0439465_0013311 Ga0439465_0013311_1877_2371 150
114 3300042531 Ga0450918_001414 Ga0450918_001414_3128_3622 150
115 3300042531 Ga0450918_012478 Ga0450918_012478_635_1132 150
116 3300050489 nmdc:mga03683_14261_c2 nmdc:mga03683_14261_c2_158_652 150
117 3300050490 nmdc:mga03n38_3911_c1 nmdc:mga03n38_3911_c1_2608_3102 150
118 iso_pu_bacteria 2513020051 2513230595 150
119 iso_pu_bacteria 2738541277 2738721383 150
120 iso_pu_bacteria 2738543019 2739281052 150
121 iso_pu_bacteria 2919462493 2919463736 150
122 iso_pu_bacteria 2928084124 2928088455 150
123 3300002773 JGI25152J39213_1006699 JGI25152J39213_10066993 151
124 3300002987 JGI25159J45721_1007000 JGI25159J45721_10070002 151
125 3300003187 JGI25151J46595_10000966 JGI25151J46595_100009666 151
126 3300003187 JGI25151J46595_10001112 JGI25151J46595_100011126 151
127 3300003187 JGI25151J46595_10017723 JGI25151J46595_100177232 151
128 3300003215 JGI25153J46596_10015702 JGI25153J46596_100157023 151
129 3300003320 rootH2_10132772 rootH2_101327723 151
130 3300003323 rootH1_10027375 rootH1_100273752 151
131 3300003323 rootH1_10214128 rootH1_102141282 151
132 3300003354 JGI25160J50197_1009525 JGI25160J50197_10095254 151
133 3300003374 JGI25161J50226_1004393 JGI25161J50226_10043933 151
134 3300003771 Ga0055526_1006793 Ga0055526_10067934 151
135 3300003773 Ga0055537_1005698 Ga0055537_10056982 151
136 3300003775 Ga0055524_1010884 Ga0055524_10108844 151
137 3300003781 Ga0055536_1007882 Ga0055536_10078824 151
138 3300003784 Ga0055534_1005667 Ga0055534_10056672 151
139 3300003790 Ga0055528_1012474 Ga0055528_10124742 151
140 3300003791 Ga0055530_10000437 Ga0055530_1000043717 151
141 3300003792 Ga0055540_1000662 Ga0055540_10006627 151
142 3300003792 Ga0055540_1006221 Ga0055540_10062214 151
143 3300003794 Ga0055531_10006612 Ga0055531_100066124 151
144 3300004625 Ga0055543_1012149 Ga0055543_10121492 151
145 3300005262 Ga0065165_1014669 Ga0065165_10146693 151
146 3300005457 Ga0070662_100035244 Ga0070662_1000352443 151
147 3300005457 Ga0070662_100062362 Ga0070662_1000623623 151
148 3300005539 Ga0068853_100011188 Ga0068853_1000111887 151
149 3300005539 Ga0068853_100141248 Ga0068853_1001412483 151
150 3300005577 Ga0068857_100170490 Ga0068857_1001704902 151
151 3300005578 Ga0068854_100370630 Ga0068854_1003706302 151
152 3300005614 Ga0068856_100418924 Ga0068856_1004189242 151
153 3300006038 Ga0075365_10001481 Ga0075365_100014814 151
154 3300006042 Ga0075368_10109502 Ga0075368_101095021 151
155 3300006048 Ga0075363_100040725 Ga0075363_1000407252 151
156 3300006048 Ga0075363_100042531 Ga0075363_1000425313 151
157 3300006048 Ga0075363_100113465 Ga0075363_1001134652 151
158 3300006051 Ga0075364_10669832 Ga0075364_106698322 151
159 3300006058 Ga0075432_10003340 Ga0075432_100033405 151
160 3300006058 Ga0075432_10083775 Ga0075432_100837752 151
161 3300006177 Ga0075362_10122360 Ga0075362_101223602 151
162 3300006177 Ga0075362_10301238 Ga0075362_103012381 151
163 3300006178 Ga0075367_10111193 Ga0075367_101111932 151
164 3300006178 Ga0075367_10143477 Ga0075367_101434772 151
165 3300006195 Ga0075366_10053341 Ga0075366_100533412 151
166 3300006237 Ga0097621_100582842 Ga0097621_1005828422 151
167 3300006353 Ga0075370_10000608 Ga0075370_1000060813 151
168 3300006353 Ga0075370_10000650 Ga0075370_1000065012 151
169 3300006948 Ga0099826_10093503 Ga0099826_100935032 151
170 3300009036 Ga0105244_10004764 Ga0105244_100047649 151
171 3300009148 Ga0105243_10020301 Ga0105243_100203013 151
172 3300009148 Ga0105243_10080909 Ga0105243_100809092 151
173 3300009545 Ga0105237_10366154 Ga0105237_103661543 151
174 3300010375 Ga0105239_10032631 Ga0105239_100326315 151
175 3300011119 Ga0105246_10075196 Ga0105246_100751962 151
176 3300013100 Ga0157373_10004049 Ga0157373_100040493 151
177 3300013100 Ga0157373_10014593 Ga0157373_100145933 151
178 3300013100 Ga0157373_10134636 Ga0157373_101346362 151
179 3300013104 Ga0157370_10036402 Ga0157370_100364024 151
180 3300013104 Ga0157370_10179910 Ga0157370_101799102 151
181 3300013105 Ga0157369_10009375 Ga0157369_100093754 151
182 3300014497 Ga0182008_10002207 Ga0182008_100022072 151
183 3300014497 Ga0182008_10323855 Ga0182008_103238552 151
184 3300015261 Ga0182006_1008645 Ga0182006_10086452 151
185 3300015261 Ga0182006_1100589 Ga0182006_11005892 151
186 3300015261 Ga0182006_1109114 Ga0182006_11091142 151
187 3300015261 Ga0182006_1111786 Ga0182006_11117862 151
188 3300015262 Ga0182007_10000958 Ga0182007_1000095813 151
189 3300017792 Ga0163161_10329360 Ga0163161_103293602 151
190 3300025208 Ga0209436_103697 Ga0209436_1036973 151
191 3300025245 Ga0207425_1020365 Ga0207425_10203652 151
192 3300025258 Ga0209129_1001080 Ga0209129_100108014 151
193 3300025258 Ga0209129_1007022 Ga0209129_10070223 151
194 3300025263 Ga0209565_1006301 Ga0209565_10063012 151
195 3300025291 Ga0209675_1003060 Ga0209675_10030604 151
196 3300025291 Ga0209675_1005108 Ga0209675_10051082 151
197 3300025292 Ga0209676_1000304 Ga0209676_100030435 151
198 3300025292 Ga0209676_1019803 Ga0209676_10198031 151
199 3300025294 Ga0209025_1001614 Ga0209025_100161420 151
200 3300025297 Ga0209758_1017703 Ga0209758_10177033 151
201 3300025298 Ga0209050_1004084 Ga0209050_10040847 151
202 3300025298 Ga0209050_1029467 Ga0209050_10294671 151
203 3300025299 Ga0209256_1000095 Ga0209256_1000095218 151
204 3300025303 Ga0209051_1000117 Ga0209051_1000117111 151
205 3300025303 Ga0209051_1000273 Ga0209051_10002734 151
206 3300025304 Ga0209257_1006794 Ga0209257_10067943 151
207 3300025914 Ga0207671_10018941 Ga0207671_100189414 151
208 3300025914 Ga0207671_10274594 Ga0207671_102745943 151
209 3300025933 Ga0207706_10040414 Ga0207706_100404144 151
210 3300025935 Ga0207709_10003682 Ga0207709_100036824 151
211 3300025935 Ga0207709_10058738 Ga0207709_100587382 151
212 3300025935 Ga0207709_10111334 Ga0207709_101113342 151
213 3300026041 Ga0207639_10130479 Ga0207639_101304792 151
214 3300026041 Ga0207639_10269670 Ga0207639_102696701 151
215 3300026078 Ga0207702_10152298 Ga0207702_101522983 151
216 3300027907 Ga0207428_10044731 Ga0207428_100447314 151
217 3300028794 Ga0307515_10160701 Ga0307515_101607013 151
218 3300030731 Ga0316177_1186783 Ga0316177_11867833 151
219 3300030732 Ga0316176_1109314 Ga0316176_11093142 151
220 3300030733 Ga0314311_1060445 Ga0314311_10604452 151
221 3300030734 Ga0316179_1052133 Ga0316179_10521333 151
222 3300030735 Ga0316178_1025359 Ga0316178_10253592 151
223 3300030742 Ga0316183_1034957 Ga0316183_10349573 151
224 3300030745 Ga0316182_1048437 Ga0316182_10484372 151
225 3300031548 Ga0307408_100023025 Ga0307408_1000230252 151
226 3300031731 Ga0307405_10016512 Ga0307405_100165122 151
227 3300031901 Ga0307406_10064188 Ga0307406_100641883 151
228 3300031911 Ga0307412_10070656 Ga0307412_100706563 151
229 3300031911 Ga0307412_10091144 Ga0307412_100911442 151
230 3300031911 Ga0307412_10200516 Ga0307412_102005162 151
231 3300031911 Ga0307412_10779777 Ga0307412_107797771 151
232 3300031995 Ga0307409_101658896 Ga0307409_1016588961 151
233 3300032002 Ga0307416_100212588 Ga0307416_1002125883 151
234 3300032002 Ga0307416_102389488 Ga0307416_1023894881 151
235 3300032005 Ga0307411_10619331 Ga0307411_106193311 151
236 3300041486 Ga0451807_0399926 Ga0451807_0399926_104_607 151
237 3300042007 Ga0439449_0268089 Ga0439449_0268089_98_598 151
238 3300042145 Ga0450906_006989 Ga0450906_006989_647_1144 151
239 3300042531 Ga0450918_001549 Ga0450918_001549_222_719 151
240 3300046513 Ga0495616_0000933 Ga0495616_0000933_9367_9873 151
241 3300046518 Ga0495631_0000176 Ga0495631_0000176_22730_23236 151
242 3300046530 Ga0495654_0019577 Ga0495654_0019577_693_1196 151
243 3300046539 Ga0495621_0001613 Ga0495621_0001613_251_757 151
244 3300046616 Ga0495668_0228406 Ga0495668_0228406_224_727 151
245 3300046660 Ga0495625_0000045 Ga0495625_0000045_22521_23036 151
246 3300046660 Ga0495625_0004736 Ga0495625_0004736_11630_12136 151
247 3300046660 Ga0495625_0189507 Ga0495625_0189507_480_983 151
248 3300046665 Ga0495661_0152943 Ga0495661_0152943_485_988 151
249 3300046674 Ga0495588_0041874 Ga0495588_0041874_664_1164 151
250 3300046674 Ga0495588_0095710 Ga0495588_0095710_554_1057 151
251 3300046692 Ga0495671_0001321 Ga0495671_0001321_10521_11024 151
252 3300046810 Ga0495660_0081884 Ga0495660_0081884_526_1035 151
253 3300046810 Ga0495660_0144751 Ga0495660_0144751_306_809 151
254 3300047321 Ga0495676_0050257 Ga0495676_0050257_1616_2116 151
255 3300047321 Ga0495676_0055055 Ga0495676_0055055_2442_2939 151
256 3300047673 Ga0495593_0007620 Ga0495593_0007620_1097_1594 151
257 3300048089 Ga0495614_0286964 Ga0495614_0286964_87_587 151
258 3300048920 Ga0496117_0014962 Ga0496117_0014962_247_759 151
259 3300048920 Ga0496117_0126201 Ga0496117_0126201_807_1307 151
260 3300048920 Ga0496117_0158503 Ga0496117_0158503_795_1292 151
261 3300048921 Ga0496118_0283638 Ga0496118_0283638_324_824 151
262 3300048924 Ga0496121_0014563 Ga0496121_0014563_4001_4498 151
263 3300048924 Ga0496121_0047132 Ga0496121_0047132_664_1161 151
264 3300048924 Ga0496121_0194013 Ga0496121_0194013_375_881 151
265 3300048925 Ga0496122_0061464 Ga0496122_0061464_2109_2606 151
266 3300048926 Ga0496123_0069826 Ga0496123_0069826_126_626 151
267 3300048927 Ga0496124_0017973 Ga0496124_0017973_2536_3033 151
268 3300048928 Ga0496125_0048473 Ga0496125_0048473_170_676 151
269 3300049526 Ga0501303_001434 Ga0501303_001434_364_870 151
270 3300049679 Ga0501249_007678 Ga0501249_007678_472_972 151
271 3300049705 Ga0501225_0010225 Ga0501225_0010225_1835_2335 151
272 3300049759 Ga0501262_000875 Ga0501262_000875_1120_1626 151
273 3300050489 nmdc:mga03683_25306_c1 nmdc:mga03683_25306_c1_1486_1995 151
274 3300050490 nmdc:mga03n38_11757_c1 nmdc:mga03n38_11757_c1_508_1017 151
275 3300050490 nmdc:mga03n38_203767_c1 nmdc:mga03n38_203767_c1_115_630 151
276 3300050491 nmdc:mga00v17_5029_c1 nmdc:mga00v17_5029_c1_1689_2198 151
277 3300050492 nmdc:mga0yw44_50366_c1 nmdc:mga0yw44_50366_c1_1423_1938 151
278 3300050492 nmdc:mga0yw44_892652_c1 nmdc:mga0yw44_892652_c1_87_584 151
279 3300050493 nmdc:mga0k408_191660_c1 nmdc:mga0k408_191660_c1_250_750 151
280 3300050494 nmdc:mga06z11_146936_c1 nmdc:mga06z11_146936_c1_578_1093 151
281 3300050494 nmdc:mga06z11_212009_c1 nmdc:mga06z11_212009_c1_211_711 151
282 3300050496 nmdc:mga07m45_12830_c1 nmdc:mga07m45_12830_c1_3857_4357 151
283 3300050496 nmdc:mga07m45_2026_c1 nmdc:mga07m45_2026_c1_1555_2055 151
284 3300050496 nmdc:mga07m45_36262_c1 nmdc:mga07m45_36262_c1_1499_2008 151
285 3300053079 Ga0500610_0025369 Ga0500610_0025369_998_1501 151
286 3300053079 Ga0500610_0029045 Ga0500610_0029045_1420_1923 151
287 3300053087 Ga0500643_011862 Ga0500643_011862_840_1346 151
288 3300053091 Ga0500647_0246316 Ga0500647_0246316_118_615 151
289 3300053093 Ga0500651_0000289 Ga0500651_0000289_22656_23162 151
290 3300053093 Ga0500651_0222114 Ga0500651_0222114_200_697 151
291 3300053094 Ga0500566_0037033 Ga0500566_0037033_1236_1742 151
292 3300053096 Ga0500641_0135241 Ga0500641_0135241_286_789 151
293 3300053108 Ga0500562_004643 Ga0500562_004643_876_1373 151
294 3300053110 Ga0500571_000089 Ga0500571_000089_6033_6530 151
295 3300053117 Ga0500593_000412 Ga0500593_000412_11687_12190 151
296 3300053118 Ga0500594_0000269 Ga0500594_0000269_6841_7347 151
297 3300053120 Ga0500597_144177 Ga0500597_144177_249_746 151
298 3300053121 Ga0500607_000942 Ga0500607_000942_21110_21613 151
299 3300053125 Ga0500618_014211 Ga0500618_014211_252_749 151
300 3300053133 Ga0500655_000391 Ga0500655_000391_4513_5010 151
301 3300053134 Ga0500658_0000140 Ga0500658_0000140_16228_16734 151
302 3300053138 Ga0500564_005549 Ga0500564_005549_4559_5056 151
303 3300053139 Ga0500568_0038286 Ga0500568_0038286_984_1484 151
304 3300053141 Ga0500574_013864 Ga0500574_013864_250_747 151
305 3300053151 Ga0500604_0028333 Ga0500604_0028333_1110_1616 151
306 3300053153 Ga0500616_0003226 Ga0500616_0003226_311_817 151
307 3300053153 Ga0500616_0079732 Ga0500616_0079732_936_1436 151
308 3300053157 Ga0500624_023439 Ga0500624_023439_57_554 151
309 3300053158 Ga0500627_0002479 Ga0500627_0002479_4716_5219 151
310 3300053161 Ga0500634_0027556 Ga0500634_0027556_204_707 151
311 3300053161 Ga0500634_0075339 Ga0500634_0075339_458_955 151
312 3300053162 Ga0500638_289577 Ga0500638_289577_37_534 151
313 3300053177 Ga0500636_0000403 Ga0500636_0000403_22734_23231 151
314 iso_pu_bacteria 2945945610 2945945854 151
315 3300053122 Ga0500608_014603 Ga0500608_014603_2175_2693 152
316 3300053128 Ga0500626_016786 Ga0500626_016786_1246_1746 152
317 3300053136 Ga0500559_0003859 Ga0500559_0003859_1543_2043 152
318 iso_pu_bacteria 2599185214 2599626411 153
319 iso_pu_bacteria 2599185226 2599676265 153
320 iso_pu_bacteria 2599185227 2599682113 153
321 iso_pu_bacteria 2599185229 2599695763 153
322 iso_pu_bacteria 2885198086 2885202976 153
323 iso_pu_bacteria 2885211737 2885216627 153
324 3300009148 Ga0105243_10342505 Ga0105243_103425052 154
325 3300025935 Ga0207709_10012572 Ga0207709_100125723 154
326 3300046530 Ga0495654_0003294 Ga0495654_0003294_7540_8046 154
327 3300046660 Ga0495625_0054583 Ga0495625_0054583_1713_2219 154
328 3300048924 Ga0496121_0184666 Ga0496121_0184666_374_880 154
329 3300048927 Ga0496124_0590298 Ga0496124_0590298_44_550 154
330 3300053134 Ga0500658_0000137 Ga0500658_0000137_17109_17615 154
331 3300053139 Ga0500568_0000735 Ga0500568_0000735_10829_11335 154
332 3300059643 Ga0587072_014449 Ga0587072_014449_318_824 154
333 iso_pu_bacteria 2928051484 2928055657 157
334 3300001989 JGI24739J22299_10107532 JGI24739J22299_101075322 158
335 3300002773 JGI25152J39213_1006012 JGI25152J39213_10060123 158
336 3300002987 JGI25159J45721_1012020 JGI25159J45721_10120202 158
337 3300003187 JGI25151J46595_10015221 JGI25151J46595_100152213 158
338 3300003215 JGI25153J46596_10013693 JGI25153J46596_100136933 158
339 3300003773 Ga0055537_1005003 Ga0055537_10050033 158
340 3300003784 Ga0055534_1004545 Ga0055534_10045453 158
341 3300003790 Ga0055528_1010959 Ga0055528_10109593 158
342 3300005262 Ga0065165_1057122 Ga0065165_10571221 158
343 3300012505 Ga0157339_1003387 Ga0157339_10033872 158
344 3300025258 Ga0209129_1005846 Ga0209129_10058464 158
345 3300025263 Ga0209565_1005468 Ga0209565_10054683 158
346 3300025284 Ga0209130_1006745 Ga0209130_10067453 158
347 3300025294 Ga0209025_1012180 Ga0209025_10121804 158
348 3300025295 Ga0209564_1012835 Ga0209564_10128353 158
349 3300025297 Ga0209758_1003764 Ga0209758_100376413 158
350 3300025298 Ga0209050_1051115 Ga0209050_10511152 158
351 3300025299 Ga0209256_1011045 Ga0209256_10110453 158
352 3300025302 Ga0207426_1010707 Ga0207426_10107073 158
353 3300048920 Ga0496117_0107236 Ga0496117_0107236_409_927 158
354 3300048921 Ga0496118_0018910 Ga0496118_0018910_4463_4981 158
355 3300001979 JGI24740J21852_10035598 JGI24740J21852_100355981 161
356 3300003322 rootL2_10097100 rootL2_100971005 161
357 3300003760 Ga0055527_1025152 Ga0055527_10251521 161
358 3300003761 Ga0055535_1001074 Ga0055535_10010745 161
359 3300003762 Ga0055542_1000074 Ga0055542_100007420 161
360 3300013102 Ga0157371_10159175 Ga0157371_101591752 161
361 3300025228 Ga0209672_101028 Ga0209672_1010284 161
362 3300025229 Ga0209147_101428 Ga0209147_1014283 161
363 3300025242 Ga0209258_100176 Ga0209258_100176120 161
364 3300025254 Ga0209148_1000033 Ga0209148_1000033251 161
365 3300048928 Ga0496125_0030283 Ga0496125_0030283_3009_3536 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01478

Peptidase_A24

Type IV leader peptidase family

11

117

0.92

Feature Viewer

pLDDT pTM Quality
54.29 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map