F423626
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 365 | 220 | 362 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300006237|Ga0097621_100662595|Ga0097621_1006625952 |
| Length | 191 |
| Sequence | MIDDPEAALQSAPRTRRYLIYDPRMNPEELRAIQAPLKATYKTTPEAALITLKAAGRLGEGVTCNVETGKAIARAGLHPATGGDGLSLCSGDMLLEALVACAGVTMNAVSSALGIPIRDGRVFAEGDLDFRGTLGVDKTASVGFQTIRLRFELDTDATEEQLATLYKLTERYCVVFQTLAKPPTMEFRRTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 2 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 3 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 147 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 148 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 149 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 150 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 151 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 152 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 182 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.18 |
| Metatranscriptomes | 0 |
| Isolates | 0.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.82 |
| Rhizoplane | 9.32 |
| Rhizosphere | 88.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10559163 | 3300005293 | Bacteria | 731 |
| 2 | Ga0070658_10178406 | 3300005327 | Bacteria | 1787 |
| 3 | Ga0070676_10006292 | 3300005328 | Bacteria | 6341 |
| 4 | Ga0070676_10010959 | 3300005328 | Bacteria | 4926 |
| 5 | Ga0070676_10069087 | 3300005328 | Bacteria | 2117 |
| 6 | Ga0070683_100274880 | 3300005329 | Bacteria | 1602 |
| 7 | Ga0070683_100368853 | 3300005329 | Bacteria | 1367 |
| 8 | Ga0070670_100404726 | 3300005331 | Bacteria | 1205 |
| 9 | Ga0070677_10009469 | 3300005333 | Bacteria | 3303 |
| 10 | Ga0068869_100016849 | 3300005334 | Bacteria | 4938 |
| 11 | Ga0068869_100360498 | 3300005334 | Bacteria | 1187 |
| 12 | Ga0070666_10336983 | 3300005335 | Unclassified | 1078 |
| 13 | Ga0070680_100888259 | 3300005336 | Bacteria | 769 |
| 14 | Ga0070682_100844479 | 3300005337 | Bacteria | 748 |
| 15 | Ga0070682_101425705 | 3300005337 | Bacteria | 593 |
| 16 | Ga0068868_100119296 | 3300005338 | Bacteria | 2150 |
| 17 | Ga0068868_100218880 | 3300005338 | Bacteria | 1593 |
| 18 | Ga0070689_100865107 | 3300005340 | Bacteria | 798 |
| 19 | Ga0070687_100396534 | 3300005343 | Bacteria | 904 |
| 20 | Ga0070661_100143160 | 3300005344 | Bacteria | 1803 |
| 21 | Ga0070661_100257593 | 3300005344 | Bacteria | 1348 |
| 22 | Ga0070668_100792429 | 3300005347 | Bacteria | 841 |
| 23 | Ga0070669_100165779 | 3300005353 | Bacteria | 1720 |
| 24 | Ga0070675_100063326 | 3300005354 | Bacteria | 3057 |
| 25 | Ga0070675_100150734 | 3300005354 | Unclassified | 1994 |
| 26 | Ga0070671_100281278 | 3300005355 | Bacteria | 1415 |
| 27 | Ga0070671_100452512 | 3300005355 | Bacteria | 1102 |
| 28 | Ga0070673_100174049 | 3300005364 | Bacteria | 1839 |
| 29 | Ga0070673_100854546 | 3300005364 | Bacteria | 842 |
| 30 | Ga0070688_101347788 | 3300005365 | Bacteria | 577 |
| 31 | Ga0070659_100115870 | 3300005366 | Bacteria | 2166 |
| 32 | Ga0070659_100296723 | 3300005366 | Bacteria | 1347 |
| 33 | Ga0070667_100136403 | 3300005367 | Bacteria | 2146 |
| 34 | Ga0070667_100150815 | 3300005367 | Bacteria | 2042 |
| 35 | Ga0070709_10546126 | 3300005434 | Bacteria | 886 |
| 36 | Ga0070714_100019515 | 3300005435 | Bacteria | 5525 |
| 37 | Ga0070713_100016531 | 3300005436 | Bacteria | 5547 |
| 38 | Ga0070713_100379660 | 3300005436 | Bacteria | 1316 |
| 39 | Ga0070710_10113189 | 3300005437 | Bacteria | 1633 |
| 40 | Ga0070663_101044653 | 3300005455 | Bacteria | 712 |
| 41 | Ga0070678_100916183 | 3300005456 | Bacteria | 802 |
| 42 | Ga0070662_101005100 | 3300005457 | Bacteria | 714 |
| 43 | Ga0068867_100102466 | 3300005459 | Bacteria | 2188 |
| 44 | Ga0070685_10240199 | 3300005466 | Bacteria | 1195 |
| 45 | Ga0070685_10792587 | 3300005466 | Bacteria | 698 |
| 46 | Ga0070698_100003191 | 3300005471 | Bacteria | 18080 |
| 47 | Ga0070698_100187833 | 3300005471 | Unclassified | 2004 |
| 48 | Ga0070684_100109669 | 3300005535 | Bacteria | 2474 |
| 49 | Ga0070684_100329353 | 3300005535 | Bacteria | 1403 |
| 50 | Ga0070684_100448013 | 3300005535 | Bacteria | 1193 |
| 51 | Ga0070684_100641830 | 3300005535 | Bacteria | 988 |
| 52 | Ga0070697_100104866 | 3300005536 | Bacteria | 2351 |
| 53 | Ga0070672_100231462 | 3300005543 | Bacteria | 1553 |
| 54 | Ga0070672_100276195 | 3300005543 | Unclassified | 1420 |
| 55 | Ga0070672_100466542 | 3300005543 | Bacteria | 1089 |
| 56 | Ga0070686_100152678 | 3300005544 | Bacteria | 1619 |
| 57 | Ga0070686_100516333 | 3300005544 | Unclassified | 929 |
| 58 | Ga0070696_100351973 | 3300005546 | Bacteria | 1141 |
| 59 | Ga0070693_100288281 | 3300005547 | Bacteria | 1102 |
| 60 | Ga0070665_100106336 | 3300005548 | Unclassified | 2808 |
| 61 | Ga0070665_100383955 | 3300005548 | Bacteria | 1412 |
| 62 | Ga0070665_100393435 | 3300005548 | Bacteria | 1394 |
| 63 | Ga0070704_100650526 | 3300005549 | Bacteria | 930 |
| 64 | Ga0070704_100790065 | 3300005549 | Bacteria | 847 |
| 65 | Ga0068855_100422070 | 3300005563 | Bacteria | 1459 |
| 66 | Ga0070664_100029360 | 3300005564 | Bacteria | 4585 |
| 67 | Ga0070664_100115003 | 3300005564 | Bacteria | 2351 |
| 68 | Ga0070664_100635000 | 3300005564 | Bacteria | 992 |
| 69 | Ga0068856_100149407 | 3300005614 | Bacteria | 2345 |
| 70 | Ga0068856_100183806 | 3300005614 | Bacteria | 2104 |
| 71 | Ga0068856_100465565 | 3300005614 | Bacteria | 1285 |
| 72 | Ga0068856_100911300 | 3300005614 | Bacteria | 898 |
| 73 | Ga0070702_100275026 | 3300005615 | Bacteria | 1153 |
| 74 | Ga0070702_100624857 | 3300005615 | Bacteria | 811 |
| 75 | Ga0068852_100075477 | 3300005616 | Bacteria | 2974 |
| 76 | Ga0068852_100164541 | 3300005616 | Bacteria | 2074 |
| 77 | Ga0068859_100442046 | 3300005617 | Unclassified | 1397 |
| 78 | Ga0068866_10048106 | 3300005718 | Bacteria | 2154 |
| 79 | Ga0068861_100795222 | 3300005719 | Bacteria | 887 |
| 80 | Ga0068861_101391290 | 3300005719 | Bacteria | 685 |
| 81 | Ga0068861_101959019 | 3300005719 | Bacteria | 584 |
| 82 | Ga0068851_10018002 | 3300005834 | Bacteria | 3401 |
| 83 | Ga0068851_10090357 | 3300005834 | Bacteria | 1611 |
| 84 | Ga0068863_100000021 | 3300005841 | Bacteria | 198088 |
| 85 | Ga0068860_100012890 | 3300005843 | Bacteria | 8217 |
| 86 | Ga0068860_100257116 | 3300005843 | Bacteria | 1702 |
| 87 | Ga0068862_100136733 | 3300005844 | Bacteria | 2172 |
| 88 | Ga0081539_10062513 | 3300005985 | Bacteria | 2035 |
| 89 | Ga0070716_100387364 | 3300006173 | Bacteria | 1001 |
| 90 | Ga0070712_100128327 | 3300006175 | Bacteria | 1919 |
| 91 | Ga0070712_100946826 | 3300006175 | Bacteria | 744 |
| 92 | Ga0097621_100045252 | 3300006237 | Unclassified | 3554 |
| 93 | Ga0097621_100067383 | 3300006237 | Bacteria | 2950 |
| 94 | Ga0097621_100662595 | 3300006237 | Bacteria | 958 |
| 95 | Ga0068871_100089181 | 3300006358 | Bacteria | 2566 |
| 96 | Ga0068871_100422021 | 3300006358 | Bacteria | 1191 |
| 97 | Ga0068871_100490924 | 3300006358 | Bacteria | 1106 |
| 98 | Ga0075434_100747597 | 3300006871 | Bacteria | 995 |
| 99 | Ga0075429_100996397 | 3300006880 | Bacteria | 733 |
| 100 | Ga0068865_100056186 | 3300006881 | Bacteria | 2741 |
| 101 | Ga0068865_100086430 | 3300006881 | Bacteria | 2264 |
| 102 | Ga0068865_100162136 | 3300006881 | Bacteria | 1707 |
| 103 | Ga0068865_100538442 | 3300006881 | Bacteria | 979 |
| 104 | Ga0068865_100969532 | 3300006881 | Bacteria | 743 |
| 105 | Ga0075436_100048619 | 3300006914 | Bacteria | 2927 |
| 106 | Ga0097620_100442042 | 3300006931 | Unclassified | 1397 |
| 107 | Ga0075435_100386059 | 3300007076 | Bacteria | 1203 |
| 108 | Ga0111539_11243798 | 3300009094 | Bacteria | 864 |
| 109 | Ga0105245_10148407 | 3300009098 | Bacteria | 2215 |
| 110 | Ga0105245_10273070 | 3300009098 | Unclassified | 1649 |
| 111 | Ga0105245_10601366 | 3300009098 | Bacteria | 1126 |
| 112 | Ga0114129_10008348 | 3300009147 | Bacteria | 14768 |
| 113 | Ga0114129_10414403 | 3300009147 | Bacteria | 1773 |
| 114 | Ga0114129_11494046 | 3300009147 | Bacteria | 830 |
| 115 | Ga0114129_11724541 | 3300009147 | Bacteria | 764 |
| 116 | Ga0105243_10344059 | 3300009148 | Bacteria | 1367 |
| 117 | Ga0105243_11722935 | 3300009148 | Bacteria | 656 |
| 118 | Ga0105243_12133977 | 3300009148 | Bacteria | 596 |
| 119 | Ga0105242_10034727 | 3300009176 | Bacteria | 4043 |
| 120 | Ga0105242_10049517 | 3300009176 | Bacteria | 3420 |
| 121 | Ga0105242_10050281 | 3300009176 | Bacteria | 3393 |
| 122 | Ga0105242_10541004 | 3300009176 | Bacteria | 1115 |
| 123 | Ga0105248_10033966 | 3300009177 | Bacteria | 5701 |
| 124 | Ga0105248_10081114 | 3300009177 | Bacteria | 3647 |
| 125 | Ga0105248_10119929 | 3300009177 | Bacteria | 2967 |
| 126 | Ga0105248_11278278 | 3300009177 | Bacteria | 830 |
| 127 | Ga0105237_10135854 | 3300009545 | Bacteria | 2453 |
| 128 | Ga0105249_10365984 | 3300009553 | Bacteria | 1464 |
| 129 | Ga0105239_11255461 | 3300010375 | Unclassified | 854 |
| 130 | Ga0105246_10105639 | 3300011119 | Bacteria | 2058 |
| 131 | Ga0105246_10479701 | 3300011119 | Bacteria | 1052 |
| 132 | Ga0105246_10904428 | 3300011119 | Bacteria | 792 |
| 133 | Ga0157369_10844248 | 3300013105 | Bacteria | 940 |
| 134 | Ga0157374_10003347 | 3300013296 | Bacteria | 13463 |
| 135 | Ga0157374_10042277 | 3300013296 | Bacteria | 4203 |
| 136 | Ga0157374_10293551 | 3300013296 | Bacteria | 1607 |
| 137 | Ga0157374_10306095 | 3300013296 | Bacteria | 1573 |
| 138 | Ga0163162_10039077 | 3300013306 | Bacteria | 4739 |
| 139 | Ga0157375_10010985 | 3300013308 | Bacteria | 7986 |
| 140 | Ga0157375_10233812 | 3300013308 | Bacteria | 1997 |
| 141 | Ga0157375_10358610 | 3300013308 | Bacteria | 1624 |
| 142 | Ga0157375_10605398 | 3300013308 | Bacteria | 1255 |
| 143 | Ga0163163_10425297 | 3300014325 | Bacteria | 1387 |
| 144 | Ga0157380_10000815 | 3300014326 | Bacteria | 19534 |
| 145 | Ga0182008_10303515 | 3300014497 | Bacteria | 836 |
| 146 | Ga0157379_10616720 | 3300014968 | Bacteria | 1014 |
| 147 | Ga0157376_10074496 | 3300014969 | Bacteria | 2894 |
| 148 | Ga0157376_11194017 | 3300014969 | Unclassified | 789 |
| 149 | Ga0157376_11247757 | 3300014969 | Bacteria | 772 |
| 150 | Ga0163161_10115017 | 3300017792 | Bacteria | 2016 |
| 151 | Ga0207656_10067128 | 3300025321 | Bacteria | 1587 |
| 152 | Ga0207682_10011740 | 3300025893 | Bacteria | 3423 |
| 153 | Ga0207682_10067079 | 3300025893 | Bacteria | 1513 |
| 154 | Ga0207682_10096454 | 3300025893 | Bacteria | 1288 |
| 155 | Ga0207692_10121986 | 3300025898 | Bacteria | 1461 |
| 156 | Ga0207642_10275805 | 3300025899 | Bacteria | 965 |
| 157 | Ga0207688_10042193 | 3300025901 | Bacteria | 2540 |
| 158 | Ga0207688_10099390 | 3300025901 | Bacteria | 1678 |
| 159 | Ga0207699_10064061 | 3300025906 | Bacteria | 2223 |
| 160 | Ga0207645_10001687 | 3300025907 | Bacteria | 17921 |
| 161 | Ga0207645_10123091 | 3300025907 | Bacteria | 1685 |
| 162 | Ga0207645_10173495 | 3300025907 | Bacteria | 1414 |
| 163 | Ga0207693_10154310 | 3300025915 | Bacteria | 1806 |
| 164 | Ga0207693_10197338 | 3300025915 | Bacteria | 1583 |
| 165 | Ga0207663_10453302 | 3300025916 | Bacteria | 990 |
| 166 | Ga0207646_10079559 | 3300025922 | Bacteria | 2930 |
| 167 | Ga0207650_10135231 | 3300025925 | Bacteria | 1933 |
| 168 | Ga0207650_10351471 | 3300025925 | Bacteria | 1213 |
| 169 | Ga0207659_10236378 | 3300025926 | Bacteria | 1476 |
| 170 | Ga0207700_10006144 | 3300025928 | Bacteria | 7233 |
| 171 | Ga0207700_10240199 | 3300025928 | Bacteria | 1544 |
| 172 | Ga0207664_10007115 | 3300025929 | Bacteria | 7755 |
| 173 | Ga0207664_10141825 | 3300025929 | Bacteria | 2033 |
| 174 | Ga0207644_10029702 | 3300025931 | Bacteria | 3795 |
| 175 | Ga0207690_10491416 | 3300025932 | Bacteria | 992 |
| 176 | Ga0207706_10308249 | 3300025933 | Bacteria | 1379 |
| 177 | Ga0207706_10730964 | 3300025933 | Bacteria | 844 |
| 178 | Ga0207686_10082217 | 3300025934 | Bacteria | 2105 |
| 179 | Ga0207709_10632257 | 3300025935 | Bacteria | 850 |
| 180 | Ga0207704_10019608 | 3300025938 | Bacteria | 3556 |
| 181 | Ga0207704_10055900 | 3300025938 | Bacteria | 2414 |
| 182 | Ga0207665_10127297 | 3300025939 | Bacteria | 1804 |
| 183 | Ga0207691_10179145 | 3300025940 | Unclassified | 1852 |
| 184 | Ga0207691_10386353 | 3300025940 | Bacteria | 1195 |
| 185 | Ga0207711_10071516 | 3300025941 | Bacteria | 3010 |
| 186 | Ga0207711_10276505 | 3300025941 | Bacteria | 1546 |
| 187 | Ga0207689_10004266 | 3300025942 | Bacteria | 13005 |
| 188 | Ga0207689_10027522 | 3300025942 | Bacteria | 4758 |
| 189 | Ga0207689_10383026 | 3300025942 | Bacteria | 1171 |
| 190 | Ga0207689_10628582 | 3300025942 | Bacteria | 904 |
| 191 | Ga0207661_10397016 | 3300025944 | Unclassified | 1250 |
| 192 | Ga0207679_10172770 | 3300025945 | Bacteria | 1781 |
| 193 | Ga0207679_10428806 | 3300025945 | Bacteria | 1168 |
| 194 | Ga0207668_10927495 | 3300025972 | Bacteria | 776 |
| 195 | Ga0207640_10165248 | 3300025981 | Bacteria | 1643 |
| 196 | Ga0207658_10529600 | 3300025986 | Bacteria | 1052 |
| 197 | Ga0207658_10971067 | 3300025986 | Unclassified | 775 |
| 198 | Ga0207677_10045670 | 3300026023 | Bacteria | 2926 |
| 199 | Ga0207703_10593659 | 3300026035 | Bacteria | 1047 |
| 200 | Ga0207678_10091722 | 3300026067 | Bacteria | 2597 |
| 201 | Ga0207702_10183464 | 3300026078 | Bacteria | 1929 |
| 202 | Ga0207702_11368926 | 3300026078 | Bacteria | 702 |
| 203 | Ga0207641_10000151 | 3300026088 | Bacteria | 99225 |
| 204 | Ga0207641_10532271 | 3300026088 | Bacteria | 1144 |
| 205 | Ga0207648_10088545 | 3300026089 | Bacteria | 2703 |
| 206 | Ga0207648_10116426 | 3300026089 | Bacteria | 2349 |
| 207 | Ga0207648_10176754 | 3300026089 | Bacteria | 1888 |
| 208 | Ga0207676_10105274 | 3300026095 | Bacteria | 2348 |
| 209 | Ga0207676_10541899 | 3300026095 | Unclassified | 1111 |
| 210 | Ga0207675_100185114 | 3300026118 | Bacteria | 1996 |
| 211 | Ga0207675_101915136 | 3300026118 | Bacteria | 611 |
| 212 | Ga0207683_10044807 | 3300026121 | Bacteria | 3868 |
| 213 | Ga0207683_10053158 | 3300026121 | Bacteria | 3551 |
| 214 | Ga0207683_10193063 | 3300026121 | Bacteria | 1849 |
| 215 | Ga0207698_10077709 | 3300026142 | Bacteria | 2662 |
| 216 | Ga0207698_10718852 | 3300026142 | Bacteria | 995 |
| 217 | Ga0268265_10304300 | 3300028380 | Bacteria | 1437 |
| 218 | Ga0268264_10028578 | 3300028381 | Bacteria | 4562 |
| 219 | Ga0307408_101016660 | 3300031548 | Bacteria | 765 |
| 220 | Ga0265314_10030909 | 3300031711 | Unclassified | 3960 |
| 221 | Ga0307413_10268292 | 3300031824 | Bacteria | 1276 |
| 222 | Ga0307410_10180270 | 3300031852 | Bacteria | 1599 |
| 223 | Ga0307410_10266035 | 3300031852 | Bacteria | 1339 |
| 224 | Ga0307406_10563412 | 3300031901 | Bacteria | 934 |
| 225 | Ga0307407_10067763 | 3300031903 | Bacteria | 2111 |
| 226 | Ga0307407_10157334 | 3300031903 | Bacteria | 1484 |
| 227 | Ga0307409_100065666 | 3300031995 | Bacteria | 2857 |
| 228 | Ga0307409_100350167 | 3300031995 | Bacteria | 1393 |
| 229 | Ga0307409_101783939 | 3300031995 | Bacteria | 644 |
| 230 | Ga0307416_100183204 | 3300032002 | Bacteria | 1965 |
| 231 | Ga0307416_102215568 | 3300032002 | Bacteria | 651 |
| 232 | Ga0307411_10512981 | 3300032005 | Bacteria | 1016 |
| 233 | Ga0307411_10734988 | 3300032005 | Bacteria | 863 |
| 234 | Ga0307415_100041404 | 3300032126 | Bacteria | 3059 |
| 235 | Ga0373953_0323267 | 3300035117 | Bacteria | 674 |
| 236 | Ga0373946_0221863 | 3300035171 | Bacteria | 913 |
| 237 | Ga0373955_0133676 | 3300035172 | Bacteria | 1450 |
| 238 | Ga0373937_0341418 | 3300036401 | Bacteria | 1418 |
| 239 | Ga0373925_0224031 | 3300037068 | Bacteria | 1502 |
| 240 | Ga0373925_0953542 | 3300037068 | Unclassified | 707 |
| 241 | Ga0436364_0953917 | 3300037853 | Bacteria | 3743 |
| 242 | Ga0436364_1059543 | 3300037853 | Bacteria | 1395 |
| 243 | Ga0395901_0404245 | 3300038443 | Bacteria | 1403 |
| 244 | Ga0436365_0985991 | 3300039437 | Bacteria | 5786 |
| 245 | Ga0436365_1228777 | 3300039437 | Bacteria | 775 |
| 246 | Ga0436363_0557980 | 3300039450 | Bacteria | 939 |
| 247 | Ga0436362_0028083 | 3300039453 | Bacteria | 1305 |
| 248 | Ga0451807_2709540 | 3300041486 | Bacteria | 812 |
| 249 | Ga0466961_0578114 | 3300044693 | Bacteria | 676 |
| 250 | Ga0466963_0005983 | 3300044694 | Bacteria | 7168 |
| 251 | Ga0466964_0023126 | 3300044706 | Bacteria | 2415 |
| 252 | Ga0466971_0042034 | 3300044719 | Bacteria | 2054 |
| 253 | Ga0466959_0063433 | 3300045049 | Bacteria | 2683 |
| 254 | Ga0466959_0485854 | 3300045049 | Bacteria | 835 |
| 255 | Ga0466967_0027656 | 3300045976 | Bacteria | 4720 |
| 256 | Ga0466967_0272488 | 3300045976 | Bacteria | 1622 |
| 257 | Ga0466967_1163735 | 3300045976 | Bacteria | 768 |
| 258 | Ga0495592_0000036 | 3300046454 | Bacteria | 125461 |
| 259 | Ga0495629_0262923 | 3300046459 | Bacteria | 1186 |
| 260 | Ga0495641_0058605 | 3300046461 | Bacteria | 1742 |
| 261 | Ga0495580_0160858 | 3300046472 | Bacteria | 1554 |
| 262 | Ga0495639_0025596 | 3300046475 | Bacteria | 2603 |
| 263 | Ga0495608_0233872 | 3300046511 | Bacteria | 1150 |
| 264 | Ga0495630_0026815 | 3300046517 | Bacteria | 4268 |
| 265 | Ga0495652_0566552 | 3300046529 | Bacteria | 779 |
| 266 | Ga0495586_0326267 | 3300046535 | Bacteria | 881 |
| 267 | Ga0495586_0467574 | 3300046535 | Bacteria | 727 |
| 268 | Ga0495621_0070071 | 3300046539 | Bacteria | 1290 |
| 269 | Ga0495622_0248522 | 3300046557 | Bacteria | 783 |
| 270 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 271 | Ga0495635_0100866 | 3300046663 | Bacteria | 1973 |
| 272 | Ga0495647_0000054 | 3300046681 | Bacteria | 30734 |
| 273 | Ga0495613_0079607 | 3300046689 | Bacteria | 2383 |
| 274 | Ga0495624_0000008 | 3300046690 | Bacteria | 145035 |
| 275 | Ga0495680_0212369 | 3300047322 | Bacteria | 1385 |
| 276 | Ga0495684_0458828 | 3300047471 | Bacteria | 884 |
| 277 | Ga0495593_0105989 | 3300047673 | Bacteria | 1438 |
| 278 | Ga0496100_0352297 | 3300048903 | Bacteria | 1112 |
| 279 | Ga0496100_0521158 | 3300048903 | Bacteria | 917 |
| 280 | Ga0496101_0228867 | 3300048904 | Bacteria | 1445 |
| 281 | Ga0496101_0502494 | 3300048904 | Bacteria | 958 |
| 282 | Ga0496102_0100668 | 3300048905 | Bacteria | 2684 |
| 283 | Ga0496102_0619080 | 3300048905 | Bacteria | 1006 |
| 284 | Ga0496103_0382231 | 3300048906 | Bacteria | 905 |
| 285 | Ga0496104_0252425 | 3300048907 | Bacteria | 1676 |
| 286 | Ga0496106_0000081 | 3300048909 | Bacteria | 76468 |
| 287 | Ga0496106_0056852 | 3300048909 | Bacteria | 2958 |
| 288 | Ga0496106_0210024 | 3300048909 | Bacteria | 1551 |
| 289 | Ga0496106_0925719 | 3300048909 | Bacteria | 687 |
| 290 | Ga0496107_0011995 | 3300048910 | Bacteria | 6048 |
| 291 | Ga0496107_0105438 | 3300048910 | Bacteria | 2069 |
| 292 | Ga0496109_0171539 | 3300048912 | Bacteria | 2035 |
| 293 | Ga0496109_0270270 | 3300048912 | Bacteria | 1602 |
| 294 | Ga0496109_0541443 | 3300048912 | Bacteria | 1098 |
| 295 | Ga0496109_0971043 | 3300048912 | Bacteria | 787 |
| 296 | Ga0496110_0021101 | 3300048913 | Bacteria | 5506 |
| 297 | Ga0496110_0138397 | 3300048913 | Bacteria | 2201 |
| 298 | Ga0496110_0314006 | 3300048913 | Bacteria | 1427 |
| 299 | Ga0496110_0884323 | 3300048913 | Bacteria | 799 |
| 300 | Ga0496110_0936026 | 3300048913 | Bacteria | 773 |
| 301 | Ga0496111_0200161 | 3300048914 | Bacteria | 1485 |
| 302 | Ga0496111_0648849 | 3300048914 | Bacteria | 770 |
| 303 | Ga0496112_0371362 | 3300048915 | Bacteria | 1372 |
| 304 | Ga0496113_0051020 | 3300048916 | Bacteria | 3086 |
| 305 | Ga0496114_0010766 | 3300048917 | Bacteria | 7280 |
| 306 | Ga0496114_0034563 | 3300048917 | Bacteria | 4172 |
| 307 | Ga0496114_0134532 | 3300048917 | Bacteria | 2137 |
| 308 | Ga0496114_0178310 | 3300048917 | Bacteria | 1854 |
| 309 | Ga0496114_0779828 | 3300048917 | Bacteria | 834 |
| 310 | Ga0496114_1094102 | 3300048917 | Unclassified | 682 |
| 311 | Ga0496126_0178243 | 3300048929 | Unclassified | 1807 |
| 312 | Ga0501032_0111260 | 3300049569 | Bacteria | 1812 |
| 313 | Ga0501034_0449365 | 3300049571 | Bacteria | 1207 |
| 314 | Ga0501034_0488310 | 3300049571 | Bacteria | 1146 |
| 315 | Ga0501036_0057589 | 3300049572 | Bacteria | 3292 |
| 316 | Ga0501040_0043870 | 3300049576 | Bacteria | 3048 |
| 317 | Ga0501041_0097738 | 3300049577 | Unclassified | 1815 |
| 318 | Ga0501042_0178997 | 3300049578 | Unclassified | 1529 |
| 319 | Ga0501043_0000112 | 3300049579 | Bacteria | 76249 |
| 320 | Ga0501043_0129274 | 3300049579 | Bacteria | 1980 |
| 321 | Ga0501046_0000146 | 3300049580 | Bacteria | 74204 |
| 322 | Ga0501047_0000192 | 3300049581 | Bacteria | 74300 |
| 323 | Ga0501047_0291777 | 3300049581 | Bacteria | 1475 |
| 324 | Ga0501048_0000874 | 3300049582 | Bacteria | 22228 |
| 325 | Ga0501048_0267153 | 3300049582 | Unclassified | 1215 |
| 326 | Ga0501067_0196085 | 3300049583 | Bacteria | 1125 |
| 327 | Ga0501071_0191426 | 3300049587 | Unclassified | 1534 |
| 328 | Ga0501072_0178816 | 3300049588 | Bacteria | 1692 |
| 329 | Ga0501073_0013610 | 3300049589 | Bacteria | 5917 |
| 330 | Ga0501073_0135376 | 3300049589 | Bacteria | 1708 |
| 331 | Ga0501073_0141081 | 3300049589 | Unclassified | 1670 |
| 332 | Ga0501073_0417164 | 3300049589 | Bacteria | 927 |
| 333 | Ga0501074_0008391 | 3300049590 | Bacteria | 7489 |
| 334 | Ga0501076_0902449 | 3300049592 | Unclassified | 728 |
| 335 | Ga0501077_0185294 | 3300049593 | Bacteria | 1322 |
| 336 | Ga0501079_0034764 | 3300049741 | Bacteria | 3878 |
| 337 | Ga0501079_0091492 | 3300049741 | Bacteria | 2357 |
| 338 | Ga0501080_0144214 | 3300049742 | Bacteria | 2201 |
| 339 | Ga0501080_0174027 | 3300049742 | Bacteria | 1984 |
| 340 | Ga0501081_0013548 | 3300049743 | Bacteria | 5362 |
| 341 | Ga0501081_0039864 | 3300049743 | Bacteria | 3215 |
| 342 | Ga0501083_0206385 | 3300049744 | Unclassified | 1281 |
| 343 | Ga0501035_0172177 | 3300049822 | Bacteria | 1870 |
| 344 | Ga0501044_0072929 | 3300049823 | Bacteria | 3490 |
| 345 | Ga0501045_0001324 | 3300049824 | Bacteria | 16434 |
| 346 | Ga0501045_0033230 | 3300049824 | Bacteria | 3740 |
| 347 | nmdc:mga05p37_238965_c1 | 3300050507 | Bacteria | 2185 |
| 348 | nmdc:mga05p37_36391_c1 | 3300050507 | Bacteria | 6039 |
| 349 | nmdc:mga05p37_564942_c1 | 3300050507 | Bacteria | 1292 |
| 350 | nmdc:mga09592_1055741_c1 | 3300050508 | Bacteria | 677 |
| 351 | nmdc:mga09592_364440_c1 | 3300050508 | Bacteria | 1250 |
| 352 | nmdc:mga0n895_1458675_c1 | 3300050512 | Unclassified | 651 |
| 353 | nmdc:mga0rr50_358447_c1 | 3300050513 | Bacteria | 1227 |
| 354 | nmdc:mga08x19_99706_c1 | 3300050514 | Bacteria | 1926 |
| 355 | nmdc:mga0a205_49845_c2 | 3300050515 | Bacteria | 2151 |
| 356 | nmdc:mga0a205_8030_c1 | 3300050515 | Bacteria | 9593 |
| 357 | Ga0495601_0065184 | 3300053077 | Bacteria | 2318 |
| 358 | Ga0495601_0525079 | 3300053077 | Bacteria | 763 |
| 359 | Ga0495619_0060930 | 3300053085 | Bacteria | 2509 |
| 360 | Ga0501084_0644318 | 3300054114 | Unclassified | 894 |
| 361 | Ga0530510_0017145 | 3300061734 | Bacteria | 5130 |
| 362 | Ga0530510_0335786 | 3300061734 | Bacteria | 1134 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025893 | Ga0207682_10011740 | Ga0207682_100117402 | 151 |
| 2 | 3300039450 | Ga0436363_0557980 | Ga0436363_0557980_271_747 | 152 |
| 3 | 3300053077 | Ga0495601_0525079 | Ga0495601_0525079_261_737 | 152 |
| 4 | 3300011119 | Ga0105246_10105639 | Ga0105246_101056392 | 153 |
| 5 | 3300045976 | Ga0466967_1163735 | Ga0466967_1163735_238_753 | 153 |
| 6 | 3300005338 | Ga0068868_100218880 | Ga0068868_1002188803 | 154 |
| 7 | 3300005344 | Ga0070661_100143160 | Ga0070661_1001431602 | 154 |
| 8 | 3300005354 | Ga0070675_100063326 | Ga0070675_1000633262 | 154 |
| 9 | 3300005355 | Ga0070671_100452512 | Ga0070671_1004525122 | 154 |
| 10 | 3300005457 | Ga0070662_101005100 | Ga0070662_1010051001 | 154 |
| 11 | 3300005543 | Ga0070672_100231462 | Ga0070672_1002314622 | 154 |
| 12 | 3300005616 | Ga0068852_100075477 | Ga0068852_1000754773 | 154 |
| 13 | 3300014969 | Ga0157376_10074496 | Ga0157376_100744963 | 154 |
| 14 | 3300025933 | Ga0207706_10730964 | Ga0207706_107309642 | 154 |
| 15 | 3300025940 | Ga0207691_10179145 | Ga0207691_101791453 | 154 |
| 16 | 3300025944 | Ga0207661_10397016 | Ga0207661_103970161 | 154 |
| 17 | 3300025981 | Ga0207640_10165248 | Ga0207640_101652481 | 154 |
| 18 | 3300026121 | Ga0207683_10044807 | Ga0207683_100448075 | 154 |
| 19 | 3300048912 | Ga0496109_0171539 | Ga0496109_0171539_33_578 | 154 |
| 20 | 3300048913 | Ga0496110_0138397 | Ga0496110_0138397_1620_2165 | 154 |
| 21 | 3300005343 | Ga0070687_100396534 | Ga0070687_1003965342 | 156 |
| 22 | 3300005347 | Ga0070668_100792429 | Ga0070668_1007924291 | 156 |
| 23 | 3300005549 | Ga0070704_100650526 | Ga0070704_1006505261 | 156 |
| 24 | 3300005719 | Ga0068861_100795222 | Ga0068861_1007952222 | 156 |
| 25 | 3300006871 | Ga0075434_100747597 | Ga0075434_1007475971 | 156 |
| 26 | 3300025901 | Ga0207688_10042193 | Ga0207688_100421933 | 156 |
| 27 | 3300025935 | Ga0207709_10632257 | Ga0207709_106322571 | 156 |
| 28 | 3300025972 | Ga0207668_10927495 | Ga0207668_109274952 | 156 |
| 29 | 3300046663 | Ga0495635_0000016 | Ga0495635_0000016_79476_79982 | 156 |
| 30 | 3300048905 | Ga0496102_0100668 | Ga0496102_0100668_1895_2419 | 156 |
| 31 | 3300048906 | Ga0496103_0382231 | Ga0496103_0382231_258_782 | 156 |
| 32 | 3300048909 | Ga0496106_0925719 | Ga0496106_0925719_143_667 | 156 |
| 33 | 3300048912 | Ga0496109_0270270 | Ga0496109_0270270_172_696 | 156 |
| 34 | 3300048913 | Ga0496110_0936026 | Ga0496110_0936026_210_734 | 156 |
| 35 | 3300048914 | Ga0496111_0648849 | Ga0496111_0648849_224_748 | 156 |
| 36 | 3300048915 | Ga0496112_0371362 | Ga0496112_0371362_757_1281 | 156 |
| 37 | 3300048916 | Ga0496113_0051020 | Ga0496113_0051020_1452_1976 | 156 |
| 38 | 3300049583 | Ga0501067_0196085 | Ga0501067_0196085_437_961 | 156 |
| 39 | iso_pu_bacteria | 2509276022 | 2509397749 | 157 |
| 40 | 3300005327 | Ga0070658_10178406 | Ga0070658_101784062 | 158 |
| 41 | 3300005329 | Ga0070683_100368853 | Ga0070683_1003688532 | 158 |
| 42 | 3300005334 | Ga0068869_100360498 | Ga0068869_1003604982 | 158 |
| 43 | 3300005338 | Ga0068868_100119296 | Ga0068868_1001192961 | 158 |
| 44 | 3300005367 | Ga0070667_100150815 | Ga0070667_1001508151 | 158 |
| 45 | 3300005435 | Ga0070714_100019515 | Ga0070714_1000195153 | 158 |
| 46 | 3300005436 | Ga0070713_100016531 | Ga0070713_1000165313 | 158 |
| 47 | 3300005437 | Ga0070710_10113189 | Ga0070710_101131892 | 158 |
| 48 | 3300005535 | Ga0070684_100329353 | Ga0070684_1003293531 | 158 |
| 49 | 3300005547 | Ga0070693_100288281 | Ga0070693_1002882812 | 158 |
| 50 | 3300005614 | Ga0068856_100911300 | Ga0068856_1009113002 | 158 |
| 51 | 3300005834 | Ga0068851_10018002 | Ga0068851_100180022 | 158 |
| 52 | 3300006175 | Ga0070712_100128327 | Ga0070712_1001283272 | 158 |
| 53 | 3300006237 | Ga0097621_100067383 | Ga0097621_1000673831 | 158 |
| 54 | 3300006358 | Ga0068871_100089181 | Ga0068871_1000891812 | 158 |
| 55 | 3300006358 | Ga0068871_100490924 | Ga0068871_1004909242 | 158 |
| 56 | 3300006881 | Ga0068865_100086430 | Ga0068865_1000864302 | 158 |
| 57 | 3300009098 | Ga0105245_10273070 | Ga0105245_102730702 | 158 |
| 58 | 3300009177 | Ga0105248_10081114 | Ga0105248_100811142 | 158 |
| 59 | 3300013308 | Ga0157375_10605398 | Ga0157375_106053981 | 158 |
| 60 | 3300025893 | Ga0207682_10067079 | Ga0207682_100670792 | 158 |
| 61 | 3300025898 | Ga0207692_10121986 | Ga0207692_101219862 | 158 |
| 62 | 3300025901 | Ga0207688_10099390 | Ga0207688_100993901 | 158 |
| 63 | 3300025907 | Ga0207645_10173495 | Ga0207645_101734952 | 158 |
| 64 | 3300025915 | Ga0207693_10154310 | Ga0207693_101543102 | 158 |
| 65 | 3300025928 | Ga0207700_10006144 | Ga0207700_100061444 | 158 |
| 66 | 3300025929 | Ga0207664_10007115 | Ga0207664_100071153 | 158 |
| 67 | 3300025941 | Ga0207711_10276505 | Ga0207711_102765052 | 158 |
| 68 | 3300025942 | Ga0207689_10383026 | Ga0207689_103830261 | 158 |
| 69 | 3300026023 | Ga0207677_10045670 | Ga0207677_100456702 | 158 |
| 70 | 3300026078 | Ga0207702_11368926 | Ga0207702_113689262 | 158 |
| 71 | 3300026142 | Ga0207698_10718852 | Ga0207698_107188522 | 158 |
| 72 | 3300036401 | Ga0373937_0341418 | Ga0373937_0341418_124_648 | 158 |
| 73 | 3300041486 | Ga0451807_2709540 | Ga0451807_2709540_134_679 | 158 |
| 74 | 3300046535 | Ga0495586_0326267 | Ga0495586_0326267_300_824 | 158 |
| 75 | 3300048914 | Ga0496111_0200161 | Ga0496111_0200161_665_1210 | 158 |
| 76 | 3300048917 | Ga0496114_0779828 | Ga0496114_0779828_71_616 | 158 |
| 77 | iso_pu_bacteria | 2874139085 | 2874140719 | 158 |
| 78 | 3300049572 | Ga0501036_0057589 | Ga0501036_0057589_2285_2779 | 159 |
| 79 | 3300049576 | Ga0501040_0043870 | Ga0501040_0043870_178_672 | 159 |
| 80 | 3300049577 | Ga0501041_0097738 | Ga0501041_0097738_171_665 | 159 |
| 81 | 3300049578 | Ga0501042_0178997 | Ga0501042_0178997_171_665 | 159 |
| 82 | 3300049582 | Ga0501048_0267153 | Ga0501048_0267153_279_773 | 159 |
| 83 | 3300049587 | Ga0501071_0191426 | Ga0501071_0191426_999_1493 | 159 |
| 84 | 3300049588 | Ga0501072_0178816 | Ga0501072_0178816_943_1437 | 159 |
| 85 | 3300049589 | Ga0501073_0141081 | Ga0501073_0141081_1100_1594 | 159 |
| 86 | 3300049590 | Ga0501074_0008391 | Ga0501074_0008391_3104_3598 | 159 |
| 87 | 3300049592 | Ga0501076_0902449 | Ga0501076_0902449_209_703 | 159 |
| 88 | 3300049593 | Ga0501077_0185294 | Ga0501077_0185294_634_1128 | 159 |
| 89 | 3300049741 | Ga0501079_0034764 | Ga0501079_0034764_174_668 | 159 |
| 90 | 3300049742 | Ga0501080_0174027 | Ga0501080_0174027_188_682 | 159 |
| 91 | 3300049743 | Ga0501081_0039864 | Ga0501081_0039864_438_932 | 159 |
| 92 | 3300049744 | Ga0501083_0206385 | Ga0501083_0206385_679_1173 | 159 |
| 93 | 3300049822 | Ga0501035_0172177 | Ga0501035_0172177_219_713 | 159 |
| 94 | 3300049824 | Ga0501045_0001324 | Ga0501045_0001324_9594_10088 | 159 |
| 95 | 3300054114 | Ga0501084_0644318 | Ga0501084_0644318_380_874 | 159 |
| 96 | 3300061734 | Ga0530510_0017145 | Ga0530510_0017145_4437_4931 | 159 |
| 97 | 3300049571 | Ga0501034_0449365 | Ga0501034_0449365_75_575 | 160 |
| 98 | 3300049589 | Ga0501073_0135376 | Ga0501073_0135376_1157_1657 | 160 |
| 99 | iso_pu_bacteria | 2513237351 | 2514588201 | 160 |
| 100 | 3300006175 | Ga0070712_100946826 | Ga0070712_1009468262 | 161 |
| 101 | 3300025915 | Ga0207693_10197338 | Ga0207693_101973382 | 161 |
| 102 | 3300031711 | Ga0265314_10030909 | Ga0265314_100309092 | 161 |
| 103 | 3300046557 | Ga0495622_0248522 | Ga0495622_0248522_127_630 | 161 |
| 104 | 3300048917 | Ga0496114_1094102 | Ga0496114_1094102_29_544 | 161 |
| 105 | 3300050512 | nmdc:mga0n895_1458675_c1 | nmdc:mga0n895_1458675_c1_52_552 | 161 |
| 106 | 3300005328 | Ga0070676_10006292 | Ga0070676_100062921 | 162 |
| 107 | 3300005328 | Ga0070676_10010959 | Ga0070676_100109594 | 162 |
| 108 | 3300005331 | Ga0070670_100404726 | Ga0070670_1004047262 | 162 |
| 109 | 3300005334 | Ga0068869_100016849 | Ga0068869_1000168496 | 162 |
| 110 | 3300005335 | Ga0070666_10336983 | Ga0070666_103369831 | 162 |
| 111 | 3300005337 | Ga0070682_101425705 | Ga0070682_1014257051 | 162 |
| 112 | 3300005353 | Ga0070669_100165779 | Ga0070669_1001657793 | 162 |
| 113 | 3300005354 | Ga0070675_100150734 | Ga0070675_1001507343 | 162 |
| 114 | 3300005364 | Ga0070673_100174049 | Ga0070673_1001740492 | 162 |
| 115 | 3300005367 | Ga0070667_100136403 | Ga0070667_1001364031 | 162 |
| 116 | 3300005436 | Ga0070713_100379660 | Ga0070713_1003796603 | 162 |
| 117 | 3300005466 | Ga0070685_10240199 | Ga0070685_102401993 | 162 |
| 118 | 3300005466 | Ga0070685_10792587 | Ga0070685_107925871 | 162 |
| 119 | 3300005543 | Ga0070672_100276195 | Ga0070672_1002761951 | 162 |
| 120 | 3300005543 | Ga0070672_100466542 | Ga0070672_1004665422 | 162 |
| 121 | 3300005544 | Ga0070686_100152678 | Ga0070686_1001526782 | 162 |
| 122 | 3300005544 | Ga0070686_100516333 | Ga0070686_1005163331 | 162 |
| 123 | 3300005548 | Ga0070665_100106336 | Ga0070665_1001063362 | 162 |
| 124 | 3300005548 | Ga0070665_100393435 | Ga0070665_1003934352 | 162 |
| 125 | 3300005615 | Ga0070702_100624857 | Ga0070702_1006248571 | 162 |
| 126 | 3300005616 | Ga0068852_100164541 | Ga0068852_1001645412 | 162 |
| 127 | 3300005617 | Ga0068859_100442046 | Ga0068859_1004420462 | 162 |
| 128 | 3300005718 | Ga0068866_10048106 | Ga0068866_100481063 | 162 |
| 129 | 3300005834 | Ga0068851_10090357 | Ga0068851_100903572 | 162 |
| 130 | 3300005841 | Ga0068863_100000021 | Ga0068863_100000021118 | 162 |
| 131 | 3300005843 | Ga0068860_100012890 | Ga0068860_1000128904 | 162 |
| 132 | 3300005844 | Ga0068862_100136733 | Ga0068862_1001367333 | 162 |
| 133 | 3300006237 | Ga0097621_100045252 | Ga0097621_1000452523 | 162 |
| 134 | 3300006237 | Ga0097621_100662595 | Ga0097621_1006625952 | 162 |
| 135 | 3300006881 | Ga0068865_100056186 | Ga0068865_1000561863 | 162 |
| 136 | 3300006881 | Ga0068865_100162136 | Ga0068865_1001621362 | 162 |
| 137 | 3300006881 | Ga0068865_100538442 | Ga0068865_1005384422 | 162 |
| 138 | 3300006881 | Ga0068865_100969532 | Ga0068865_1009695321 | 162 |
| 139 | 3300006931 | Ga0097620_100442042 | Ga0097620_1004420422 | 162 |
| 140 | 3300009094 | Ga0111539_11243798 | Ga0111539_112437982 | 162 |
| 141 | 3300009098 | Ga0105245_10601366 | Ga0105245_106013662 | 162 |
| 142 | 3300009148 | Ga0105243_10344059 | Ga0105243_103440592 | 162 |
| 143 | 3300009148 | Ga0105243_11722935 | Ga0105243_117229351 | 162 |
| 144 | 3300009148 | Ga0105243_12133977 | Ga0105243_121339771 | 162 |
| 145 | 3300009176 | Ga0105242_10034727 | Ga0105242_100347272 | 162 |
| 146 | 3300009176 | Ga0105242_10049517 | Ga0105242_100495173 | 162 |
| 147 | 3300009176 | Ga0105242_10050281 | Ga0105242_100502812 | 162 |
| 148 | 3300009177 | Ga0105248_10033966 | Ga0105248_100339666 | 162 |
| 149 | 3300009177 | Ga0105248_10119929 | Ga0105248_101199294 | 162 |
| 150 | 3300009177 | Ga0105248_11278278 | Ga0105248_112782781 | 162 |
| 151 | 3300009553 | Ga0105249_10365984 | Ga0105249_103659842 | 162 |
| 152 | 3300011119 | Ga0105246_10479701 | Ga0105246_104797012 | 162 |
| 153 | 3300013296 | Ga0157374_10306095 | Ga0157374_103060952 | 162 |
| 154 | 3300013308 | Ga0157375_10010985 | Ga0157375_100109853 | 162 |
| 155 | 3300014325 | Ga0163163_10425297 | Ga0163163_104252973 | 162 |
| 156 | 3300014968 | Ga0157379_10616720 | Ga0157379_106167202 | 162 |
| 157 | 3300014969 | Ga0157376_11247757 | Ga0157376_112477572 | 162 |
| 158 | 3300017792 | Ga0163161_10115017 | Ga0163161_101150173 | 162 |
| 159 | 3300025321 | Ga0207656_10067128 | Ga0207656_100671282 | 162 |
| 160 | 3300025893 | Ga0207682_10096454 | Ga0207682_100964542 | 162 |
| 161 | 3300025907 | Ga0207645_10001687 | Ga0207645_100016876 | 162 |
| 162 | 3300025907 | Ga0207645_10123091 | Ga0207645_101230912 | 162 |
| 163 | 3300025925 | Ga0207650_10351471 | Ga0207650_103514712 | 162 |
| 164 | 3300025926 | Ga0207659_10236378 | Ga0207659_102363783 | 162 |
| 165 | 3300025933 | Ga0207706_10308249 | Ga0207706_103082492 | 162 |
| 166 | 3300025934 | Ga0207686_10082217 | Ga0207686_100822172 | 162 |
| 167 | 3300025938 | Ga0207704_10019608 | Ga0207704_100196083 | 162 |
| 168 | 3300025938 | Ga0207704_10055900 | Ga0207704_100559002 | 162 |
| 169 | 3300025940 | Ga0207691_10386353 | Ga0207691_103863532 | 162 |
| 170 | 3300025941 | Ga0207711_10071516 | Ga0207711_100715162 | 162 |
| 171 | 3300025942 | Ga0207689_10004266 | Ga0207689_100042668 | 162 |
| 172 | 3300025942 | Ga0207689_10628582 | Ga0207689_106285822 | 162 |
| 173 | 3300025945 | Ga0207679_10172770 | Ga0207679_101727702 | 162 |
| 174 | 3300025986 | Ga0207658_10529600 | Ga0207658_105296001 | 162 |
| 175 | 3300025986 | Ga0207658_10971067 | Ga0207658_109710671 | 162 |
| 176 | 3300026035 | Ga0207703_10593659 | Ga0207703_105936592 | 162 |
| 177 | 3300026088 | Ga0207641_10000151 | Ga0207641_1000015115 | 162 |
| 178 | 3300026089 | Ga0207648_10088545 | Ga0207648_100885453 | 162 |
| 179 | 3300026089 | Ga0207648_10116426 | Ga0207648_101164264 | 162 |
| 180 | 3300026095 | Ga0207676_10541899 | Ga0207676_105418992 | 162 |
| 181 | 3300026118 | Ga0207675_100185114 | Ga0207675_1001851142 | 162 |
| 182 | 3300026121 | Ga0207683_10053158 | Ga0207683_100531583 | 162 |
| 183 | 3300026142 | Ga0207698_10077709 | Ga0207698_100777093 | 162 |
| 184 | 3300028380 | Ga0268265_10304300 | Ga0268265_103043002 | 162 |
| 185 | 3300028381 | Ga0268264_10028578 | Ga0268264_100285781 | 162 |
| 186 | 3300031903 | Ga0307407_10157334 | Ga0307407_101573342 | 162 |
| 187 | 3300032002 | Ga0307416_100183204 | Ga0307416_1001832042 | 162 |
| 188 | 3300035172 | Ga0373955_0133676 | Ga0373955_0133676_568_1071 | 162 |
| 189 | 3300037068 | Ga0373925_0224031 | Ga0373925_0224031_41_544 | 162 |
| 190 | 3300037068 | Ga0373925_0953542 | Ga0373925_0953542_21_524 | 162 |
| 191 | 3300046459 | Ga0495629_0262923 | Ga0495629_0262923_78_581 | 162 |
| 192 | 3300046472 | Ga0495580_0160858 | Ga0495580_0160858_363_866 | 162 |
| 193 | 3300046529 | Ga0495652_0566552 | Ga0495652_0566552_71_574 | 162 |
| 194 | 3300046535 | Ga0495586_0467574 | Ga0495586_0467574_32_535 | 162 |
| 195 | 3300046539 | Ga0495621_0070071 | Ga0495621_0070071_520_1023 | 162 |
| 196 | 3300046663 | Ga0495635_0100866 | Ga0495635_0100866_1000_1503 | 162 |
| 197 | 3300046689 | Ga0495613_0079607 | Ga0495613_0079607_873_1376 | 162 |
| 198 | 3300047322 | Ga0495680_0212369 | Ga0495680_0212369_608_1111 | 162 |
| 199 | 3300047471 | Ga0495684_0458828 | Ga0495684_0458828_73_576 | 162 |
| 200 | 3300048903 | Ga0496100_0352297 | Ga0496100_0352297_592_1095 | 162 |
| 201 | 3300048904 | Ga0496101_0502494 | Ga0496101_0502494_35_538 | 162 |
| 202 | 3300048905 | Ga0496102_0619080 | Ga0496102_0619080_202_705 | 162 |
| 203 | 3300048907 | Ga0496104_0252425 | Ga0496104_0252425_849_1352 | 162 |
| 204 | 3300048909 | Ga0496106_0210024 | Ga0496106_0210024_252_755 | 162 |
| 205 | 3300048910 | Ga0496107_0105438 | Ga0496107_0105438_484_987 | 162 |
| 206 | 3300048912 | Ga0496109_0971043 | Ga0496109_0971043_20_526 | 162 |
| 207 | 3300048913 | Ga0496110_0021101 | Ga0496110_0021101_2033_2536 | 162 |
| 208 | 3300048913 | Ga0496110_0314006 | Ga0496110_0314006_621_1124 | 162 |
| 209 | 3300048917 | Ga0496114_0010766 | Ga0496114_0010766_3887_4390 | 162 |
| 210 | 3300048917 | Ga0496114_0034563 | Ga0496114_0034563_2247_2750 | 162 |
| 211 | 3300049581 | Ga0501047_0291777 | Ga0501047_0291777_372_884 | 162 |
| 212 | 3300049589 | Ga0501073_0013610 | Ga0501073_0013610_94_600 | 162 |
| 213 | 3300049589 | Ga0501073_0417164 | Ga0501073_0417164_162_674 | 162 |
| 214 | 3300049742 | Ga0501080_0144214 | Ga0501080_0144214_48_560 | 162 |
| 215 | 3300053077 | Ga0495601_0065184 | Ga0495601_0065184_269_772 | 162 |
| 216 | 3300053085 | Ga0495619_0060930 | Ga0495619_0060930_990_1493 | 162 |
| 217 | 3300005328 | Ga0070676_10069087 | Ga0070676_100690873 | 163 |
| 218 | 3300005333 | Ga0070677_10009469 | Ga0070677_100094692 | 163 |
| 219 | 3300005340 | Ga0070689_100865107 | Ga0070689_1008651072 | 163 |
| 220 | 3300005344 | Ga0070661_100257593 | Ga0070661_1002575931 | 163 |
| 221 | 3300005364 | Ga0070673_100854546 | Ga0070673_1008545462 | 163 |
| 222 | 3300005365 | Ga0070688_101347788 | Ga0070688_1013477881 | 163 |
| 223 | 3300005366 | Ga0070659_100115870 | Ga0070659_1001158703 | 163 |
| 224 | 3300005455 | Ga0070663_101044653 | Ga0070663_1010446531 | 163 |
| 225 | 3300005471 | Ga0070698_100187833 | Ga0070698_1001878332 | 163 |
| 226 | 3300005535 | Ga0070684_100641830 | Ga0070684_1006418301 | 163 |
| 227 | 3300005536 | Ga0070697_100104866 | Ga0070697_1001048662 | 163 |
| 228 | 3300005549 | Ga0070704_100790065 | Ga0070704_1007900652 | 163 |
| 229 | 3300005563 | Ga0068855_100422070 | Ga0068855_1004220703 | 163 |
| 230 | 3300005564 | Ga0070664_100029360 | Ga0070664_1000293602 | 163 |
| 231 | 3300005564 | Ga0070664_100115003 | Ga0070664_1001150032 | 163 |
| 232 | 3300005614 | Ga0068856_100149407 | Ga0068856_1001494073 | 163 |
| 233 | 3300005614 | Ga0068856_100183806 | Ga0068856_1001838061 | 163 |
| 234 | 3300005719 | Ga0068861_101391290 | Ga0068861_1013912901 | 163 |
| 235 | 3300005843 | Ga0068860_100257116 | Ga0068860_1002571162 | 163 |
| 236 | 3300006880 | Ga0075429_100996397 | Ga0075429_1009963971 | 163 |
| 237 | 3300007076 | Ga0075435_100386059 | Ga0075435_1003860592 | 163 |
| 238 | 3300009098 | Ga0105245_10148407 | Ga0105245_101484072 | 163 |
| 239 | 3300009147 | Ga0114129_10008348 | Ga0114129_1000834814 | 163 |
| 240 | 3300009147 | Ga0114129_11494046 | Ga0114129_114940462 | 163 |
| 241 | 3300009147 | Ga0114129_11724541 | Ga0114129_117245412 | 163 |
| 242 | 3300009176 | Ga0105242_10541004 | Ga0105242_105410041 | 163 |
| 243 | 3300010375 | Ga0105239_11255461 | Ga0105239_112554611 | 163 |
| 244 | 3300011119 | Ga0105246_10904428 | Ga0105246_109044282 | 163 |
| 245 | 3300013296 | Ga0157374_10003347 | Ga0157374_100033472 | 163 |
| 246 | 3300013296 | Ga0157374_10042277 | Ga0157374_100422774 | 163 |
| 247 | 3300013308 | Ga0157375_10233812 | Ga0157375_102338123 | 163 |
| 248 | 3300013308 | Ga0157375_10358610 | Ga0157375_103586103 | 163 |
| 249 | 3300014497 | Ga0182008_10303515 | Ga0182008_103035152 | 163 |
| 250 | 3300014969 | Ga0157376_11194017 | Ga0157376_111940171 | 163 |
| 251 | 3300025899 | Ga0207642_10275805 | Ga0207642_102758052 | 163 |
| 252 | 3300026067 | Ga0207678_10091722 | Ga0207678_100917224 | 163 |
| 253 | 3300031548 | Ga0307408_101016660 | Ga0307408_1010166602 | 163 |
| 254 | 3300031852 | Ga0307410_10266035 | Ga0307410_102660352 | 163 |
| 255 | 3300031901 | Ga0307406_10563412 | Ga0307406_105634122 | 163 |
| 256 | 3300031995 | Ga0307409_100350167 | Ga0307409_1003501672 | 163 |
| 257 | 3300032002 | Ga0307416_102215568 | Ga0307416_1022155681 | 163 |
| 258 | 3300032005 | Ga0307411_10734988 | Ga0307411_107349882 | 163 |
| 259 | 3300037853 | Ga0436364_1059543 | Ga0436364_1059543_863_1369 | 163 |
| 260 | 3300044693 | Ga0466961_0578114 | Ga0466961_0578114_103_609 | 163 |
| 261 | 3300044719 | Ga0466971_0042034 | Ga0466971_0042034_819_1325 | 163 |
| 262 | 3300045049 | Ga0466959_0063433 | Ga0466959_0063433_1366_1872 | 163 |
| 263 | 3300046454 | Ga0495592_0000036 | Ga0495592_0000036_79851_80357 | 163 |
| 264 | 3300046461 | Ga0495641_0058605 | Ga0495641_0058605_430_936 | 163 |
| 265 | 3300046475 | Ga0495639_0025596 | Ga0495639_0025596_341_847 | 163 |
| 266 | 3300046517 | Ga0495630_0026815 | Ga0495630_0026815_3710_4216 | 163 |
| 267 | 3300046681 | Ga0495647_0000054 | Ga0495647_0000054_18690_19196 | 163 |
| 268 | 3300046690 | Ga0495624_0000008 | Ga0495624_0000008_22383_22889 | 163 |
| 269 | 3300047673 | Ga0495593_0105989 | Ga0495593_0105989_125_631 | 163 |
| 270 | 3300048903 | Ga0496100_0521158 | Ga0496100_0521158_10_516 | 163 |
| 271 | 3300048904 | Ga0496101_0228867 | Ga0496101_0228867_530_1036 | 163 |
| 272 | 3300048909 | Ga0496106_0000081 | Ga0496106_0000081_18361_18867 | 163 |
| 273 | 3300048909 | Ga0496106_0056852 | Ga0496106_0056852_2432_2938 | 163 |
| 274 | 3300048910 | Ga0496107_0011995 | Ga0496107_0011995_3644_4150 | 163 |
| 275 | 3300048917 | Ga0496114_0178310 | Ga0496114_0178310_1047_1553 | 163 |
| 276 | 3300049571 | Ga0501034_0488310 | Ga0501034_0488310_465_974 | 163 |
| 277 | 3300049741 | Ga0501079_0091492 | Ga0501079_0091492_1303_1812 | 163 |
| 278 | 3300049743 | Ga0501081_0013548 | Ga0501081_0013548_2022_2531 | 163 |
| 279 | 3300050507 | nmdc:mga05p37_238965_c1 | nmdc:mga05p37_238965_c1_341_856 | 163 |
| 280 | 3300050507 | nmdc:mga05p37_36391_c1 | nmdc:mga05p37_36391_c1_1552_2061 | 163 |
| 281 | 3300050508 | nmdc:mga09592_364440_c1 | nmdc:mga09592_364440_c1_703_1212 | 163 |
| 282 | 3300050513 | nmdc:mga0rr50_358447_c1 | nmdc:mga0rr50_358447_c1_214_720 | 163 |
| 283 | 3300050515 | nmdc:mga0a205_8030_c1 | nmdc:mga0a205_8030_c1_503_1012 | 163 |
| 284 | 3300005293 | Ga0065715_10559163 | Ga0065715_105591632 | 164 |
| 285 | 3300005329 | Ga0070683_100274880 | Ga0070683_1002748802 | 164 |
| 286 | 3300005336 | Ga0070680_100888259 | Ga0070680_1008882592 | 164 |
| 287 | 3300005337 | Ga0070682_100844479 | Ga0070682_1008444792 | 164 |
| 288 | 3300005355 | Ga0070671_100281278 | Ga0070671_1002812782 | 164 |
| 289 | 3300005366 | Ga0070659_100296723 | Ga0070659_1002967232 | 164 |
| 290 | 3300005434 | Ga0070709_10546126 | Ga0070709_105461261 | 164 |
| 291 | 3300005456 | Ga0070678_100916183 | Ga0070678_1009161831 | 164 |
| 292 | 3300005459 | Ga0068867_100102466 | Ga0068867_1001024663 | 164 |
| 293 | 3300005471 | Ga0070698_100003191 | Ga0070698_1000031917 | 164 |
| 294 | 3300005535 | Ga0070684_100109669 | Ga0070684_1001096692 | 164 |
| 295 | 3300005535 | Ga0070684_100448013 | Ga0070684_1004480132 | 164 |
| 296 | 3300005546 | Ga0070696_100351973 | Ga0070696_1003519733 | 164 |
| 297 | 3300005548 | Ga0070665_100383955 | Ga0070665_1003839552 | 164 |
| 298 | 3300005564 | Ga0070664_100635000 | Ga0070664_1006350002 | 164 |
| 299 | 3300005614 | Ga0068856_100465565 | Ga0068856_1004655652 | 164 |
| 300 | 3300005615 | Ga0070702_100275026 | Ga0070702_1002750262 | 164 |
| 301 | 3300005719 | Ga0068861_101959019 | Ga0068861_1019590191 | 164 |
| 302 | 3300005985 | Ga0081539_10062513 | Ga0081539_100625132 | 164 |
| 303 | 3300006173 | Ga0070716_100387364 | Ga0070716_1003873642 | 164 |
| 304 | 3300006358 | Ga0068871_100422021 | Ga0068871_1004220212 | 164 |
| 305 | 3300006914 | Ga0075436_100048619 | Ga0075436_1000486194 | 164 |
| 306 | 3300009147 | Ga0114129_10414403 | Ga0114129_104144033 | 164 |
| 307 | 3300009545 | Ga0105237_10135854 | Ga0105237_101358544 | 164 |
| 308 | 3300013105 | Ga0157369_10844248 | Ga0157369_108442482 | 164 |
| 309 | 3300013296 | Ga0157374_10293551 | Ga0157374_102935512 | 164 |
| 310 | 3300013306 | Ga0163162_10039077 | Ga0163162_100390773 | 164 |
| 311 | 3300014326 | Ga0157380_10000815 | Ga0157380_1000081511 | 164 |
| 312 | 3300025906 | Ga0207699_10064061 | Ga0207699_100640613 | 164 |
| 313 | 3300025916 | Ga0207663_10453302 | Ga0207663_104533022 | 164 |
| 314 | 3300025922 | Ga0207646_10079559 | Ga0207646_100795592 | 164 |
| 315 | 3300025925 | Ga0207650_10135231 | Ga0207650_101352313 | 164 |
| 316 | 3300025928 | Ga0207700_10240199 | Ga0207700_102401992 | 164 |
| 317 | 3300025929 | Ga0207664_10141825 | Ga0207664_101418253 | 164 |
| 318 | 3300025931 | Ga0207644_10029702 | Ga0207644_100297023 | 164 |
| 319 | 3300025932 | Ga0207690_10491416 | Ga0207690_104914162 | 164 |
| 320 | 3300025939 | Ga0207665_10127297 | Ga0207665_101272972 | 164 |
| 321 | 3300025942 | Ga0207689_10027522 | Ga0207689_100275224 | 164 |
| 322 | 3300025945 | Ga0207679_10428806 | Ga0207679_104288062 | 164 |
| 323 | 3300026078 | Ga0207702_10183464 | Ga0207702_101834642 | 164 |
| 324 | 3300026088 | Ga0207641_10532271 | Ga0207641_105322712 | 164 |
| 325 | 3300026089 | Ga0207648_10176754 | Ga0207648_101767543 | 164 |
| 326 | 3300026095 | Ga0207676_10105274 | Ga0207676_101052743 | 164 |
| 327 | 3300026118 | Ga0207675_101915136 | Ga0207675_1019151361 | 164 |
| 328 | 3300026121 | Ga0207683_10193063 | Ga0207683_101930632 | 164 |
| 329 | 3300031824 | Ga0307413_10268292 | Ga0307413_102682922 | 164 |
| 330 | 3300031852 | Ga0307410_10180270 | Ga0307410_101802702 | 164 |
| 331 | 3300031903 | Ga0307407_10067763 | Ga0307407_100677634 | 164 |
| 332 | 3300031995 | Ga0307409_100065666 | Ga0307409_1000656662 | 164 |
| 333 | 3300031995 | Ga0307409_101783939 | Ga0307409_1017839391 | 164 |
| 334 | 3300032005 | Ga0307411_10512981 | Ga0307411_105129812 | 164 |
| 335 | 3300032126 | Ga0307415_100041404 | Ga0307415_1000414045 | 164 |
| 336 | 3300035117 | Ga0373953_0323267 | Ga0373953_0323267_84_593 | 164 |
| 337 | 3300035171 | Ga0373946_0221863 | Ga0373946_0221863_25_534 | 164 |
| 338 | 3300037853 | Ga0436364_0953917 | Ga0436364_0953917_409_921 | 164 |
| 339 | 3300038443 | Ga0395901_0404245 | Ga0395901_0404245_692_1201 | 164 |
| 340 | 3300039437 | Ga0436365_0985991 | Ga0436365_0985991_5188_5697 | 164 |
| 341 | 3300039437 | Ga0436365_1228777 | Ga0436365_1228777_141_653 | 164 |
| 342 | 3300039453 | Ga0436362_0028083 | Ga0436362_0028083_527_1051 | 164 |
| 343 | 3300044694 | Ga0466963_0005983 | Ga0466963_0005983_6027_6539 | 164 |
| 344 | 3300044706 | Ga0466964_0023126 | Ga0466964_0023126_880_1392 | 164 |
| 345 | 3300045049 | Ga0466959_0485854 | Ga0466959_0485854_122_634 | 164 |
| 346 | 3300045976 | Ga0466967_0027656 | Ga0466967_0027656_2688_3200 | 164 |
| 347 | 3300045976 | Ga0466967_0272488 | Ga0466967_0272488_279_791 | 164 |
| 348 | 3300046511 | Ga0495608_0233872 | Ga0495608_0233872_513_1028 | 164 |
| 349 | 3300048912 | Ga0496109_0541443 | Ga0496109_0541443_53_571 | 164 |
| 350 | 3300048913 | Ga0496110_0884323 | Ga0496110_0884323_239_757 | 164 |
| 351 | 3300048917 | Ga0496114_0134532 | Ga0496114_0134532_504_1016 | 164 |
| 352 | 3300048929 | Ga0496126_0178243 | Ga0496126_0178243_889_1410 | 164 |
| 353 | 3300049569 | Ga0501032_0111260 | Ga0501032_0111260_381_893 | 164 |
| 354 | 3300049579 | Ga0501043_0000112 | Ga0501043_0000112_46460_46972 | 164 |
| 355 | 3300049579 | Ga0501043_0129274 | Ga0501043_0129274_757_1266 | 164 |
| 356 | 3300049580 | Ga0501046_0000146 | Ga0501046_0000146_46464_46976 | 164 |
| 357 | 3300049581 | Ga0501047_0000192 | Ga0501047_0000192_27329_27841 | 164 |
| 358 | 3300049582 | Ga0501048_0000874 | Ga0501048_0000874_15950_16462 | 164 |
| 359 | 3300049823 | Ga0501044_0072929 | Ga0501044_0072929_1399_1911 | 164 |
| 360 | 3300049824 | Ga0501045_0033230 | Ga0501045_0033230_2616_3128 | 164 |
| 361 | 3300050507 | nmdc:mga05p37_564942_c1 | nmdc:mga05p37_564942_c1_670_1197 | 164 |
| 362 | 3300050508 | nmdc:mga09592_1055741_c1 | nmdc:mga09592_1055741_c1_26_547 | 164 |
| 363 | 3300050514 | nmdc:mga08x19_99706_c1 | nmdc:mga08x19_99706_c1_887_1408 | 164 |
| 364 | 3300050515 | nmdc:mga0a205_49845_c2 | nmdc:mga0a205_49845_c2_773_1300 | 164 |
| 365 | 3300061734 | Ga0530510_0335786 | Ga0530510_0335786_523_1035 | 164 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vvw-assembly2.cif.gz_B | w0 fused 4-ot wild type symmetric trimer | 0.7253 | 117 | 162 |
| 3mf7-assembly1.cif.gz_A | crystal structure of (r)-oxirane-2-carboxylate inhibited cis-caad | 0.7192 | 111 | 162 |
| 2onf-assembly1.cif.gz_B | crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution | 0.7071 | 31 | 161 |
| 7pnw-assembly1.cif.gz_C | mouse mitochondrial ribosome small subunit lacking m5u modification | 0.7066 | 117 | 161 |
| 6vmi-assembly1.cif.gz_AC | structure of the human mitochondrial ribosome-ef-g1 complex (classiii) | 0.7049 | 117 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2egtA02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7508 | 67 | 160 | 3.30.300.20 |
| 6mjnB02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7289 | 69 | 161 | 3.30.300.20 |
| 2onfB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7251 | 36 | 161 | 3.30.300.20 |
| af_A0A1D6IAQ3_139_360_3.40.50.1440 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Tubulin/FtsZ, GTPase domain | 0.7242 | 128 | 162 | 3.40.50.1440 |
| 2e8fA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.7206 | 39 | 164 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A531KJY7-F1-model_v4 | OsmC family peroxiredoxin | 0.9532 | 1 | 103 |
|
| AF-A0A3L7PN37-F1-model_v4 | OsmC family peroxiredoxin | 0.9499 | 1 | 122 |
|
| AF-A0A7W0NGL8-F1-model_v4 | deleted | 0.9425 | 3 | 149 |
|
| AF-A0A0D1XLZ8-F1-model_v4 | OsmC-like protein | 0.925 | 1 | 154 |
|
| AF-A0A4S0I5V1-F1-model_v4 | deleted | 0.923 | 19 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar