F423626

General Info

Members Datasets Scaffolds Average Seq Length
365 220 362 169

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100662595|Ga0097621_1006625952
Length 191
Sequence MIDDPEAALQSAPRTRRYLIYDPRMNPEELRAIQAPLKATYKTTPEAALITLKAAGRLGEGVTCNVETGKAIARAGLHPATGGDGLSLCSGDMLLEALVACAGVTMNAVSSALGIPIRDGRVFAEGDLDFRGTLGVDKTASVGFQTIRLRFELDTDATEEQLATLYKLTERYCVVFQTLAKPPTMEFRRTV

Samples

Sample ID Description Type Environment
1 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
2 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
3 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.82
Rhizoplane 9.32
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10559163 3300005293 Bacteria 731
2 Ga0070658_10178406 3300005327 Bacteria 1787
3 Ga0070676_10006292 3300005328 Bacteria 6341
4 Ga0070676_10010959 3300005328 Bacteria 4926
5 Ga0070676_10069087 3300005328 Bacteria 2117
6 Ga0070683_100274880 3300005329 Bacteria 1602
7 Ga0070683_100368853 3300005329 Bacteria 1367
8 Ga0070670_100404726 3300005331 Bacteria 1205
9 Ga0070677_10009469 3300005333 Bacteria 3303
10 Ga0068869_100016849 3300005334 Bacteria 4938
11 Ga0068869_100360498 3300005334 Bacteria 1187
12 Ga0070666_10336983 3300005335 Unclassified 1078
13 Ga0070680_100888259 3300005336 Bacteria 769
14 Ga0070682_100844479 3300005337 Bacteria 748
15 Ga0070682_101425705 3300005337 Bacteria 593
16 Ga0068868_100119296 3300005338 Bacteria 2150
17 Ga0068868_100218880 3300005338 Bacteria 1593
18 Ga0070689_100865107 3300005340 Bacteria 798
19 Ga0070687_100396534 3300005343 Bacteria 904
20 Ga0070661_100143160 3300005344 Bacteria 1803
21 Ga0070661_100257593 3300005344 Bacteria 1348
22 Ga0070668_100792429 3300005347 Bacteria 841
23 Ga0070669_100165779 3300005353 Bacteria 1720
24 Ga0070675_100063326 3300005354 Bacteria 3057
25 Ga0070675_100150734 3300005354 Unclassified 1994
26 Ga0070671_100281278 3300005355 Bacteria 1415
27 Ga0070671_100452512 3300005355 Bacteria 1102
28 Ga0070673_100174049 3300005364 Bacteria 1839
29 Ga0070673_100854546 3300005364 Bacteria 842
30 Ga0070688_101347788 3300005365 Bacteria 577
31 Ga0070659_100115870 3300005366 Bacteria 2166
32 Ga0070659_100296723 3300005366 Bacteria 1347
33 Ga0070667_100136403 3300005367 Bacteria 2146
34 Ga0070667_100150815 3300005367 Bacteria 2042
35 Ga0070709_10546126 3300005434 Bacteria 886
36 Ga0070714_100019515 3300005435 Bacteria 5525
37 Ga0070713_100016531 3300005436 Bacteria 5547
38 Ga0070713_100379660 3300005436 Bacteria 1316
39 Ga0070710_10113189 3300005437 Bacteria 1633
40 Ga0070663_101044653 3300005455 Bacteria 712
41 Ga0070678_100916183 3300005456 Bacteria 802
42 Ga0070662_101005100 3300005457 Bacteria 714
43 Ga0068867_100102466 3300005459 Bacteria 2188
44 Ga0070685_10240199 3300005466 Bacteria 1195
45 Ga0070685_10792587 3300005466 Bacteria 698
46 Ga0070698_100003191 3300005471 Bacteria 18080
47 Ga0070698_100187833 3300005471 Unclassified 2004
48 Ga0070684_100109669 3300005535 Bacteria 2474
49 Ga0070684_100329353 3300005535 Bacteria 1403
50 Ga0070684_100448013 3300005535 Bacteria 1193
51 Ga0070684_100641830 3300005535 Bacteria 988
52 Ga0070697_100104866 3300005536 Bacteria 2351
53 Ga0070672_100231462 3300005543 Bacteria 1553
54 Ga0070672_100276195 3300005543 Unclassified 1420
55 Ga0070672_100466542 3300005543 Bacteria 1089
56 Ga0070686_100152678 3300005544 Bacteria 1619
57 Ga0070686_100516333 3300005544 Unclassified 929
58 Ga0070696_100351973 3300005546 Bacteria 1141
59 Ga0070693_100288281 3300005547 Bacteria 1102
60 Ga0070665_100106336 3300005548 Unclassified 2808
61 Ga0070665_100383955 3300005548 Bacteria 1412
62 Ga0070665_100393435 3300005548 Bacteria 1394
63 Ga0070704_100650526 3300005549 Bacteria 930
64 Ga0070704_100790065 3300005549 Bacteria 847
65 Ga0068855_100422070 3300005563 Bacteria 1459
66 Ga0070664_100029360 3300005564 Bacteria 4585
67 Ga0070664_100115003 3300005564 Bacteria 2351
68 Ga0070664_100635000 3300005564 Bacteria 992
69 Ga0068856_100149407 3300005614 Bacteria 2345
70 Ga0068856_100183806 3300005614 Bacteria 2104
71 Ga0068856_100465565 3300005614 Bacteria 1285
72 Ga0068856_100911300 3300005614 Bacteria 898
73 Ga0070702_100275026 3300005615 Bacteria 1153
74 Ga0070702_100624857 3300005615 Bacteria 811
75 Ga0068852_100075477 3300005616 Bacteria 2974
76 Ga0068852_100164541 3300005616 Bacteria 2074
77 Ga0068859_100442046 3300005617 Unclassified 1397
78 Ga0068866_10048106 3300005718 Bacteria 2154
79 Ga0068861_100795222 3300005719 Bacteria 887
80 Ga0068861_101391290 3300005719 Bacteria 685
81 Ga0068861_101959019 3300005719 Bacteria 584
82 Ga0068851_10018002 3300005834 Bacteria 3401
83 Ga0068851_10090357 3300005834 Bacteria 1611
84 Ga0068863_100000021 3300005841 Bacteria 198088
85 Ga0068860_100012890 3300005843 Bacteria 8217
86 Ga0068860_100257116 3300005843 Bacteria 1702
87 Ga0068862_100136733 3300005844 Bacteria 2172
88 Ga0081539_10062513 3300005985 Bacteria 2035
89 Ga0070716_100387364 3300006173 Bacteria 1001
90 Ga0070712_100128327 3300006175 Bacteria 1919
91 Ga0070712_100946826 3300006175 Bacteria 744
92 Ga0097621_100045252 3300006237 Unclassified 3554
93 Ga0097621_100067383 3300006237 Bacteria 2950
94 Ga0097621_100662595 3300006237 Bacteria 958
95 Ga0068871_100089181 3300006358 Bacteria 2566
96 Ga0068871_100422021 3300006358 Bacteria 1191
97 Ga0068871_100490924 3300006358 Bacteria 1106
98 Ga0075434_100747597 3300006871 Bacteria 995
99 Ga0075429_100996397 3300006880 Bacteria 733
100 Ga0068865_100056186 3300006881 Bacteria 2741
101 Ga0068865_100086430 3300006881 Bacteria 2264
102 Ga0068865_100162136 3300006881 Bacteria 1707
103 Ga0068865_100538442 3300006881 Bacteria 979
104 Ga0068865_100969532 3300006881 Bacteria 743
105 Ga0075436_100048619 3300006914 Bacteria 2927
106 Ga0097620_100442042 3300006931 Unclassified 1397
107 Ga0075435_100386059 3300007076 Bacteria 1203
108 Ga0111539_11243798 3300009094 Bacteria 864
109 Ga0105245_10148407 3300009098 Bacteria 2215
110 Ga0105245_10273070 3300009098 Unclassified 1649
111 Ga0105245_10601366 3300009098 Bacteria 1126
112 Ga0114129_10008348 3300009147 Bacteria 14768
113 Ga0114129_10414403 3300009147 Bacteria 1773
114 Ga0114129_11494046 3300009147 Bacteria 830
115 Ga0114129_11724541 3300009147 Bacteria 764
116 Ga0105243_10344059 3300009148 Bacteria 1367
117 Ga0105243_11722935 3300009148 Bacteria 656
118 Ga0105243_12133977 3300009148 Bacteria 596
119 Ga0105242_10034727 3300009176 Bacteria 4043
120 Ga0105242_10049517 3300009176 Bacteria 3420
121 Ga0105242_10050281 3300009176 Bacteria 3393
122 Ga0105242_10541004 3300009176 Bacteria 1115
123 Ga0105248_10033966 3300009177 Bacteria 5701
124 Ga0105248_10081114 3300009177 Bacteria 3647
125 Ga0105248_10119929 3300009177 Bacteria 2967
126 Ga0105248_11278278 3300009177 Bacteria 830
127 Ga0105237_10135854 3300009545 Bacteria 2453
128 Ga0105249_10365984 3300009553 Bacteria 1464
129 Ga0105239_11255461 3300010375 Unclassified 854
130 Ga0105246_10105639 3300011119 Bacteria 2058
131 Ga0105246_10479701 3300011119 Bacteria 1052
132 Ga0105246_10904428 3300011119 Bacteria 792
133 Ga0157369_10844248 3300013105 Bacteria 940
134 Ga0157374_10003347 3300013296 Bacteria 13463
135 Ga0157374_10042277 3300013296 Bacteria 4203
136 Ga0157374_10293551 3300013296 Bacteria 1607
137 Ga0157374_10306095 3300013296 Bacteria 1573
138 Ga0163162_10039077 3300013306 Bacteria 4739
139 Ga0157375_10010985 3300013308 Bacteria 7986
140 Ga0157375_10233812 3300013308 Bacteria 1997
141 Ga0157375_10358610 3300013308 Bacteria 1624
142 Ga0157375_10605398 3300013308 Bacteria 1255
143 Ga0163163_10425297 3300014325 Bacteria 1387
144 Ga0157380_10000815 3300014326 Bacteria 19534
145 Ga0182008_10303515 3300014497 Bacteria 836
146 Ga0157379_10616720 3300014968 Bacteria 1014
147 Ga0157376_10074496 3300014969 Bacteria 2894
148 Ga0157376_11194017 3300014969 Unclassified 789
149 Ga0157376_11247757 3300014969 Bacteria 772
150 Ga0163161_10115017 3300017792 Bacteria 2016
151 Ga0207656_10067128 3300025321 Bacteria 1587
152 Ga0207682_10011740 3300025893 Bacteria 3423
153 Ga0207682_10067079 3300025893 Bacteria 1513
154 Ga0207682_10096454 3300025893 Bacteria 1288
155 Ga0207692_10121986 3300025898 Bacteria 1461
156 Ga0207642_10275805 3300025899 Bacteria 965
157 Ga0207688_10042193 3300025901 Bacteria 2540
158 Ga0207688_10099390 3300025901 Bacteria 1678
159 Ga0207699_10064061 3300025906 Bacteria 2223
160 Ga0207645_10001687 3300025907 Bacteria 17921
161 Ga0207645_10123091 3300025907 Bacteria 1685
162 Ga0207645_10173495 3300025907 Bacteria 1414
163 Ga0207693_10154310 3300025915 Bacteria 1806
164 Ga0207693_10197338 3300025915 Bacteria 1583
165 Ga0207663_10453302 3300025916 Bacteria 990
166 Ga0207646_10079559 3300025922 Bacteria 2930
167 Ga0207650_10135231 3300025925 Bacteria 1933
168 Ga0207650_10351471 3300025925 Bacteria 1213
169 Ga0207659_10236378 3300025926 Bacteria 1476
170 Ga0207700_10006144 3300025928 Bacteria 7233
171 Ga0207700_10240199 3300025928 Bacteria 1544
172 Ga0207664_10007115 3300025929 Bacteria 7755
173 Ga0207664_10141825 3300025929 Bacteria 2033
174 Ga0207644_10029702 3300025931 Bacteria 3795
175 Ga0207690_10491416 3300025932 Bacteria 992
176 Ga0207706_10308249 3300025933 Bacteria 1379
177 Ga0207706_10730964 3300025933 Bacteria 844
178 Ga0207686_10082217 3300025934 Bacteria 2105
179 Ga0207709_10632257 3300025935 Bacteria 850
180 Ga0207704_10019608 3300025938 Bacteria 3556
181 Ga0207704_10055900 3300025938 Bacteria 2414
182 Ga0207665_10127297 3300025939 Bacteria 1804
183 Ga0207691_10179145 3300025940 Unclassified 1852
184 Ga0207691_10386353 3300025940 Bacteria 1195
185 Ga0207711_10071516 3300025941 Bacteria 3010
186 Ga0207711_10276505 3300025941 Bacteria 1546
187 Ga0207689_10004266 3300025942 Bacteria 13005
188 Ga0207689_10027522 3300025942 Bacteria 4758
189 Ga0207689_10383026 3300025942 Bacteria 1171
190 Ga0207689_10628582 3300025942 Bacteria 904
191 Ga0207661_10397016 3300025944 Unclassified 1250
192 Ga0207679_10172770 3300025945 Bacteria 1781
193 Ga0207679_10428806 3300025945 Bacteria 1168
194 Ga0207668_10927495 3300025972 Bacteria 776
195 Ga0207640_10165248 3300025981 Bacteria 1643
196 Ga0207658_10529600 3300025986 Bacteria 1052
197 Ga0207658_10971067 3300025986 Unclassified 775
198 Ga0207677_10045670 3300026023 Bacteria 2926
199 Ga0207703_10593659 3300026035 Bacteria 1047
200 Ga0207678_10091722 3300026067 Bacteria 2597
201 Ga0207702_10183464 3300026078 Bacteria 1929
202 Ga0207702_11368926 3300026078 Bacteria 702
203 Ga0207641_10000151 3300026088 Bacteria 99225
204 Ga0207641_10532271 3300026088 Bacteria 1144
205 Ga0207648_10088545 3300026089 Bacteria 2703
206 Ga0207648_10116426 3300026089 Bacteria 2349
207 Ga0207648_10176754 3300026089 Bacteria 1888
208 Ga0207676_10105274 3300026095 Bacteria 2348
209 Ga0207676_10541899 3300026095 Unclassified 1111
210 Ga0207675_100185114 3300026118 Bacteria 1996
211 Ga0207675_101915136 3300026118 Bacteria 611
212 Ga0207683_10044807 3300026121 Bacteria 3868
213 Ga0207683_10053158 3300026121 Bacteria 3551
214 Ga0207683_10193063 3300026121 Bacteria 1849
215 Ga0207698_10077709 3300026142 Bacteria 2662
216 Ga0207698_10718852 3300026142 Bacteria 995
217 Ga0268265_10304300 3300028380 Bacteria 1437
218 Ga0268264_10028578 3300028381 Bacteria 4562
219 Ga0307408_101016660 3300031548 Bacteria 765
220 Ga0265314_10030909 3300031711 Unclassified 3960
221 Ga0307413_10268292 3300031824 Bacteria 1276
222 Ga0307410_10180270 3300031852 Bacteria 1599
223 Ga0307410_10266035 3300031852 Bacteria 1339
224 Ga0307406_10563412 3300031901 Bacteria 934
225 Ga0307407_10067763 3300031903 Bacteria 2111
226 Ga0307407_10157334 3300031903 Bacteria 1484
227 Ga0307409_100065666 3300031995 Bacteria 2857
228 Ga0307409_100350167 3300031995 Bacteria 1393
229 Ga0307409_101783939 3300031995 Bacteria 644
230 Ga0307416_100183204 3300032002 Bacteria 1965
231 Ga0307416_102215568 3300032002 Bacteria 651
232 Ga0307411_10512981 3300032005 Bacteria 1016
233 Ga0307411_10734988 3300032005 Bacteria 863
234 Ga0307415_100041404 3300032126 Bacteria 3059
235 Ga0373953_0323267 3300035117 Bacteria 674
236 Ga0373946_0221863 3300035171 Bacteria 913
237 Ga0373955_0133676 3300035172 Bacteria 1450
238 Ga0373937_0341418 3300036401 Bacteria 1418
239 Ga0373925_0224031 3300037068 Bacteria 1502
240 Ga0373925_0953542 3300037068 Unclassified 707
241 Ga0436364_0953917 3300037853 Bacteria 3743
242 Ga0436364_1059543 3300037853 Bacteria 1395
243 Ga0395901_0404245 3300038443 Bacteria 1403
244 Ga0436365_0985991 3300039437 Bacteria 5786
245 Ga0436365_1228777 3300039437 Bacteria 775
246 Ga0436363_0557980 3300039450 Bacteria 939
247 Ga0436362_0028083 3300039453 Bacteria 1305
248 Ga0451807_2709540 3300041486 Bacteria 812
249 Ga0466961_0578114 3300044693 Bacteria 676
250 Ga0466963_0005983 3300044694 Bacteria 7168
251 Ga0466964_0023126 3300044706 Bacteria 2415
252 Ga0466971_0042034 3300044719 Bacteria 2054
253 Ga0466959_0063433 3300045049 Bacteria 2683
254 Ga0466959_0485854 3300045049 Bacteria 835
255 Ga0466967_0027656 3300045976 Bacteria 4720
256 Ga0466967_0272488 3300045976 Bacteria 1622
257 Ga0466967_1163735 3300045976 Bacteria 768
258 Ga0495592_0000036 3300046454 Bacteria 125461
259 Ga0495629_0262923 3300046459 Bacteria 1186
260 Ga0495641_0058605 3300046461 Bacteria 1742
261 Ga0495580_0160858 3300046472 Bacteria 1554
262 Ga0495639_0025596 3300046475 Bacteria 2603
263 Ga0495608_0233872 3300046511 Bacteria 1150
264 Ga0495630_0026815 3300046517 Bacteria 4268
265 Ga0495652_0566552 3300046529 Bacteria 779
266 Ga0495586_0326267 3300046535 Bacteria 881
267 Ga0495586_0467574 3300046535 Bacteria 727
268 Ga0495621_0070071 3300046539 Bacteria 1290
269 Ga0495622_0248522 3300046557 Bacteria 783
270 Ga0495635_0000016 3300046663 Bacteria 214088
271 Ga0495635_0100866 3300046663 Bacteria 1973
272 Ga0495647_0000054 3300046681 Bacteria 30734
273 Ga0495613_0079607 3300046689 Bacteria 2383
274 Ga0495624_0000008 3300046690 Bacteria 145035
275 Ga0495680_0212369 3300047322 Bacteria 1385
276 Ga0495684_0458828 3300047471 Bacteria 884
277 Ga0495593_0105989 3300047673 Bacteria 1438
278 Ga0496100_0352297 3300048903 Bacteria 1112
279 Ga0496100_0521158 3300048903 Bacteria 917
280 Ga0496101_0228867 3300048904 Bacteria 1445
281 Ga0496101_0502494 3300048904 Bacteria 958
282 Ga0496102_0100668 3300048905 Bacteria 2684
283 Ga0496102_0619080 3300048905 Bacteria 1006
284 Ga0496103_0382231 3300048906 Bacteria 905
285 Ga0496104_0252425 3300048907 Bacteria 1676
286 Ga0496106_0000081 3300048909 Bacteria 76468
287 Ga0496106_0056852 3300048909 Bacteria 2958
288 Ga0496106_0210024 3300048909 Bacteria 1551
289 Ga0496106_0925719 3300048909 Bacteria 687
290 Ga0496107_0011995 3300048910 Bacteria 6048
291 Ga0496107_0105438 3300048910 Bacteria 2069
292 Ga0496109_0171539 3300048912 Bacteria 2035
293 Ga0496109_0270270 3300048912 Bacteria 1602
294 Ga0496109_0541443 3300048912 Bacteria 1098
295 Ga0496109_0971043 3300048912 Bacteria 787
296 Ga0496110_0021101 3300048913 Bacteria 5506
297 Ga0496110_0138397 3300048913 Bacteria 2201
298 Ga0496110_0314006 3300048913 Bacteria 1427
299 Ga0496110_0884323 3300048913 Bacteria 799
300 Ga0496110_0936026 3300048913 Bacteria 773
301 Ga0496111_0200161 3300048914 Bacteria 1485
302 Ga0496111_0648849 3300048914 Bacteria 770
303 Ga0496112_0371362 3300048915 Bacteria 1372
304 Ga0496113_0051020 3300048916 Bacteria 3086
305 Ga0496114_0010766 3300048917 Bacteria 7280
306 Ga0496114_0034563 3300048917 Bacteria 4172
307 Ga0496114_0134532 3300048917 Bacteria 2137
308 Ga0496114_0178310 3300048917 Bacteria 1854
309 Ga0496114_0779828 3300048917 Bacteria 834
310 Ga0496114_1094102 3300048917 Unclassified 682
311 Ga0496126_0178243 3300048929 Unclassified 1807
312 Ga0501032_0111260 3300049569 Bacteria 1812
313 Ga0501034_0449365 3300049571 Bacteria 1207
314 Ga0501034_0488310 3300049571 Bacteria 1146
315 Ga0501036_0057589 3300049572 Bacteria 3292
316 Ga0501040_0043870 3300049576 Bacteria 3048
317 Ga0501041_0097738 3300049577 Unclassified 1815
318 Ga0501042_0178997 3300049578 Unclassified 1529
319 Ga0501043_0000112 3300049579 Bacteria 76249
320 Ga0501043_0129274 3300049579 Bacteria 1980
321 Ga0501046_0000146 3300049580 Bacteria 74204
322 Ga0501047_0000192 3300049581 Bacteria 74300
323 Ga0501047_0291777 3300049581 Bacteria 1475
324 Ga0501048_0000874 3300049582 Bacteria 22228
325 Ga0501048_0267153 3300049582 Unclassified 1215
326 Ga0501067_0196085 3300049583 Bacteria 1125
327 Ga0501071_0191426 3300049587 Unclassified 1534
328 Ga0501072_0178816 3300049588 Bacteria 1692
329 Ga0501073_0013610 3300049589 Bacteria 5917
330 Ga0501073_0135376 3300049589 Bacteria 1708
331 Ga0501073_0141081 3300049589 Unclassified 1670
332 Ga0501073_0417164 3300049589 Bacteria 927
333 Ga0501074_0008391 3300049590 Bacteria 7489
334 Ga0501076_0902449 3300049592 Unclassified 728
335 Ga0501077_0185294 3300049593 Bacteria 1322
336 Ga0501079_0034764 3300049741 Bacteria 3878
337 Ga0501079_0091492 3300049741 Bacteria 2357
338 Ga0501080_0144214 3300049742 Bacteria 2201
339 Ga0501080_0174027 3300049742 Bacteria 1984
340 Ga0501081_0013548 3300049743 Bacteria 5362
341 Ga0501081_0039864 3300049743 Bacteria 3215
342 Ga0501083_0206385 3300049744 Unclassified 1281
343 Ga0501035_0172177 3300049822 Bacteria 1870
344 Ga0501044_0072929 3300049823 Bacteria 3490
345 Ga0501045_0001324 3300049824 Bacteria 16434
346 Ga0501045_0033230 3300049824 Bacteria 3740
347 nmdc:mga05p37_238965_c1 3300050507 Bacteria 2185
348 nmdc:mga05p37_36391_c1 3300050507 Bacteria 6039
349 nmdc:mga05p37_564942_c1 3300050507 Bacteria 1292
350 nmdc:mga09592_1055741_c1 3300050508 Bacteria 677
351 nmdc:mga09592_364440_c1 3300050508 Bacteria 1250
352 nmdc:mga0n895_1458675_c1 3300050512 Unclassified 651
353 nmdc:mga0rr50_358447_c1 3300050513 Bacteria 1227
354 nmdc:mga08x19_99706_c1 3300050514 Bacteria 1926
355 nmdc:mga0a205_49845_c2 3300050515 Bacteria 2151
356 nmdc:mga0a205_8030_c1 3300050515 Bacteria 9593
357 Ga0495601_0065184 3300053077 Bacteria 2318
358 Ga0495601_0525079 3300053077 Bacteria 763
359 Ga0495619_0060930 3300053085 Bacteria 2509
360 Ga0501084_0644318 3300054114 Unclassified 894
361 Ga0530510_0017145 3300061734 Bacteria 5130
362 Ga0530510_0335786 3300061734 Bacteria 1134

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10011740 Ga0207682_100117402 151
2 3300039450 Ga0436363_0557980 Ga0436363_0557980_271_747 152
3 3300053077 Ga0495601_0525079 Ga0495601_0525079_261_737 152
4 3300011119 Ga0105246_10105639 Ga0105246_101056392 153
5 3300045976 Ga0466967_1163735 Ga0466967_1163735_238_753 153
6 3300005338 Ga0068868_100218880 Ga0068868_1002188803 154
7 3300005344 Ga0070661_100143160 Ga0070661_1001431602 154
8 3300005354 Ga0070675_100063326 Ga0070675_1000633262 154
9 3300005355 Ga0070671_100452512 Ga0070671_1004525122 154
10 3300005457 Ga0070662_101005100 Ga0070662_1010051001 154
11 3300005543 Ga0070672_100231462 Ga0070672_1002314622 154
12 3300005616 Ga0068852_100075477 Ga0068852_1000754773 154
13 3300014969 Ga0157376_10074496 Ga0157376_100744963 154
14 3300025933 Ga0207706_10730964 Ga0207706_107309642 154
15 3300025940 Ga0207691_10179145 Ga0207691_101791453 154
16 3300025944 Ga0207661_10397016 Ga0207661_103970161 154
17 3300025981 Ga0207640_10165248 Ga0207640_101652481 154
18 3300026121 Ga0207683_10044807 Ga0207683_100448075 154
19 3300048912 Ga0496109_0171539 Ga0496109_0171539_33_578 154
20 3300048913 Ga0496110_0138397 Ga0496110_0138397_1620_2165 154
21 3300005343 Ga0070687_100396534 Ga0070687_1003965342 156
22 3300005347 Ga0070668_100792429 Ga0070668_1007924291 156
23 3300005549 Ga0070704_100650526 Ga0070704_1006505261 156
24 3300005719 Ga0068861_100795222 Ga0068861_1007952222 156
25 3300006871 Ga0075434_100747597 Ga0075434_1007475971 156
26 3300025901 Ga0207688_10042193 Ga0207688_100421933 156
27 3300025935 Ga0207709_10632257 Ga0207709_106322571 156
28 3300025972 Ga0207668_10927495 Ga0207668_109274952 156
29 3300046663 Ga0495635_0000016 Ga0495635_0000016_79476_79982 156
30 3300048905 Ga0496102_0100668 Ga0496102_0100668_1895_2419 156
31 3300048906 Ga0496103_0382231 Ga0496103_0382231_258_782 156
32 3300048909 Ga0496106_0925719 Ga0496106_0925719_143_667 156
33 3300048912 Ga0496109_0270270 Ga0496109_0270270_172_696 156
34 3300048913 Ga0496110_0936026 Ga0496110_0936026_210_734 156
35 3300048914 Ga0496111_0648849 Ga0496111_0648849_224_748 156
36 3300048915 Ga0496112_0371362 Ga0496112_0371362_757_1281 156
37 3300048916 Ga0496113_0051020 Ga0496113_0051020_1452_1976 156
38 3300049583 Ga0501067_0196085 Ga0501067_0196085_437_961 156
39 iso_pu_bacteria 2509276022 2509397749 157
40 3300005327 Ga0070658_10178406 Ga0070658_101784062 158
41 3300005329 Ga0070683_100368853 Ga0070683_1003688532 158
42 3300005334 Ga0068869_100360498 Ga0068869_1003604982 158
43 3300005338 Ga0068868_100119296 Ga0068868_1001192961 158
44 3300005367 Ga0070667_100150815 Ga0070667_1001508151 158
45 3300005435 Ga0070714_100019515 Ga0070714_1000195153 158
46 3300005436 Ga0070713_100016531 Ga0070713_1000165313 158
47 3300005437 Ga0070710_10113189 Ga0070710_101131892 158
48 3300005535 Ga0070684_100329353 Ga0070684_1003293531 158
49 3300005547 Ga0070693_100288281 Ga0070693_1002882812 158
50 3300005614 Ga0068856_100911300 Ga0068856_1009113002 158
51 3300005834 Ga0068851_10018002 Ga0068851_100180022 158
52 3300006175 Ga0070712_100128327 Ga0070712_1001283272 158
53 3300006237 Ga0097621_100067383 Ga0097621_1000673831 158
54 3300006358 Ga0068871_100089181 Ga0068871_1000891812 158
55 3300006358 Ga0068871_100490924 Ga0068871_1004909242 158
56 3300006881 Ga0068865_100086430 Ga0068865_1000864302 158
57 3300009098 Ga0105245_10273070 Ga0105245_102730702 158
58 3300009177 Ga0105248_10081114 Ga0105248_100811142 158
59 3300013308 Ga0157375_10605398 Ga0157375_106053981 158
60 3300025893 Ga0207682_10067079 Ga0207682_100670792 158
61 3300025898 Ga0207692_10121986 Ga0207692_101219862 158
62 3300025901 Ga0207688_10099390 Ga0207688_100993901 158
63 3300025907 Ga0207645_10173495 Ga0207645_101734952 158
64 3300025915 Ga0207693_10154310 Ga0207693_101543102 158
65 3300025928 Ga0207700_10006144 Ga0207700_100061444 158
66 3300025929 Ga0207664_10007115 Ga0207664_100071153 158
67 3300025941 Ga0207711_10276505 Ga0207711_102765052 158
68 3300025942 Ga0207689_10383026 Ga0207689_103830261 158
69 3300026023 Ga0207677_10045670 Ga0207677_100456702 158
70 3300026078 Ga0207702_11368926 Ga0207702_113689262 158
71 3300026142 Ga0207698_10718852 Ga0207698_107188522 158
72 3300036401 Ga0373937_0341418 Ga0373937_0341418_124_648 158
73 3300041486 Ga0451807_2709540 Ga0451807_2709540_134_679 158
74 3300046535 Ga0495586_0326267 Ga0495586_0326267_300_824 158
75 3300048914 Ga0496111_0200161 Ga0496111_0200161_665_1210 158
76 3300048917 Ga0496114_0779828 Ga0496114_0779828_71_616 158
77 iso_pu_bacteria 2874139085 2874140719 158
78 3300049572 Ga0501036_0057589 Ga0501036_0057589_2285_2779 159
79 3300049576 Ga0501040_0043870 Ga0501040_0043870_178_672 159
80 3300049577 Ga0501041_0097738 Ga0501041_0097738_171_665 159
81 3300049578 Ga0501042_0178997 Ga0501042_0178997_171_665 159
82 3300049582 Ga0501048_0267153 Ga0501048_0267153_279_773 159
83 3300049587 Ga0501071_0191426 Ga0501071_0191426_999_1493 159
84 3300049588 Ga0501072_0178816 Ga0501072_0178816_943_1437 159
85 3300049589 Ga0501073_0141081 Ga0501073_0141081_1100_1594 159
86 3300049590 Ga0501074_0008391 Ga0501074_0008391_3104_3598 159
87 3300049592 Ga0501076_0902449 Ga0501076_0902449_209_703 159
88 3300049593 Ga0501077_0185294 Ga0501077_0185294_634_1128 159
89 3300049741 Ga0501079_0034764 Ga0501079_0034764_174_668 159
90 3300049742 Ga0501080_0174027 Ga0501080_0174027_188_682 159
91 3300049743 Ga0501081_0039864 Ga0501081_0039864_438_932 159
92 3300049744 Ga0501083_0206385 Ga0501083_0206385_679_1173 159
93 3300049822 Ga0501035_0172177 Ga0501035_0172177_219_713 159
94 3300049824 Ga0501045_0001324 Ga0501045_0001324_9594_10088 159
95 3300054114 Ga0501084_0644318 Ga0501084_0644318_380_874 159
96 3300061734 Ga0530510_0017145 Ga0530510_0017145_4437_4931 159
97 3300049571 Ga0501034_0449365 Ga0501034_0449365_75_575 160
98 3300049589 Ga0501073_0135376 Ga0501073_0135376_1157_1657 160
99 iso_pu_bacteria 2513237351 2514588201 160
100 3300006175 Ga0070712_100946826 Ga0070712_1009468262 161
101 3300025915 Ga0207693_10197338 Ga0207693_101973382 161
102 3300031711 Ga0265314_10030909 Ga0265314_100309092 161
103 3300046557 Ga0495622_0248522 Ga0495622_0248522_127_630 161
104 3300048917 Ga0496114_1094102 Ga0496114_1094102_29_544 161
105 3300050512 nmdc:mga0n895_1458675_c1 nmdc:mga0n895_1458675_c1_52_552 161
106 3300005328 Ga0070676_10006292 Ga0070676_100062921 162
107 3300005328 Ga0070676_10010959 Ga0070676_100109594 162
108 3300005331 Ga0070670_100404726 Ga0070670_1004047262 162
109 3300005334 Ga0068869_100016849 Ga0068869_1000168496 162
110 3300005335 Ga0070666_10336983 Ga0070666_103369831 162
111 3300005337 Ga0070682_101425705 Ga0070682_1014257051 162
112 3300005353 Ga0070669_100165779 Ga0070669_1001657793 162
113 3300005354 Ga0070675_100150734 Ga0070675_1001507343 162
114 3300005364 Ga0070673_100174049 Ga0070673_1001740492 162
115 3300005367 Ga0070667_100136403 Ga0070667_1001364031 162
116 3300005436 Ga0070713_100379660 Ga0070713_1003796603 162
117 3300005466 Ga0070685_10240199 Ga0070685_102401993 162
118 3300005466 Ga0070685_10792587 Ga0070685_107925871 162
119 3300005543 Ga0070672_100276195 Ga0070672_1002761951 162
120 3300005543 Ga0070672_100466542 Ga0070672_1004665422 162
121 3300005544 Ga0070686_100152678 Ga0070686_1001526782 162
122 3300005544 Ga0070686_100516333 Ga0070686_1005163331 162
123 3300005548 Ga0070665_100106336 Ga0070665_1001063362 162
124 3300005548 Ga0070665_100393435 Ga0070665_1003934352 162
125 3300005615 Ga0070702_100624857 Ga0070702_1006248571 162
126 3300005616 Ga0068852_100164541 Ga0068852_1001645412 162
127 3300005617 Ga0068859_100442046 Ga0068859_1004420462 162
128 3300005718 Ga0068866_10048106 Ga0068866_100481063 162
129 3300005834 Ga0068851_10090357 Ga0068851_100903572 162
130 3300005841 Ga0068863_100000021 Ga0068863_100000021118 162
131 3300005843 Ga0068860_100012890 Ga0068860_1000128904 162
132 3300005844 Ga0068862_100136733 Ga0068862_1001367333 162
133 3300006237 Ga0097621_100045252 Ga0097621_1000452523 162
134 3300006237 Ga0097621_100662595 Ga0097621_1006625952 162
135 3300006881 Ga0068865_100056186 Ga0068865_1000561863 162
136 3300006881 Ga0068865_100162136 Ga0068865_1001621362 162
137 3300006881 Ga0068865_100538442 Ga0068865_1005384422 162
138 3300006881 Ga0068865_100969532 Ga0068865_1009695321 162
139 3300006931 Ga0097620_100442042 Ga0097620_1004420422 162
140 3300009094 Ga0111539_11243798 Ga0111539_112437982 162
141 3300009098 Ga0105245_10601366 Ga0105245_106013662 162
142 3300009148 Ga0105243_10344059 Ga0105243_103440592 162
143 3300009148 Ga0105243_11722935 Ga0105243_117229351 162
144 3300009148 Ga0105243_12133977 Ga0105243_121339771 162
145 3300009176 Ga0105242_10034727 Ga0105242_100347272 162
146 3300009176 Ga0105242_10049517 Ga0105242_100495173 162
147 3300009176 Ga0105242_10050281 Ga0105242_100502812 162
148 3300009177 Ga0105248_10033966 Ga0105248_100339666 162
149 3300009177 Ga0105248_10119929 Ga0105248_101199294 162
150 3300009177 Ga0105248_11278278 Ga0105248_112782781 162
151 3300009553 Ga0105249_10365984 Ga0105249_103659842 162
152 3300011119 Ga0105246_10479701 Ga0105246_104797012 162
153 3300013296 Ga0157374_10306095 Ga0157374_103060952 162
154 3300013308 Ga0157375_10010985 Ga0157375_100109853 162
155 3300014325 Ga0163163_10425297 Ga0163163_104252973 162
156 3300014968 Ga0157379_10616720 Ga0157379_106167202 162
157 3300014969 Ga0157376_11247757 Ga0157376_112477572 162
158 3300017792 Ga0163161_10115017 Ga0163161_101150173 162
159 3300025321 Ga0207656_10067128 Ga0207656_100671282 162
160 3300025893 Ga0207682_10096454 Ga0207682_100964542 162
161 3300025907 Ga0207645_10001687 Ga0207645_100016876 162
162 3300025907 Ga0207645_10123091 Ga0207645_101230912 162
163 3300025925 Ga0207650_10351471 Ga0207650_103514712 162
164 3300025926 Ga0207659_10236378 Ga0207659_102363783 162
165 3300025933 Ga0207706_10308249 Ga0207706_103082492 162
166 3300025934 Ga0207686_10082217 Ga0207686_100822172 162
167 3300025938 Ga0207704_10019608 Ga0207704_100196083 162
168 3300025938 Ga0207704_10055900 Ga0207704_100559002 162
169 3300025940 Ga0207691_10386353 Ga0207691_103863532 162
170 3300025941 Ga0207711_10071516 Ga0207711_100715162 162
171 3300025942 Ga0207689_10004266 Ga0207689_100042668 162
172 3300025942 Ga0207689_10628582 Ga0207689_106285822 162
173 3300025945 Ga0207679_10172770 Ga0207679_101727702 162
174 3300025986 Ga0207658_10529600 Ga0207658_105296001 162
175 3300025986 Ga0207658_10971067 Ga0207658_109710671 162
176 3300026035 Ga0207703_10593659 Ga0207703_105936592 162
177 3300026088 Ga0207641_10000151 Ga0207641_1000015115 162
178 3300026089 Ga0207648_10088545 Ga0207648_100885453 162
179 3300026089 Ga0207648_10116426 Ga0207648_101164264 162
180 3300026095 Ga0207676_10541899 Ga0207676_105418992 162
181 3300026118 Ga0207675_100185114 Ga0207675_1001851142 162
182 3300026121 Ga0207683_10053158 Ga0207683_100531583 162
183 3300026142 Ga0207698_10077709 Ga0207698_100777093 162
184 3300028380 Ga0268265_10304300 Ga0268265_103043002 162
185 3300028381 Ga0268264_10028578 Ga0268264_100285781 162
186 3300031903 Ga0307407_10157334 Ga0307407_101573342 162
187 3300032002 Ga0307416_100183204 Ga0307416_1001832042 162
188 3300035172 Ga0373955_0133676 Ga0373955_0133676_568_1071 162
189 3300037068 Ga0373925_0224031 Ga0373925_0224031_41_544 162
190 3300037068 Ga0373925_0953542 Ga0373925_0953542_21_524 162
191 3300046459 Ga0495629_0262923 Ga0495629_0262923_78_581 162
192 3300046472 Ga0495580_0160858 Ga0495580_0160858_363_866 162
193 3300046529 Ga0495652_0566552 Ga0495652_0566552_71_574 162
194 3300046535 Ga0495586_0467574 Ga0495586_0467574_32_535 162
195 3300046539 Ga0495621_0070071 Ga0495621_0070071_520_1023 162
196 3300046663 Ga0495635_0100866 Ga0495635_0100866_1000_1503 162
197 3300046689 Ga0495613_0079607 Ga0495613_0079607_873_1376 162
198 3300047322 Ga0495680_0212369 Ga0495680_0212369_608_1111 162
199 3300047471 Ga0495684_0458828 Ga0495684_0458828_73_576 162
200 3300048903 Ga0496100_0352297 Ga0496100_0352297_592_1095 162
201 3300048904 Ga0496101_0502494 Ga0496101_0502494_35_538 162
202 3300048905 Ga0496102_0619080 Ga0496102_0619080_202_705 162
203 3300048907 Ga0496104_0252425 Ga0496104_0252425_849_1352 162
204 3300048909 Ga0496106_0210024 Ga0496106_0210024_252_755 162
205 3300048910 Ga0496107_0105438 Ga0496107_0105438_484_987 162
206 3300048912 Ga0496109_0971043 Ga0496109_0971043_20_526 162
207 3300048913 Ga0496110_0021101 Ga0496110_0021101_2033_2536 162
208 3300048913 Ga0496110_0314006 Ga0496110_0314006_621_1124 162
209 3300048917 Ga0496114_0010766 Ga0496114_0010766_3887_4390 162
210 3300048917 Ga0496114_0034563 Ga0496114_0034563_2247_2750 162
211 3300049581 Ga0501047_0291777 Ga0501047_0291777_372_884 162
212 3300049589 Ga0501073_0013610 Ga0501073_0013610_94_600 162
213 3300049589 Ga0501073_0417164 Ga0501073_0417164_162_674 162
214 3300049742 Ga0501080_0144214 Ga0501080_0144214_48_560 162
215 3300053077 Ga0495601_0065184 Ga0495601_0065184_269_772 162
216 3300053085 Ga0495619_0060930 Ga0495619_0060930_990_1493 162
217 3300005328 Ga0070676_10069087 Ga0070676_100690873 163
218 3300005333 Ga0070677_10009469 Ga0070677_100094692 163
219 3300005340 Ga0070689_100865107 Ga0070689_1008651072 163
220 3300005344 Ga0070661_100257593 Ga0070661_1002575931 163
221 3300005364 Ga0070673_100854546 Ga0070673_1008545462 163
222 3300005365 Ga0070688_101347788 Ga0070688_1013477881 163
223 3300005366 Ga0070659_100115870 Ga0070659_1001158703 163
224 3300005455 Ga0070663_101044653 Ga0070663_1010446531 163
225 3300005471 Ga0070698_100187833 Ga0070698_1001878332 163
226 3300005535 Ga0070684_100641830 Ga0070684_1006418301 163
227 3300005536 Ga0070697_100104866 Ga0070697_1001048662 163
228 3300005549 Ga0070704_100790065 Ga0070704_1007900652 163
229 3300005563 Ga0068855_100422070 Ga0068855_1004220703 163
230 3300005564 Ga0070664_100029360 Ga0070664_1000293602 163
231 3300005564 Ga0070664_100115003 Ga0070664_1001150032 163
232 3300005614 Ga0068856_100149407 Ga0068856_1001494073 163
233 3300005614 Ga0068856_100183806 Ga0068856_1001838061 163
234 3300005719 Ga0068861_101391290 Ga0068861_1013912901 163
235 3300005843 Ga0068860_100257116 Ga0068860_1002571162 163
236 3300006880 Ga0075429_100996397 Ga0075429_1009963971 163
237 3300007076 Ga0075435_100386059 Ga0075435_1003860592 163
238 3300009098 Ga0105245_10148407 Ga0105245_101484072 163
239 3300009147 Ga0114129_10008348 Ga0114129_1000834814 163
240 3300009147 Ga0114129_11494046 Ga0114129_114940462 163
241 3300009147 Ga0114129_11724541 Ga0114129_117245412 163
242 3300009176 Ga0105242_10541004 Ga0105242_105410041 163
243 3300010375 Ga0105239_11255461 Ga0105239_112554611 163
244 3300011119 Ga0105246_10904428 Ga0105246_109044282 163
245 3300013296 Ga0157374_10003347 Ga0157374_100033472 163
246 3300013296 Ga0157374_10042277 Ga0157374_100422774 163
247 3300013308 Ga0157375_10233812 Ga0157375_102338123 163
248 3300013308 Ga0157375_10358610 Ga0157375_103586103 163
249 3300014497 Ga0182008_10303515 Ga0182008_103035152 163
250 3300014969 Ga0157376_11194017 Ga0157376_111940171 163
251 3300025899 Ga0207642_10275805 Ga0207642_102758052 163
252 3300026067 Ga0207678_10091722 Ga0207678_100917224 163
253 3300031548 Ga0307408_101016660 Ga0307408_1010166602 163
254 3300031852 Ga0307410_10266035 Ga0307410_102660352 163
255 3300031901 Ga0307406_10563412 Ga0307406_105634122 163
256 3300031995 Ga0307409_100350167 Ga0307409_1003501672 163
257 3300032002 Ga0307416_102215568 Ga0307416_1022155681 163
258 3300032005 Ga0307411_10734988 Ga0307411_107349882 163
259 3300037853 Ga0436364_1059543 Ga0436364_1059543_863_1369 163
260 3300044693 Ga0466961_0578114 Ga0466961_0578114_103_609 163
261 3300044719 Ga0466971_0042034 Ga0466971_0042034_819_1325 163
262 3300045049 Ga0466959_0063433 Ga0466959_0063433_1366_1872 163
263 3300046454 Ga0495592_0000036 Ga0495592_0000036_79851_80357 163
264 3300046461 Ga0495641_0058605 Ga0495641_0058605_430_936 163
265 3300046475 Ga0495639_0025596 Ga0495639_0025596_341_847 163
266 3300046517 Ga0495630_0026815 Ga0495630_0026815_3710_4216 163
267 3300046681 Ga0495647_0000054 Ga0495647_0000054_18690_19196 163
268 3300046690 Ga0495624_0000008 Ga0495624_0000008_22383_22889 163
269 3300047673 Ga0495593_0105989 Ga0495593_0105989_125_631 163
270 3300048903 Ga0496100_0521158 Ga0496100_0521158_10_516 163
271 3300048904 Ga0496101_0228867 Ga0496101_0228867_530_1036 163
272 3300048909 Ga0496106_0000081 Ga0496106_0000081_18361_18867 163
273 3300048909 Ga0496106_0056852 Ga0496106_0056852_2432_2938 163
274 3300048910 Ga0496107_0011995 Ga0496107_0011995_3644_4150 163
275 3300048917 Ga0496114_0178310 Ga0496114_0178310_1047_1553 163
276 3300049571 Ga0501034_0488310 Ga0501034_0488310_465_974 163
277 3300049741 Ga0501079_0091492 Ga0501079_0091492_1303_1812 163
278 3300049743 Ga0501081_0013548 Ga0501081_0013548_2022_2531 163
279 3300050507 nmdc:mga05p37_238965_c1 nmdc:mga05p37_238965_c1_341_856 163
280 3300050507 nmdc:mga05p37_36391_c1 nmdc:mga05p37_36391_c1_1552_2061 163
281 3300050508 nmdc:mga09592_364440_c1 nmdc:mga09592_364440_c1_703_1212 163
282 3300050513 nmdc:mga0rr50_358447_c1 nmdc:mga0rr50_358447_c1_214_720 163
283 3300050515 nmdc:mga0a205_8030_c1 nmdc:mga0a205_8030_c1_503_1012 163
284 3300005293 Ga0065715_10559163 Ga0065715_105591632 164
285 3300005329 Ga0070683_100274880 Ga0070683_1002748802 164
286 3300005336 Ga0070680_100888259 Ga0070680_1008882592 164
287 3300005337 Ga0070682_100844479 Ga0070682_1008444792 164
288 3300005355 Ga0070671_100281278 Ga0070671_1002812782 164
289 3300005366 Ga0070659_100296723 Ga0070659_1002967232 164
290 3300005434 Ga0070709_10546126 Ga0070709_105461261 164
291 3300005456 Ga0070678_100916183 Ga0070678_1009161831 164
292 3300005459 Ga0068867_100102466 Ga0068867_1001024663 164
293 3300005471 Ga0070698_100003191 Ga0070698_1000031917 164
294 3300005535 Ga0070684_100109669 Ga0070684_1001096692 164
295 3300005535 Ga0070684_100448013 Ga0070684_1004480132 164
296 3300005546 Ga0070696_100351973 Ga0070696_1003519733 164
297 3300005548 Ga0070665_100383955 Ga0070665_1003839552 164
298 3300005564 Ga0070664_100635000 Ga0070664_1006350002 164
299 3300005614 Ga0068856_100465565 Ga0068856_1004655652 164
300 3300005615 Ga0070702_100275026 Ga0070702_1002750262 164
301 3300005719 Ga0068861_101959019 Ga0068861_1019590191 164
302 3300005985 Ga0081539_10062513 Ga0081539_100625132 164
303 3300006173 Ga0070716_100387364 Ga0070716_1003873642 164
304 3300006358 Ga0068871_100422021 Ga0068871_1004220212 164
305 3300006914 Ga0075436_100048619 Ga0075436_1000486194 164
306 3300009147 Ga0114129_10414403 Ga0114129_104144033 164
307 3300009545 Ga0105237_10135854 Ga0105237_101358544 164
308 3300013105 Ga0157369_10844248 Ga0157369_108442482 164
309 3300013296 Ga0157374_10293551 Ga0157374_102935512 164
310 3300013306 Ga0163162_10039077 Ga0163162_100390773 164
311 3300014326 Ga0157380_10000815 Ga0157380_1000081511 164
312 3300025906 Ga0207699_10064061 Ga0207699_100640613 164
313 3300025916 Ga0207663_10453302 Ga0207663_104533022 164
314 3300025922 Ga0207646_10079559 Ga0207646_100795592 164
315 3300025925 Ga0207650_10135231 Ga0207650_101352313 164
316 3300025928 Ga0207700_10240199 Ga0207700_102401992 164
317 3300025929 Ga0207664_10141825 Ga0207664_101418253 164
318 3300025931 Ga0207644_10029702 Ga0207644_100297023 164
319 3300025932 Ga0207690_10491416 Ga0207690_104914162 164
320 3300025939 Ga0207665_10127297 Ga0207665_101272972 164
321 3300025942 Ga0207689_10027522 Ga0207689_100275224 164
322 3300025945 Ga0207679_10428806 Ga0207679_104288062 164
323 3300026078 Ga0207702_10183464 Ga0207702_101834642 164
324 3300026088 Ga0207641_10532271 Ga0207641_105322712 164
325 3300026089 Ga0207648_10176754 Ga0207648_101767543 164
326 3300026095 Ga0207676_10105274 Ga0207676_101052743 164
327 3300026118 Ga0207675_101915136 Ga0207675_1019151361 164
328 3300026121 Ga0207683_10193063 Ga0207683_101930632 164
329 3300031824 Ga0307413_10268292 Ga0307413_102682922 164
330 3300031852 Ga0307410_10180270 Ga0307410_101802702 164
331 3300031903 Ga0307407_10067763 Ga0307407_100677634 164
332 3300031995 Ga0307409_100065666 Ga0307409_1000656662 164
333 3300031995 Ga0307409_101783939 Ga0307409_1017839391 164
334 3300032005 Ga0307411_10512981 Ga0307411_105129812 164
335 3300032126 Ga0307415_100041404 Ga0307415_1000414045 164
336 3300035117 Ga0373953_0323267 Ga0373953_0323267_84_593 164
337 3300035171 Ga0373946_0221863 Ga0373946_0221863_25_534 164
338 3300037853 Ga0436364_0953917 Ga0436364_0953917_409_921 164
339 3300038443 Ga0395901_0404245 Ga0395901_0404245_692_1201 164
340 3300039437 Ga0436365_0985991 Ga0436365_0985991_5188_5697 164
341 3300039437 Ga0436365_1228777 Ga0436365_1228777_141_653 164
342 3300039453 Ga0436362_0028083 Ga0436362_0028083_527_1051 164
343 3300044694 Ga0466963_0005983 Ga0466963_0005983_6027_6539 164
344 3300044706 Ga0466964_0023126 Ga0466964_0023126_880_1392 164
345 3300045049 Ga0466959_0485854 Ga0466959_0485854_122_634 164
346 3300045976 Ga0466967_0027656 Ga0466967_0027656_2688_3200 164
347 3300045976 Ga0466967_0272488 Ga0466967_0272488_279_791 164
348 3300046511 Ga0495608_0233872 Ga0495608_0233872_513_1028 164
349 3300048912 Ga0496109_0541443 Ga0496109_0541443_53_571 164
350 3300048913 Ga0496110_0884323 Ga0496110_0884323_239_757 164
351 3300048917 Ga0496114_0134532 Ga0496114_0134532_504_1016 164
352 3300048929 Ga0496126_0178243 Ga0496126_0178243_889_1410 164
353 3300049569 Ga0501032_0111260 Ga0501032_0111260_381_893 164
354 3300049579 Ga0501043_0000112 Ga0501043_0000112_46460_46972 164
355 3300049579 Ga0501043_0129274 Ga0501043_0129274_757_1266 164
356 3300049580 Ga0501046_0000146 Ga0501046_0000146_46464_46976 164
357 3300049581 Ga0501047_0000192 Ga0501047_0000192_27329_27841 164
358 3300049582 Ga0501048_0000874 Ga0501048_0000874_15950_16462 164
359 3300049823 Ga0501044_0072929 Ga0501044_0072929_1399_1911 164
360 3300049824 Ga0501045_0033230 Ga0501045_0033230_2616_3128 164
361 3300050507 nmdc:mga05p37_564942_c1 nmdc:mga05p37_564942_c1_670_1197 164
362 3300050508 nmdc:mga09592_1055741_c1 nmdc:mga09592_1055741_c1_26_547 164
363 3300050514 nmdc:mga08x19_99706_c1 nmdc:mga08x19_99706_c1_887_1408 164
364 3300050515 nmdc:mga0a205_49845_c2 nmdc:mga0a205_49845_c2_773_1300 164
365 3300061734 Ga0530510_0335786 Ga0530510_0335786_523_1035 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

82

188

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vvw-assembly2.cif.gz_B w0 fused 4-ot wild type symmetric trimer 0.7253 117 162
3mf7-assembly1.cif.gz_A crystal structure of (r)-oxirane-2-carboxylate inhibited cis-caad 0.7192 111 162
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.7071 31 161
7pnw-assembly1.cif.gz_C mouse mitochondrial ribosome small subunit lacking m5u modification 0.7066 117 161
6vmi-assembly1.cif.gz_AC structure of the human mitochondrial ribosome-ef-g1 complex (classiii) 0.7049 117 162
ID Description Score Start End Superfamily
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7508 67 160 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7289 69 161 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7251 36 161 3.30.300.20
af_A0A1D6IAQ3_139_360_3.40.50.1440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Tubulin/FtsZ, GTPase domain 0.7242 128 162 3.40.50.1440
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7206 39 164 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A531KJY7-F1-model_v4 OsmC family peroxiredoxin 0.9532 1 103
AF-A0A3L7PN37-F1-model_v4 OsmC family peroxiredoxin 0.9499 1 122
AF-A0A7W0NGL8-F1-model_v4 deleted 0.9425 3 149
AF-A0A0D1XLZ8-F1-model_v4 OsmC-like protein 0.925 1 154
AF-A0A4S0I5V1-F1-model_v4 deleted 0.923 19 108

Feature Viewer

pLDDT pTM Quality
89.47 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map